The URL can be used to link to this page

Agenda 09/09/2025 Item #16B 1 (Change Order #2 to agreement #18-7432–CE, “Civil Engineering Category,” with Black & Veatch Corp. for the “Oakes Boulevard Sidewalks and Roundabout” project)9/9/2025 Item # 16.B.1 ID# 2025-2489 Executive Summary Recommendation to approve Change Order No. 2 under Agreement No. 18-7432–CE, “Civil Engineering Category,” with Black & Veatch Corporation for the “Oakes Boulevard Sidewalks and Roundabout” project, adding 300 days and $116,794.74 for the expansion of design needs, and authorizing the Chairman to sign the attached Change Order. (Project No. 60228) OBJECTIVE: To add time and design services, water quality efforts, environmental analysis, and permitting with the South Florida Water Management District (“SFWMD”) for the Oakes Boulevard Sidewalks and Roundabout project to address overall drainage. CONSIDERATIONS: On February 25, 2020 (Agenda Item 16.E.7), the Board approved Agreement No. 18-7432-CE (the “Agreement”), awarding the Professional Services Library Civil Engineering Category to multiple consulting firms, including Black & Veatch Corporation, for use by County departments requiring professional engineering services. On June 24, 2022, the County issued a notice to proceed under this Agreement authorizing Black & Veatch Corporation to design the Oakes Boulevard Sidewalks and Roundabout Project (the “Project”), from Vanderbilt Beach Road to Immokalee Road. The Oakes Boulevard Sidewalks and Roundabout project adds a 6-foot-wide concrete sidewalk on the east side of Oakes Boulevard from Vanderbilt Beach Road to Immokalee Road (approx. two miles) and a roundabout at the corner of Oakes Boulevard and Spanish Oakes Boulevard, while also renovating the existing asphalt sidewalk on the west side of Oakes Boulevard. Change Order No. 1 was administratively approved on February 6, 2024, adding two hundred and thirty-two days and $18,013.18 to related tasks to address residents' concerns related to design elements. Change Order No. 2 adds three hundred days to the Project’s contract time as a result of a wetland corridor that is impacting the Project, which wasn’t apparent at the time the consultant was originally hired for the Project. As a result, additional permitting, associated stormwater design revisions, environmental impact analysis, and the required permitting is now required. Additional funds in the amount of $116,794.74 is necessary to complete the added work, which includes the expansion of the stormwater design, water quality efforts, environmental analysis, and permitting with the Water Management District. The proposed change was not included in the original contract, as the wetland corridor only became a constraint for this project as it developed. This item is consistent with the County’s strategic plan, with the objective to design and maintain an effective transportation system to reduce traffic congestion and improve the mobility of its residents and visitors. FISCAL IMPACT: Funding in the amount of $116,794.74 is available in the Infrastructure Sales Tax Fund (3018), Sidewalks Sales Tax Project (60228). The source of funding is surtax sales. GROWTH MANAGEMENT IMPACT: This recommendation is consistent with the Long-Range Transportation Plan and Objective 1 of the Transportation Element of the Collier County Growth Management Plan to maintain the major roadway system at an acceptable Level of Service. LEGAL CONSIDERATIONS: This item is approved as to form and legality and requires majority vote for Board approval. —SRT RECOMMENDATIONS: To approve Change Order No. 2, adding three hundred days under Agreement No. 18-7432- CE with Black & Veatch Corporation for the “Oaks Boulevard Sidewalks and Roundabout” project, and authorize the Chairman to sign the attached Change Order. (Project No. 60228) PREPARED BY: Katherine Chachere, RLA, Project Manager III (Lic.), Transportation Engineering Division Page 697 of 2661 9/9/2025 Item # 16.B.1 ID# 2025-2489 ATTACHMENTS: 1. 4500218257-Black&Veatch_C#2_Add$_TimeExt CAO 2. NotarizedAffifavit_B&V 3. R10324544 CO 1 Black & Veatch 4. Oakes W.O - 10306100 5. 18-7432-CE Black&Veatch_Contract Page 698 of 2661 Page 699 of 2661 Page 700 of 2661 Page 701 of 2661 Page 702 of 2661 Page 703 of 2661 Page 704 of 2661 Page 705 of 2661 Page 706 of 2661 Revised: 01/14/2021 (Divisions who may require additional signatures may include on separate sheet.) PROCUREMENT USE ONLY Admin BCC Rpt BCC ES Contract Modification Work Order Modification Contract #: Change #: Purchase Order #: Project #: Contractor/Firm Name: Contract/Project: Project Manager Name: r: Division Name: Completion Date, Description of the Task(s) Change, and Rationale for the Change Notice to Proceed Original Last Approved Revised Date Date Completion Date Date (Includes this change) # of Days Added Select Tasks Add new task(s) Delete task(s) Change task(s) Other Provide a response to the following: 1.) detailed and specific explanation/rationale of the requested change(s) to the task(s) and / or the additional days added (if requested); 2.) why this change was not included in the original contract; and, 3.) describe the impact if this change is not processed. Attach additional information from the Design Professional and/or Contractor if needed. Prepared by: ___________________________________________________________________________ Date: ________________ Mark McCleary, PE, PSM, Supervisor Project Management, Transportation Engineering Acceptance of this Change Order shall constitute a modification to contract / work order identified above and will be subject to all the same terms and conditions as contained in the contract / work order indicated above, as fully as if the same were stated in this acceptance. The adjustment, if any, to the Contract shall constitute a full and final settlement of any and all claims of the Contractor / Vendor / Consultant / Design Professional arising out of or related to the change set forth herein, including claims for impact and delay costs. Accepted by: ___________________________________________________________________________ Date: ________________ Rafael E. Frias III, Associate Vice President, Black & Veatch Accepted by: ___________________________________________________________________________ Date: ________________ Jay Ahmad, PE, Division Director, Transportation Engineering Approved by: ___________________________________________________________________________ Date: _______________ Trinity Scott, Department Head, Transportation Management Services Approved by: ___________________________________________________________________________ Date: ________________ Procurement Professional Procurement Services Change Order Form 60228.8 Black & Veatch 4500218257 18-7432 1 Oakes Blvd. Sidewalks and Roundabout Transportation Engineering Mark McCleary TBD *NOTE: A notice to stop work was issued on 6/14/2, leaving 8 days on the original contract/work order. The revised date of completionwill be determined when the work is started again This change order will add days to the contract time because of production and delivery delays due to residents’ concerns relating to design elements of sidewalk location, drainage facilities, school bus stop locations, pathway re-construction and the roundabout design on Oakes Blvd. There is additional cost associated DQGUHDOORFDWLRQZLWKLQWKHWDVNVwith this change. The change being requested was not included in the original contract because more in depth discussion, coordination and preliminary planning was required to identify the best solution(s) for the neighborhood and to complete the intent of the project. If this modification is not processed the current designer cannot complete the project and we would need to procure another design consultant who would have to start over. ; Rafael E. Frias III, PE Digitally signed by Rafael E. Frias III, PE DN: C=US, E=FriasRE@bv.com, O=Black & Veatch Corporation, CN="Rafael E. Frias III, PE" Date: 2024.02.02 09:37:32-05'00' AhmadJay Digitally signed by AhmadJay Date: 2024.02.02 08:41:36 -05'00' Digitally signed by McClearyMark Date: 2024.02.02 08:07:32 -05'00' ted by ved b Page 707 of 2661 Revised: 01/14/2021 (Divisions who may require additional signatures may include on separate sheet.) PROCUREMENT USE ONLY Admin BCC Rpt BCC ES Change Order/Amendment Summary CO# AMD# Description COST TIME Justification Additive (+) Deductive (-) Days Added New Amount 1 Add daysWR 7DVNWKUXDQG UHDOORFDWLRQRIIXQGV DQGLQFUHDVH Needed days to complete project. Page 708 of 2661 Collier County B&V Project 412948 County Project 60228.8 January 22, 2024 Mark McCleary Principal Project Manager Transportation Management Services Department Transportation Engineering Division Subject: Change Order 1 Dear Mr. McCleary: Black & Veatch requests a change order for “Oakes Blvd Sidewalks and Roundabout Project” contract 18- 7432 (CE) “Professional Services Library Civil Engineering Category”, project number 60228.8. The extension would be for an additional 232 days on tasks 1 through 8, bringing the total contract duration from 760 to 992 days. As part of this contract changer order, funds for Tasks 4 & 5 will be reallocated to Tasks 2 & 8. Please note that AIM Engineering & Survey, Ardamen & Associates, and BCC Engineering are part of the original proposal. Black & Veatch also requests additional funds, as shown in Table 1. The scope Change Order 1 will include the addition of several services that were identified during the 30% design of the project: x Based on community feedback, an additional public meeting will be hosted and conducted, including printing revised plans, attending the public meeting, and preparing other meeting material as requested by the county. x During the 30% design, sidewalk alignment was evaluated to determine typical cross-sections for sidewalk options and coordinate with County staff on the various options. The original scope assumed all sidewalks would be placed near the edge of the right-of-way; however, due to the placement of the road, that was not feasible, and the sidewalk would be evaluated to ensure sections and alignments would satisfy resident and county concerns. x During the review of the sidewalk alignments and completion of the survey, it was determined that multiple houses could sheet flow off property to the county's swale. A drainage assessment would need to be completed to confirm the sidewalk location relative to the residents would not cause drainage issues for residents. x From the first public workshop, the County received input from residents that bus stops at each intersection would be preferred to provide a safe place for children to access the school bus. The county has requested that Black & Veatch include the site plan and necessary improvements at seven intersections in their design. x Simplified geotechnical analysis from 10 deep standard penetration tests to hand augers to determine sub-grade material. x Removal of additional subsurface utility exploration as sufficient information was already provided by the surveyor with the utility locates. Page 709 of 2661 Table 1: Fund Reallocation Task Task Name Original Amount Change New Task Amount Task Type 1 Intersection Control Evaluation $9,230.58 $0.00 $9,230.58 LS 2 Design Services $301,104.00 $23,988.00 $325,092.00 LS 3 Survey Services $43,292.00 $0.00 $43,292.00 LS 4 Subsurface Utility Engineering (SUE) $9,677.00 -$4,095.00 $5,582.00 LS 5 Geotechnical Engineering Services $9,887.00 -$2,120.00 $7,767.00 LS 6 Permitting Services $7,593.00 $0.00 $7,593.00 LS 7 Utility Coordination $5,064.00 $0.00 $5,064.00 LS 8 Public Information Meeting $3,803.82 $240.18 $4,044.00 LS 9 Bidding Services, Services During Construction $26,046.00 $0.00 $26,046.00 T&M 10 Allowable Expenses $2,500.00 $0.00 $2,500.00 NTE Total $418,197.40 $18,013.18 $436,210.58 If you have any questions, please get in touch with me at (407) 419-3575. Thank you, Sam Miller, P.E. Project Manager cc: Mark McCleary, Collier County Mark Martin, Black & Veatch Page 710 of 2661 26-Jan-24Title: Senior Project Senior Senior Clerical/Manager Engineer Engineer Designer AdministrativeTotal Total Direct Ardaman & AIM Engineering BCC TotalHourly Rate: $201 $175 $136 $128 $73 Hours Labor Expenses Associates & Surveying Engineeering FeeProject: CR 846E SidewalksTask 2 - Design Services24 33 44 55 5 161 $23,988 $0 $0 $0 $0 $23,988.00Change Order 1 24 33 44 55 5 161 $23,988.00 $0.00Task 4 - Surface Utility Engineering (SUE)0 0 0 0 0 0 $0 $0 $0 -$4,095.00 $0 ($4,095.00)Change Order 1 0 0 0 0 0 0 $0.00 $0.00 ($4,095.00)Task 5 - Geotechnical Services0 0 0 0 0 0 $0 $0 -$2,120.00 $0 $0 ($2,120.00)Change Order 1 0 0 0 0 0 0 $0.00 $0.00 ($2,120.00)Task 8 - Public Information Meeting12 0 0 0 0 12 $2,412 $0 $0 $0 -$2,171.82 $240.18Change Order 1 1212 $2,412.00 ($2,171.82)TOTAL HOURS 36 33 44 55 5 173TOTAL COST $7,236.00 $5,775.00 $5,984.00 $7,040.00 $365.00 $26,400.00 $0 -$2,120.00 -$4,095.00 -$2,171.82$18,013.18Collier CountyOakes Boulevard Sidewalk & Roundabout - Change Order 1Fee Development Schedule - Final EstimateSubconsultantExpensesPage 711 of 2661 3DJHRI :25.25'(5385&+$6(25'(5 &RQWUDFW&(³3URIHVVLRQDO6HUYLFHV/LEUDU\&LYLO(QJLQHHULQJ&DWHJRU\´ &RQWUDFW([SLUDWLRQ'DWH)HEUXDU\ 7KLV:RUN2UGHULVIRUSURIHVVLRQDOFLYLOHQJLQHHULQJVHUYLFHVIRUZRUNNQRZQDV 3URMHFW1DPH2DNHV%OYG6LGHZDONVDQG5RXQGDERXW3URMHFW 3URMHFW1R 7KHZRUNLVVSHFLILHGLQWKHSURSRVDOGDWHG0D\ZKLFKLVDWWDFKHGKHUHWRDQGPDGHDSDUWRI WKLV:RUN2UGHU,QDFFRUGDQFHZLWK7HUPVDQG&RQGLWLRQVRIWKH$JUHHPHQWUHIHUHQFHGDERYHWKLV :RUN2UGHU3XUFKDVH2UGHULVDVVLJQHGWR%ODFN 9HDWFK&RUSRUDWLRQ 6FRSHRI:RUN$VGHWDLOHGLQWKHDWWDFKHGSURSRVDODQGWKHIROORZLQJ 2DNHV%OYG6LGHZDONVDQG5RXQGDERXW3URMHFW±9DQGHUELOW%HDFK5RDGWR,PPRNDOHH5RDG ∗7DVN ,QWHUVHFWLRQ&RQWURO(YDOXDWLRQ±6SDQLVK2DNV/DQHDQG2DNHV%OYG ∗7DVN 'HVLJQ6HUYLFHV ∗7DVN 6XUYH\LQJ6HUYLFHV ∗7DVN 6XEVXUIDFH8WLOLW\(QJLQHHULQJ68( ∗7DVN *HRWHFKQLFDO(QJLQHHULQJ6HUYLFHV ∗7DVN 3HUPLWWLQJ6HUYLFHV ∗7DVN 8WLOLW\&RRUGLQDWLRQ ∗7DVN 3XEOLF,QIRUPDWLRQ0HHWLQJ ∗7DVN %LGGLQJ6HUYLFHV6HUYLFHV'XULQJ&RQVWUXFWLRQ ∗7DVN $OORZDEOH([SHQVHV 6FKHGXOHRI:RUN&RPSOHWHZRUNZLWKLQWKUHHKXQGUHGVL[W\FDOHQGDUGD\VIRU7DVNWKURXJK 7DVNDQGIRXUKXQGUHGFDOHQGDUGD\VIRU7DVNIRUDWRWDORIVHYHQKXQGUHGVL[W\ FDOHQGDUGD\VIURPWKHGDWHRIWKH1RWLFHWR3URFHHGZKLFKZLOODFFRPSDQ\LQJWKH:RUN2UGHU7KH &RQVXOWDQW DJUHHV WKDW DQ\ :RUN 2UGHU WKDW H[WHQGV EH\RQG WKH H[SLUDWLRQ GDWH RI $JUHHPHQW &(ZLOOVXUYLYHDQGUHPDLQVXEMHFWWRWKHWHUPVDQGFRQGLWLRQVRIWKDW$JUHHPHQWXQWLOWKH FRPSOHWLRQRUWHUPLQDWLRQRIWKLV:RUN2UGHU7KHFRPSOHWH'HVLJQ%LGGLQJ6HUYLFHVDQG6HUYLFHV 'XULQJ&RQVWUXFWLRQVFKHGXOHLVDVIROORZV 'HVLJQ3KDVHPRQWKVFDOHQGDUGD\V %LGGLQJ6HUYLFHV6HUYLFHV'XULQJ&RQVWUXFWLRQ PRQWKVFDOHQGDUGD\V 7RWDOPRQWKVFDOHQGDUGD\V Page 712 of 2661 3DJHRI &RPSHQVDWLRQ,QDFFRUGDQFHZLWKWKH$JUHHPHQWUHIHUHQFHGDERYHWKH&RXQW\ZLOOFRPSHQVDWHWKH )LUPLQDFFRUGDQFHZLWKIROORZLQJPHWKRGV1HJRWLDWHG/XPS6XP1/6/XPS6XP3OXV 5HLPEXUVDEOH&RVWV/65&7LPH 0DWHULDO7 0HVWDEOLVKHGKRXUO\UDWH±6FKHGXOH$ &RVW3OXV)L[HG)HH&3))GHILQHZKLFKPHWKRGZLOOEHXVHGIRUZKLFKWDVNVDVSURYLGHGLQWKH DWWDFKHGSURSRVDO 7DVN 1/6 7DVN 1/6 7DVN 1/6 7DVN 1/6 7DVN 1/6 7DVN 1/6 7DVN 1/6 7DVN 1/6 7DVN 7 0 7DVN BBBBBBBBBBBBBBB 727$/)((1/67 0 35(3$5('%< &KDG6ZHHW3(6HQLRU3URMHFW0DQDJHU 'DWH $33529('%< -D\$KPDG3('LYLVLRQ'LUHFWRU 'DWH $33529('%< 7ULQLW\6FRWW'HSXW\'HSDUWPHQW+HDG'DWH Chad Sweet Digitally signed by Chad Sweet DN: C=US, E=chad.sweet@colliercountyfl.gov, O=Transportation Engineering, OU=Collier County, CN=Chad Sweet Reason: I am approving this document Date: 2022.05.19 10:14:19-04'00' AhmadJay Digitally signed by AhmadJay Date: 2022.05.23 08:33:07 -04'00' ScottTrinity Digitally signed by ScottTrinity Date: 2022.05.24 15:09:05 -04'00' Page 713 of 2661 3DJHRI %\WKHVLJQDWXUHEHORZWKH)LUPLQFOXGLQJHPSOR\HHVRIILFHUVDQGRUDJHQWVFHUWLILHVDQGKHUHE\ GLVFORVHVWKDWWRWKHEHVWRIWKHLUNQRZOHGJHDQGEHOLHIDOOUHOHYDQWIDFWVFRQFHUQLQJSDVWSUHVHQWRU FXUUHQWO\SODQQHGLQWHUHVWRUDFWLYLW\ILQDQFLDOFRQWUDFWXDORUJDQL]DWLRQDORURWKHUZLVHZKLFKUHODWHV WRWKHSURSRVHGZRUNDQGEHDURQZKHWKHUWKH)LUPKDVDSRWHQWLDOFRQIOLFWKDYHEHHQIXOO\GLVFORVHG $GGLWLRQDOO\WKH)LUPDJUHHVWRQRWLI\WKH3URFXUHPHQW'LUHFWRULQZULWLQJZLWKLQKRXUVRIOHDUQLQJ RIDQ\DFWXDORUSRWHQWLDOFRQIOLFWRILQWHUHVWWKDWDULVHVGXULQJWKH:RUN2UGHUDQGRUSURMHFWGXUDWLRQ $&&(37('%<%ODFN 9HDWFK&RUSRUDWLRQ 5DIDHO()ULDV,,,3($VVRFLDWH9LFH3UHVLGHQW 'DWH Rafael E. Frias III, PE Digitally signed by Rafael E. Frias III, PE DN: C=US, E=FriasRE@bv.com, O=Black & Veatch, OU=Government & Environment, CN="Rafael E. Frias III, PE" Date: 2022.05.19 11:33:11-04'00' Page 714 of 2661 ůĂĐŬΘsĞĂƚĐŚ ϰϰϭϱDĞƚƌŽWŬǁǇ͕͘^ƵŝƚĞϮϬϬ͕&ŽƌƚDǇĞƌƐ͕&>ϯϯϵϭϲ WнϭϮϯϵͲϳϬϯͲϴϮϵϰDĂƌƚŝŶDΛs͘ĐŽŵ 0D\ 6&23(2)6(59,&(6)25 352)(66,21$/&,9,/(1*,1((5,1*6(59,&(6 )25&2//,(5&2817< 2$.(6%28/(9$5'6,'(:$/.$1'5281'$%287,03529(0(17352-(&7 $352-(&7385326( &ROOLHU&RXQW\&2817<RZQVDQGRSHUDWHVWKHULJKWRIZD\52:IRU2DNHV %RXOHYDUG7KH&2817<GHVLUHVWRFRQGXFWWKHIROORZLQJSURMHFWZLWKLQWKHVSHFLILHG 52: •&RQVWUXFWLRQRIIRRWZLGHFRQFUHWHVLGHZDONRQWKHHDVWVLGHRI2DNHV %RXOHYDUGIURP,PPRNDOHH5RDG&5WR9DQGHUELOW%HDFK5RDG&5 $SSUR[LPDWHO\PLOHVLQOHQJWK •&RQVWUXFWLRQRIDQIRRWZLGHDVSKDOWSDWKZD\WRIROORZWKHURXWHRIWKHH[LVWLQJ DVSKDOWSDWKZD\RQWKHZHVWVLGHRI2DNHV%RXOHYDUG$SSUR[LPDWHO\RIWKH H[LVWLQJDVSKDOWSDWKZD\RQWKHZHVWVLGHRI2DNHV%RXOHYDUGZLOOEH UHFRQVWUXFWHGGXHWRGDPDJHIURPWUHHURRWV7KHUHPDLQLQJDSSUR[LPDWHO\ RIWKHH[LVWLQJDVSKDOWSDWKZD\ZLOOUHPDLQDQGEHXVHGDVDEDVHIRUWKHQHZ DVSKDOWSDWKZD\0LQRUUDPSDQGFURVVZDONLPSURYHPHQWVPD\EHQHHGHGDWWKH H[LVWLQJFRQQHFWLRQVWR,PPRNDOHH5RDGDQG9DQGHUELOW%HDFK5RDG •&RQVWUXFWLRQRIDVLQJOHODQHURDGZD\URXQGDERXWDW6SDQLVK2DNV/DQHDQG 2DNHV%RXOHYDUGWRSURYLGHIRUSHGHVWULDQFURVVLQJ •7KH1DSOHV6HQLRU&HQWHUZLOOFRQVWUXFWDSRUWLRQRIWKHVLGHZDONRQWKHHDVWVLGH RI2DNHV%RXOHYDUGLQWKH1%57ODQHRI$XWXPQ2DNHV/DQHWKDWWKLVSURMHFW ZLOOFRQQHFWWR&2817<ZLOOSURYLGHSODQVDQGGHWDLOVIRUFRQQHFWLRQVWRWKH VLGHZDONEHLQJFRQVWUXFWHGE\RWKHUV •$VLGHZDONFRQQHFWLRQZLOOEHSURYLGHGWR2DNHV&RPPXQLW\3DUNRQWKH VRXWKVLGHRI6SDQLVK2DNV/DQHDSSUR[LPDWHO\IHHW 7KH&2817<KDVUHTXHVWHGDSURSRVDOIURP%ODFN 9HDWFK&2168/7$17WR REWDLQVXUYH\VXEVXUIDFHXWLOLW\HQJLQHHULQJ68(DQGJHRWHFKQLFDOHQJLQHHULQJ VHUYLFHVSHUIRUP,QWHUVHFWLRQ&RQWURO(YDOXDWLRQ,&(IRURQHLQWHUVHFWLRQSUHSDUH FRQVWUXFWLRQSODQVVSHFLILFDWLRQVDQGFRVWHVWLPDWHVSUHSDUHSHUPLWVSURYLGHXWLOLW\ FRRUGLQDWLRQSURYLGHELGGLQJDVVLVWDQFHDQGSURYLGHVHUYLFHVGXULQJFRQVWUXFWLRQIRUWKH 2DNHV%RXOHYDUG6LGHZDONDQG5RXQGDERXW,PSURYHPHQW3URMHFWGHVFULEHGDERYH 6LGHZDONSODQVURXQGDERXWSODQVDQGUHODWHGLPSURYHPHQWVZLOOPHHWFXUUHQW$'$DQG )ORULGD'HSDUWPHQWRI7UDQVSRUWDWLRQ)'27UHTXLUHPHQWVDQGLQFOXGHQHFHVVDU\ FRRUGLQDWLRQZLWKWKH6RXWK)ORULGD:DWHU0DQDJHPHQW'LVWULFW6):0'RURWKHU Page 715 of 2661 0D\_3DJH VWDNHKROGHUV&2168/7$17ZLOOLQYHVWLJDWHDSSOLFDEOH6WDWHDQG)HGHUDO/DQG8VH ODZVDQGUHJXODWLRQVWKDWPD\UHODWHWRWKHSURSRVHGSURMHFWV7KHJRDORIWKHSURMHFWVLV WRFUHDWHVDIHURXWHVIRUSHGHVWULDQVDORQJDQGFURVVLQJWKHURDGZD\V %352-(&76&23(2):25. 7KHVHUYLFHVXQGHUWKLVFRQWUDFWZLOOEHSHUIRUPHGXQGHUVHSDUDWHWDVNV7KHWDVNV LQFOXGHWKHIROORZLQJ 7DVN ,QWHUVHFWLRQ&RQWURO(YDOXDWLRQ±6SDQLVK2DNV/DQHDQG2DNHV%OYG 6XEFRQVXOWDQW 7DVN 'HVLJQ6HUYLFHV 7DVN 6XUYH\LQJ6HUYLFHV6XEFRQVXOWDQW 7DVN 6XEVXUIDFH8WLOLW\(QJLQHHULQJ68(6XEFRQVXOWDQW 7DVN *HRWHFKQLFDO(QJLQHHULQJ6HUYLFHV6XEFRQVXOWDQW 7DVN 3HUPLWWLQJ6HUYLFHV 7DVN 8WLOLW\&RRUGLQDWLRQ 7DVN 3XEOLF,QIRUPDWLRQ0HHWLQJ&RQVXOWDQW 6XEFRQVXOWDQW 7DVN %LGGLQJ6HUYLFHV6HUYLFHV'XULQJ&RQVWUXFWLRQ 7DVN $OORZDEOH([SHQVHV &2168/7$17ZLOOSHUIRUPWKHWDVNVOLVWHGLQ6HFWLRQ%3URMHFW6FRSHRI:RUNIRU WKHIHHLQGLFDWHGLQ6HFWLRQ'3URMHFW%XGJHW$GGLWLRQDOVHUYLFHVEH\RQGWKLVVFRSHRI ZRUNZLOOEHFRQVLGHUHGVXSSOHPHQWDOVHUYLFHVDQGFDQEHQHJRWLDWHGDVWKH\DULVH 7$6. ,17(56(&7,21&21752/(9$/8$7,21±63$1,6+2$.6 /$1($1'2$.(6%/9'68%&2168/7$17 &2168/7$17VKDOOVXEFRQWUDFWWRDVXEFRQVXOWDQWWRSHUIRUPDQ,QWHUVHFWLRQ&RQWURO (YDOXDWLRQ,&(EDVHGRQ)'27VWDQGDUGVWRGHWHUPLQHFRQWH[WVHQVLWLYHLPSURYHPHQWV IRUWKHLQWHUVHFWLRQRI2DNHV%RXOHYDUGDW6SDQLVK2DNV/DQH,WLVXQGHUVWRRGWKDWWKH &2817<KDVSUHYLRXVO\GHWHUPLQHGWKDWPXOWLZD\VWRSFRQWUROLVZDUUDQWHGDWWKH VXEMHFWLQWHUVHFWLRQ$GGLWLRQDOO\DURXQGDERXWDVWKHIRUPRIWUDIILFFRQWUROLVEHLQJ SURSRVHG7KH&2817<ZLOOSURYLGHKRXUWUDIILFFRXQWVDQGSHDNKRXUWXUQ PRYHPHQWFRXQWVIRUWKLVORFDWLRQ 7KHVXEFRQVXOWDQWZLOOSHUIRUPDPHWKRGRORJ\UHYLHZZKLFKLQFOXGHVGLVFXVVLRQVZLWK WKHFRXQW\UHJDUGLQJRSHQLQJ\HDUWKH\HDUZKHQWKHDOWHUQDWLYHLVDQWLFLSDWHGWREH FRQVWUXFWHGDQGGHVLJQ\HDUIXWXUH\HDUXVHGWRHVWDEOLVKWKHHIILFDF\RIWKHGHVLJQDQG SODQQHGGDWDFROOHFWLRQSULRUWRSHUIRUPLQJWKH,&(HYDOXDWLRQ7KHVXEFRQVXOWDQWZLOO DOVRSHUIRUPDWUDIILFGDWDFROOHFWLRQDQGH[LVWLQJFRQGLWLRQVUHYLHZ 7KH,&(HYDOXDWLRQZLOOEHSHUIRUPHGLQWZRVWDJHV6WDJHZLOOLQFOXGHD)'27 &DSDFLW\$QDO\VLVIRU3ODQQLQJ-XQFWLRQDQG)+:$6DIHW\3HUIRUPDQFHRI,QWHUVHFWLRQ &RQWURO(YDOXDWLRQ6WDJHZLOOLQFOXGHGHYHORSPHQWRIDSUHOLPLQDU\FRQFHSWSODQFRVW HVWLPDWHDQDO\VLVRSHUDWLRQDQDO\VLVEHQHILWFRVWDQDO\VLVKLJKOHYHOUHYLHZWRDVVHVV Page 716 of 2661 0D\_3DJH HQYLURQPHQWDO52:DQGXWLOLW\LPSDFWVDQGUHYLHZPXOWLPRGDODFFRPPRGDWLRQVDWWKH LQWHUVHFWLRQ7KHUHVXOWVRIWKH,&((YDOXDWLRQZLOOEHUHSRUWHGLQDVLQJOHHQJLQHHULQJ UHSRUW 6XEFRQVXOWDQWZLOODWWHQGWKUHHYLUWXDOPHHWLQJVLQFOXGLQJDNLFNRIIPHHWLQJIRU PHWKRGRORJ\UHYLHZSURJUHVVPHHWLQJWRUHYLHZ6WDJHILQGLQJVDQGDSURJUHVVPHHWLQJ WRUHYLHZ6WDJHILQGLQJV 7$6. '(6,*16(59,&(6 )ROORZLQJSUHSDUDWLRQRIWKH,&(UHSRUWDQGXSRQGLUHFWLRQE\WKH&2817< &2168/7$17VKDOOSUHSDUHDGHVLJQVXEPLWWDOVKRZLQJWKHSURSRVHGDOLJQPHQW RIWKHSDWKZD\DQGVLGHZDONDQGFRQILJXUDWLRQIRUWKHSURSRVHGURXQGDERXWRUPXOWLZD\ VWRSFRQILJXUDWLRQDQGFRQQHFWLRQVWRH[LVWLQJVLGHZDONV7KHSDWKZD\VLGHZDONDQG URXQGDERXWVKDOOEHGHVLJQHGLQDFFRUGDQFHZLWKFXUUHQW)'270DQXDORI8QLIRUP 0LQLPXP6WDQGDUGV0806DND³)ORULGD*UHHQERRN´FULWHULDDQGPHHWFXUUHQW$'$ UHTXLUHPHQWV7KHILQDODOLJQPHQWDQGW\SLFDOVHFWLRQVIRUWKHSDWKZD\VLGHZDONDQG LQWHUVHFWLRQLPSURYHPHQWVVKDOOEHDSSURYHGE\WKH&2817<SULRUWRGHWDLOHGSODQ SURGXFWLRQ &2168/7$17VKDOOSUHSDUHFRQVWUXFWLRQSODQVGHQRWLQJWKHSURSRVHGDOLJQPHQWDQG JUDGHRIWKHSDWKZD\VLGHZDONURXQGDERXWDQGDVVRFLDWHGLPSURYHPHQWVLQFOXGLQJ GUDLQDJHLPSURYHPHQWDQGGULYHZD\DSURQV7KHFRQVWUXFWLRQSODQVVKDOOEHSUHSDUHGLQ JHQHUDODFFRUGDQFHZLWKWKH)'27'HVLJQ0DQXDO)'0DQGPD\LQFOXGHWKHIROORZLQJ LQIRUPDWLRQ •.H\6KHHW •*HQHUDO1RWHV •6XPPDU\RI3D\,WHPV •6XPPDU\RI4XDQWLWLHV •7\SLFDO6HFWLRQV •3URMHFW/D\RXW •6XUYH\&RQWURO •6RLO%RULQJ/RJVDW5RXQGDERXWORFDWLRQ •3ODQDQG3URILOH6KHHWVLQFOXGLQJ6LJQLQJDQG3DYHPHQW0DUNLQJVLIQHFHVVDU\ •'UDLQDJH'HWDLOV •6XPPDU\RI'UDLQDJH6WUXFWXUHVLIQHFHVVDU\ •&URVV6HFWLRQV •(URVLRQDQG6HGLPHQW&RQWURO3ODQV •7HPSRUDU\7UDIILF&RQWURO3ODQV •6:333 •8WLOLW\$GMXVWPHQW6KHHWVLIQHFHVVDU\ 2QFHVXUYH\LQJGDWDLVREWDLQHG&2168/7$17ZLOOVFKHGXOHDQGIDFLOLWDWHDNLFNRII PHHWLQJZLWK&2817<VWDIIWRUHYLHZWKHSURYLGHG&2817<FRQFHSWVDQGLGHQWLI\DQ\ Page 717 of 2661 0D\_3DJH QHFHVVDU\GHYLDWLRQVIRUWKHSODQQHGLPSURYHPHQWV&2168/7$17ZLOOGLVFXVVWKH SURMHFWJRDOVDQGREMHFWLYHVZLWKWKH&2817<DQGGHILQHWKHSURMHFWGHYHORSPHQW SURFHVV&2168/7$17ZLOODOVRUHTXHVWDQGFROOHFWDOOUHOHYDQWGDWDDQG GRFXPHQWDWLRQLQWKHSURMHFWDUHDIURPWKH&2817<&2168/7$17ZLOOSUHSDUHDQG GLVFXVVWKHGHVLJQSURMHFWVFKHGXOHDWWKHNLFNRIIPHHWLQJ 7KLVSURMHFWLQFOXGHVWKHIROORZLQJGHVLJQDVVXPSWLRQV •7KHVLGHZDONZLOOEHORFDWHGWRIHHWRIIWKH52:OLQHZKHUHYHUSRVVLEOH •7KHH[LVWLQJGUDLQDJHVZDOHZLWKLQWKH52:ZLOOEHUHJUDGHGDVQHFHVVDU\WR UHFHLYHVWRUPZDWHUUXQRIIIURPWKHURDGZD\DQGSDYLQJ •7KHDVSKDOWSDWKZD\ZLOOIROORZWKHURXWHRIWKHH[LVWLQJDVSKDOWSDWKZD\ •$SSUR[LPDWHO\RIWKHH[LVWLQJDVSKDOWSDWKZD\RQWKHZHVWVLGHRI2DNHV %RXOHYDUGZLOOEHUHFRQVWUXFWHGGXHWRGDPDJHIURPWUHHURRWV7KHUHPDLQLQJ DSSUR[LPDWHO\RIWKHH[LVWLQJDVSKDOWSDWKZD\ZLOOUHPDLQDQGEHXVHGDVD EDVHIRUWKHQHZDVSKDOWSDWKZD\ •,W LV DVVXPHG DGHTXDWH 52: LV DYDLODEOH WR VXSSRUW WKH SODFHPHQW RI WKH URXQGDERXWLGHQWLILHGGXULQJWKH,QWHUVHFWLRQ&RQWURO(YDOXDWLRQ,&(DQDO\VLV,I 52:RUDQHDVHPHQWLVQHHGHGWKH&2817<52:GHSDUWPHQWZLOODFTXLUHWKH QHFHVVDU\GRFXPHQWDWLRQ 3ODQVXEPLWWDOVZLOOEHPDGHDWWKHDQGSKDVHVRIGHVLJQIRU UHYLHZDQGFRPPHQWE\WKH&2817<)RUWKHDQGSKDVHRI GHVLJQVXEPLWWDOVWKHGHOLYHUDEOHVVKDOOLQFOXGH •2QHSGIILOHRIWKHSODQVDWHDFKVXEPLWWDOSKDVH •)LQDOGHVLJQSODQ&$'GUDZLQJGZJILOHV •&RVW(VWLPDWHVDWWKHDQG •2WKHUGRFXPHQWVDVVSHFLILHGLQHDFKWDVN &2168/7$17VKDOOSHUIRUPDTXDOLW\FRQWUROUHYLHZRIWKHDQG GHVLJQVXEPLWWDOVWRHQVXUHFRPSDWLELOLW\ZLWKSURMHFWJRDOVDQGGHVLJQVWDQGDUGV7KH TXDOLW\FRQWUROUHYLHZZLOORFFXUSULRUWRWKHGHVLJQSODQVVXEPLWWDOWRWKH&2817< &2168/7$17VKDOOSUHSDUHDQGVXEPLWDQHQJLQHHU¶VRSLQLRQRISUREDEOHFRQVWUXFWLRQ FRVW23&&DIWHUVXEPLWWDORIWKHDQGGHVLJQVXEPLWWDOV&RVWVZLOOEH GHWHUPLQHGEDVHGRQ)'27FRVWKLVWRU\&2168/7$17VHVWLPDWLQJGDWDEDVHDQGWKH EHVWDYDLODEOHORFDOFRQVWUXFWLRQELGFRVWKLVWRU\ &2168/7$17ZLOOVFKHGXOHDQGIDFLOLWDWHDGHVLJQUHYLHZPHHWLQJDIWHUVXEPLWWDORI WKHDQGGHVLJQSODQVXEPLWWDOV7KHSXUSRVHRIWKHGHVLJQUHYLHZVPHHWLQJVLV WRUHFHLYHDQGGLVFXVVWKH&2817<FRPPHQWVRQWKHSODQV7KHGHVLJQUHYLHZPHHWLQJ ZLOOEHDWWHQGHGE\RQHSHUVRQIURPWKH&2168/7$17DQGRWKHUDWWHQGHHVZLOOEH YLUWXDO Page 718 of 2661 0D\_3DJH 8SRQILQDOFRPSOHWLRQRIWKHGHVLJQWZRFRSLHVRIWKHILQDOVLJQHGDQGVHDOHGSODQV DQGDQHOHFWURQLFILOHVHWLQ$XWR&$'IRUPDWVKDOOEHSURYLGHG 7$6. 6859(<,1*6(59,&(668%&2168/7$17 &2168/7$17ZLOOVXEFRQWUDFWWRDVXEFRQVXOWDQWWRSHUIRUPWKHIROORZLQJVXUYH\LQJ VHUYLFHV •6XUYH\LQJVXEFRQVXOWDQWVKDOOHVWDEOLVKKRUL]RQWDODQGYHUWLFDOVLWHFRQWUROIRUWKH SURMHFWDUHD •6XUYH\LQJVXEFRQVXOWDQWVKDOOUHVHDUFKWKHSXEOLFUHFRUGVDYDLODEOHRQWKH&ROOLHU &RXQWU\3URSHUW\$SSUDLVHUDQG&ROOLHU&RXQW\&OHUNRI&RXUWZHEVLWHVWRORFDWH SDUFHOGHHGVDQGUHFRUGHGSODWVWRLGHQWLI\H[LVWLQJ52:6XUYH\LQJ VXEFRQVXOWDQWVKDOOSHUIRUPDILHOGVXUYH\WRORFDWHYHULI\RUHVWDEOLVK52: OLQHV •6XUYH\LQJVXEFRQVXOWDQWVKDOOSHUIRUPDILHOGVXUYH\WRREWDLQKRUL]RQWDODQG YHUWLFDOGDWDRIYLVLEOHDERYHJURXQGLPSURYHPHQWVDQGYLVLEOHDERYHJURXQG XWLOLWLHVZLWKLQWKHSURMHFWOLPLWVDQGVKDOOPHDVXUHFURVVVHFWLRQVDWIRRW LQWHUYDOVZLWKLQH[LVWLQJ52:RI2DNHV%RXOHYDUGERWKVLGHVRIWKHURDGZD\ WKURXJKWKHSURMHFWOLPLWV •6XUYH\LQJVXEFRQVXOWDQWVKDOOSUHSDUHDVXUYH\EDVHPDSGHOLQHDWLQJSURSHUW\ ERXQGDU\OLQHVDQG52:OLQHV7KHEDVHPDSZLOOEHLQFOXGHGLQWKHILQDO GHOLYHUDEOHDVDQ$872&$'ILOHDQGZLOOEHVXSSRUWHGE\DVLJQHGDQGVHDOHG VXUYH\RU¶VUHSRUW •6XUYH\LQJVXEFRQVXOWDQWVKDOOSUHSDUHDGLJLWDOWHUUDLQPRGHO'70IRUWKH SURMHFWDUHDDQGPDSWKHKRUL]RQWDODQGYHUWLFDOGDWDFROOHFWHGIRUYLVLEOHDERYH JURXQGLPSURYHPHQWVDQGYLVLEOHDERYHJURXQGXWLOLWLHVZLWKLQWKHSURMHFWOLPLWV 6XUYH\GDWDZLOOEHSURYLGHGLQ$872&$' •6XUYH\LQJVXEFRQVXOWDQWVKDOOSURYLGHVXUYH\GDWDLQ&LYLO'$XWR&$'ZLWKD VLJQHGDQGVHDOHGVXUYH\RU¶VUHSRUW +RUL]RQWDOFRQWUROZLOOEHEDVHGRQWKH)ORULGD6WDWH3ODQH&RRUGLQDWH6\VWHP)ORULGD :HVW=RQH1RUWK$PHULFDQ'DWXPRIDGMXVWPHQW9HUWLFDOFRQWUROZLOOEH EDVHGRQWKH1RUWK$PHULFDQ9HUWLFDO'DWXP1$9' 7$6. 68%685)$&(87,/,7<(1*,1((5,1*68( 68%&2168/7$17 &2168/7$17ZLOOVXEFRQWUDFWWRDVXEFRQVXOWDQWWRSHUIRUPVXEVXUIDFHXWLOLW\ HQJLQHHULQJ68(DWWKHLQWHUVHFWLRQRI2DNHV%RXOHYDUGDQG6SDQLVK2DNV/DQHLQWKH YLFLQLW\RIWKHSURSRVHGURXQGDERXW7KHVXEFRQVXOWDQWZLOOSHUIRUP68(4XDOLW\/HYHO %'HVLJQDWHVDWWKHLQWHUVHFWLRQWRLGHQWLI\DQGGHSLFWKRUL]RQWDOORFDWLRQVRIH[LVWLQJ XQGHUJURXQGXWLOLWLHVZLWKLQIHHWLQHDFKGLUHFWLRQIURPWKHFHQWHURIWKHLQWHUVHFWLRQ 7KHVXEFRQVXOWDQWZLOODOVRSHUIRUPDQHVWLPDWHGWHQ68(4XDOLW\/HYHO$ORFDWHV Page 719 of 2661 0D\_3DJH RQH[LVWLQJXWLOLWLHVWKDWUHTXLUHYHULILFDWLRQRIVL]HW\SHHOHYDWLRQDQGW\SHRIXWLOLW\ 7KHPDMRULW\RIWKHXWLOLWLHVDUHQRWDQWLFLSDWHGWREHEHORZWKHH[LVWLQJSDYHGVXUIDFH WKHUHIRUHWKHVXEFRQVXOWDQWZLOOFRPSOHWHPRVWRIWKH/HYHO$ORFDWHVRXWVLGHRIWKH SDYHGVXUIDFHWRDYRLGGLVWXUELQJWKHURDGZD\$Q\FRQIOLFWVWKDWIDOOZLWKLQWKHSDYHG VXUIDFHZLOOUHTXLUHDLUH[FDYDWLRQDQGUHVWRUDWLRQRIDIWVTXDUHSDYHPHQWDUHDWRWKH GHSWKRIWKHXWLOLW\W\SLFDOO\IHHWLVVWDQGDUG6RLODQGEDVHURFNZLOOEHUHSODFHGLQ LQFKOLIWVXVLQJDFRPSDFWRUSULRUWRUHSODFLQJDVSKDOWDWWZLFHWKHRULJLQDODVSKDOWGHSWK XVLQJDFRPSDFWHUDLUWDPSHU 68(LQIRUPDWLRQZLOOEHVKRZQLQ&$'ILOHVDQGLQDVXPPDU\RIYHULILHGXWLOLWLHV VSUHDGVKHHW 7$6. *(27(&+1,&$/(1*,1((5,1*6(59,&(6 68%&2168/7$17 &2168/7$17ZLOOVXEFRQWUDFWWRDVXEFRQVXOWDQWWRSHUIRUPJHRWHFKQLFDOHQJLQHHULQJ VHUYLFHVDWWKHLQWHUVHFWLRQRI2DNHV%RXOHYDUGDQG6SDQLVK2DNV/DQHLQWKHYLFLQLW\RI WKHSURSRVHGURXQGDERXW7KHJHRWHFKQLFDOLQYHVWLJDWLRQZLOOFRQVLVWRIFRQGXFWLQJIRXU 6WDQGDUG3HQHWUDWLRQ7HVW637ERULQJVWRDGHSWKRIIHHW5RXWLQHODERUDWRU\ YLVXDOFODVVLILFDWLRQZLOOEHSHUIRUPHGRQWKHIRXU637ERULQJVDORQJZLWK VSHFLILFDWLRQWHVWVGHHPHGQHFHVVDU\7KHUHVXOWVRIWKH637ERULQJVZLOOEHSUHVHQWHGLQ DQHQJLQHHULQJUHSRUWWRWKH&2817<7KLVUHSRUWZLOOSUHVHQWWKHUHVXOWVRIWKHILQGLQJV LQFOXGLQJDURDGZD\VRLOVXUYH\DQGSURYLGHDUHFRPPHQGDWLRQIRUVLWHSUHSDUDWLRQ 7$6. 3(50,77,1*6(59,&(6 &2168/7$17VKDOOSUHSDUHDSHUPLWDSSOLFDWLRQDQGDVVLVWWKH&2817<LQREWDLQLQJ DVLGHZDON³3HUPLW([HPSWLRQ´IRUWKLVSURMHFWWKURXJKWKH6RXWK)ORULGD:DWHU 0DQDJHPHQW'LVWULFW6):0'&2817<ZLOOEHUHVSRQVLEOHIRUSD\PHQWRIWKH SHUPLWDSSOLFDWLRQIHH &2168/7$17ZLOOSHUIRUPDQRQVLWH7KUHDWHQHGDQG(QGDQJHUHG6SHFLHV6XUYH\ DORQJWKHSURSRVHGVLGHZDONFRUULGRU$7KUHDWHQHGDQG(QGDQJHUHG6SHFLHVZLOOEH SUHSDUHGWKDWRXWOLQHVWKHILQGLQJVRIWKHVXUYH\DQGLIQHFHVVDU\ZLOORXWOLQHIXUWKHU FRRUGLQDWLRQSHUPLWWLQJWKDWPD\EHUHTXLUHG 3HUPLWWLQJLVDUHJXODWRU\SURFHVVRYHUZKLFK&2168/7$17KDVQRFRQWURODQGFDQQRW JXDUDQWHHWKHSHUPLWH[HPSWLRQ&2168/7$17ZLOOUHVSRQGWRDQGDGGUHVVFRPPHQWV GLUHFWO\UHODWHGWRDQGSUHFLSLWDWHGIURPWKHDERYHUHIHUHQFHGSHUPLWH[HPSWLRQ DSSOLFDWLRQ 1RRWKHUSHUPLWWLQJDSSOLFDWLRQVRUUHJXODWRU\FRQVXOWDWLRQLVLQFOXGHGZLWKWKLVSURMHFW 6KRXOGFRQVXOWDWLRQZLWKRWKHUUHJXODWRU\DJHQFLHVRUDGGLWLRQDOSHUPLWWLQJHIIRUWV EHFRPHQHFHVVDU\WKH\ZLOOEHFRQVLGHUHGDGGLWLRQDOVHUYLFHVDQGZLOOEHQHJRWLDWHGDW WKDWWLPH Page 720 of 2661 0D\_3DJH 7$6. 87,/,7<&225',1$7,21 &2168/7$17ZLOOSHUIRUPD³6816+,1(21(&$//´DQGLGHQWLI\SRWHQWLDO8WLOLW\ $UHD2ZQHUV8$2VZLWKLQWKHSURMHFWOLPLWVDQGUHTXHVWWKHORFDWLRQRIH[LVWLQJ XWLOLWLHV)ROORZLQJWKHSODQVXEPLWWDO&2168/7$17ZLOOVHQGWKHSURSRVHG FRQVWUXFWLRQSODQVWRWKH8$2VUHTXHVWLQJDQ\XWLOLW\DGMXVWPHQWSODQVLQ³5HG*UHHQ %OXH´5*%IRUPDW$Q\H[LVWLQJXWLOLW\ORFDWLRQVDQGSURSRVHGXWLOLW\DGMXVWPHQWV SURYLGHGE\WKH8$2VVKDOOEHGHSLFWHGRQWKHVLGHZDONSODQVKHHWV&2168/7$17 ZLOOFRRUGLQDWHDQGDWWHQGRQHXWLOLW\FRRUGLQDWLRQPHHWLQJ$Q\XWLOLW\UHORFDWLRQV VKDOOEHGHVLJQHGDQGFRQVWUXFWHGE\RWKHUV&2168/7$17ZLOOUHDVRQDEO\UHO\XSRQ WKHDFFXUDF\DQGFRPSOHWHQHVVRIWKHLQIRUPDWLRQGDWDSURYLGHGE\WKH&2817<RU RWKHUWKLUGSDUWLHV 7$6. 38%/,&,1)250$7,210((7,1*&2168/7$17 68%&2168/7$17 &2168/7$17DQG,&(VXEFRQVXOWDQWZLOODWWHQGRQHSXEOLFPHHWLQJDQGDGGUHVV TXHVWLRQVUHJDUGLQJWKHSURMHFWDWWKHWLPHRIWKHSXEOLFPHHWLQJ7KH&2817<ZLOO KDQGOHDOOPHHWLQJORJLVWLFVDQGWKHSUHSDUDWLRQRIDQ\SUHVHQWDWLRQRUKDQGRXWV7KH SXEOLFPHHWLQJLVDQWLFLSDWHGWRRFFXUGXULQJWKHSODQVSUHSDUDWLRQ 7$6. %,'',1*6(59,&(66(59,&(6'85,1*&216758&7,21 &2168/7$17ZLOOSURYLGH3RVW'HVLJQ6HUYLFHVIRUWKHVLGHZDONDQGURXQGDERXW SURMHFWDVIROORZV 7$6. %,'',1*6(59,&(6 &2168/7$17ZLOOSURYLGHWKH&2817<WKHIROORZLQJOLPLWHGVHUYLFHVGXULQJ ELGGLQJ •$WWHQGDQFHDWRQHSUHELGPHHWLQJ •$VVLVWDQFHWRWKH&2817<LQSUHSDULQJUHVSRQVHVWRELGGHUWHFKQLFDOTXHVWLRQV SULRUWRELGRSHQLQJ •(YDOXDWLRQRIELGVUHFHLYHGDQGSUHSDUDWLRQRID%LG(YDOXDWLRQ5HFRPPHQGDWLRQ /HWWHU 7$6. 6(59,&(6'85,1*&216758&7,21 7KH&2817<ZLOOSURYLGHIXOOWLPH&(,VHUYLFHVWKURXJKRXWFRQVWUXFWLRQ7KH &2168/7$17ZLOOSURYLGHWKH&2817<WKHIROORZLQJOLPLWHGVHUYLFHVGXULQJ FRQVWUXFWLRQ •$WWHQGDQFHDWRQHSUHFRQVWUXFWLRQPHHWLQJ •,QWHUSUHWDWLRQRIFRQWUDFWGRFXPHQWVDQGDVVLVWDQFHLQUHVSRQGLQJWRUHTXHVWVIRU LQIRUPDWLRQ5),DVUHTXHVWHGE\WKH&2817< •$WWHQGDQFHDWXSWRWZRFRQVWUXFWLRQSURJUHVVPHHWLQJV Page 721 of 2661 0D\_3DJH •&RQGXFWXSWRWZRILHOGVLWHYLVLWV •5HYLHZDQGFRPPHQWRQVKRSGUDZLQJVLQSDUDOOHOZLWKWKH&2817<¶VVKRS GUDZLQJUHYLHZ •$WWHQGDQFHDWRQHVXEVWDQWLDOFRPSOHWLRQZDONWKURXJKDQGSUHSDUDWLRQRID SXQFKOLVWUHVXOWLQJIURPWKHZDONWKURXJK 7$6. $//2:$%/((;3(16(6 &352-(&76&+('8/( 7KHSUHOLPLQDU\VFKHGXOHIRUWKHSURMHFWLVSURYLGHGEHORZ 3KDVH1DPH7DVN'XUDWLRQ GD\V ±,QWHUVHFWLRQ&RQWURO(YDOXDWLRQ 'HVLJQ6HUYLFHV ±6XUYH\LQJ6HUYLFHV ±6XEVXUIDFH8WLOLW\(QJLQHHULQJ68( ±*HRWHFKQLFDO(QJLQHHULQJ6HUYLFHV ±3HUPLWWLQJ6HUYLFHV ±8WLOLW\&RRUGLQDWLRQ ±3XEOLF,QIRUPDWLRQ0HHWLQJ %LGGLQJ6HUYLFHV6HUYLFHV'XULQJ&RQVWUXFWLRQ 727$/ '352-(&7%8'*(7 )RUSHUIRUPDQFHRIWKHWDVNVGHVFULEHGLQWKH6FRSHRI6HUYLFHVWKH&2817<ZLOO FRPSHQVDWHWKH&2168/7$17LQDFFRUGDQFHZLWKWKHEXGJHWVXPPDU\WDEOHEHORZ 7DVNVDQGZLOOEHFRPSHQVDWHGRQDOXPSVXP/6EDVLV7DVNZLOO EHFRPSHQVDWHGRQDWLPHDQGPDWHULDOV7 0EDVLVZLWKWKH1RWWR([FHHG17( DPRXQWLQGLFDWHGLQWKHEXGJHWVXPPDU\WDEOHEHORZ &2168/7$17ZLOOVXEPLWPRQWKO\LQYRLFHVWREHSDLGE\WKH&2817<EDVHGRQWKH SURJUHVVDQGVHUYLFHVFRPSOHWHGHDFKPRQWK&RPSHQVDWLRQVKDOOEHPDGHLQDFFRUGDQFH ZLWKWKHWHUPVRIWKH$JUHHPHQWEHWZHHQWKH&2817<DQG&2168/7$17 Page 722 of 2661 0D\_3DJH ,' 7DVN1DPH /617( RU7 0&RVW 2$.(6%28/(9$5'6,'(:$/.$1'5281'$%287,03529(0(17 ,QWHUVHFWLRQ&RQWURO(YDOXDWLRQ /6 'HVLJQ6HUYLFHV /6 6XUYH\LQJ6HUYLFHV /6 6XEVXUIDFH8WLOLW\(QJLQHHULQJ68( /6 *HRWHFKQLFDO(QJLQHHULQJ6HUYLFHV /6 3HUPLWWLQJ6HUYLFHV/6 8WLOLW\&RRUGLQDWLRQ /6 3XEOLF,QIRUPDWLRQ0HHWLQJ/6 %LGGLQJ6HUYLFHV6HUYLFHV'XULQJ&RQVWUXFWLRQ 7 0 $OORZDEOH([SHQVHV17( 352-(&7727$/ Page 723 of 2661 ! !"#$% & ''('"'#)*+ ,'+ !-' &'%$%' .!/ 0 ,1& 2 , !$34'%5)*+ ( ,'+ 5!-' 6 ,1& 7 ,.&& 8 , !$34'%5)*+ ,'+ 5!-' 9 $3% ,1& : ,.&& . , !$34'%5)*+ 2'%#)'#;$4 " #! 6<'%'#='%&% )"/';!$*; & >-'-"'''#?@! $ %# !! &%' ( )* +! !- !$*;5)- 4--%' , %# A%;&#' &#'+"A% - $+ .! / 0! 1 ! @# ## '50*'%$' & @& $ & $"%; 0 7-'5)27 ' 2 !"-'+)*+ ( 2%#!= 6 !$3 ''%&4-%/'%"$" 2 3- 45 %%+'3%0B- >.>96.A)! 6 1/,7 2>.>9&.!> #8 0 9 -: 5+ * : +/.#!!$3 $%'>%C ! ! 0*4'% ! &%'%D0B- '' 0 0 !-'% %' #4 '*>'% >'% #'4'5 70 && >'%6$%;)'C 6$ 9'3 0B- ' 5!$*; 0 2 Page 724 of 2661 ICE Evaluation for the intersection of Oakes Boulevard at Spanish Oaks Lane BCC will apply the FDOT’s Intersection Control Evaluation (ICE) procedure to determine context sensitive improvements for the intersection of Oakes Boulevard at Spanish Oaks Lane. BCC understands Collier County has previously determined multi-way stop control is warranted at the subject intersection. The, County is proposing a roundabout as the form of traffic control at this intersection. As part of this scope, BCC will conduct the first two stages of the ICE procedures at the study intersection to assess the viability of proposed alternative (roundabout) as follows: x Stage 1: Screening – BCC will screen the proposed alternative using FDOT’s Capacity Analysis for Planning of Junctions (CAP-X) and FHWA’s Safety Performance of Intersection Control Evaluation (SPICE) using safety and traffic data gathered. The purpose of the Stage 1 Screening will be to establish a list of viable traffic control strategies for the intersection for further review. x Stage 2: Preliminary Control Strategy Assessment – BCC will perform a more detailed safety and traffic operations analysis to help differentiate between existing and proposed control strategies from the Stage 1 screening. The BCC Team will use FDOT’s default Synchro templates (for various intersection control types) to perform the operations assessment. We will use the FDOT ICE Tool to perform the benefit-cost analysis. x Technical Memorandum – BCC will prepare a technical memorandum to summarize the findings and recommendations from the ICE Evaluation. Task 1 – Methodology Review BCC will discuss the following items with the County prior to the performance of the ICE Evaluation: x Opening and Design years, x Proposed data to be gathered from County such as traffic counts (4-hour Turning movement counts) and seasonal adjustment factors at the intersection. The outcome of the methodology review will be documented in a brief email summary for concurrence by the County. Task 2 – Traffic Data Collection & Existing Conditions Review As part of this task and in coordination with the County, BCC will document the project location, basic roadway characteristics, design speeds, peak hour volumes for design and opening years, growth rate, crash data collection/summarization, environmental data, multimodal use(s), and roadway context classifications. This effort will mainly consist of a desktop analysis. Task 3 - ICE Evaluation BCC will conduct the Stage 1 and Stage 2 review for the ICE evaluation as follows: A. Stage 1 Review - will include: x A CAP-X Analysis to assess the calculated volume to capacity ratios from the existing and proposed alternatives for the AM & PM Peak Hours for opening and design years, Page 725 of 2661 Collier County ICE Evaluation – Oakes Boulevard at Spanish Oakes Lane Page 2 of 4 x A SPICE Analysis to perform a preliminary safety evaluation of the of the existing and proposed control strategies x Preparation of the Stage 1 justification ICE Form for submittal to the County, x BCC will review the findings of the Stage 1 review with the County prior to proceeding to Stage 2. B. Stage 2 Review – x Preliminary concept plans will be prepared for the existing and proposed control strategies, x A Cost estimate analysis (including a high-level design, ROW, construction costs for selected control strategy) will be performed for the proposed alternative (assumes ROW information will be provided by client), x Operational Analyses (including analysis of LOS and delay for AM/PM for opening and design year for the existing and proposed control strategies) will be performed, x A Benefit-Cost analysis will be performed for the proposed strategy which includes Inputting delay, safety, cost estimates etc. into ICE Tool to derive the net present values (NPV) of costs and benefits will be performed, x A high-level review will be performed to assess environmental, ROW and utility impacts of the proposed control strategy that emerges from the Stage 2 review while focusing on social, natural, or physical environment impacts which may preclude the advancement of the control strategy, x The multimodal accommodations at the intersection will be reviewed including a broad overview summary of the pedestrian and bicycle activity levels, transit services near the intersection, and freight needs, x Prepare the Stage 2 justification ICE Form (Stage 2) for submittal to the County, x BCC will review the findings of the Stage 2 review with the County. Task 4 - Report Documentation BCC will compile all analysis from the preceding tasks into a single report for submittal to Collier County for review. The report will document the methodology used and the findings from the analysis. Recommendations will be provided in the report for the proposed intersection control strategy needed to maintain acceptable traffic operations and safety. One draft of the report will be prepared initially. BCC will prepare up to one revision of the draft prior to preparing a final report for agency submittal. Task 5 - Project Coordination & Meetings As part of this task, BCC will attend an initial project kickoff meeting with County staff to review goals and objectives for the project, and obtain specific directions from the County to be followed during the performance of the services listed here in. Additional meetings and presentations will be conducted during this contract to coordinate efforts and inform stakeholders. 1. Kick-off meeting for methodology review (virtual), 2. Meeting with County to present the findings from ICE Stage 1 Review(virtual), 3. Meeting with County to present the findings from ICE Stage 2 Review(virtual). Page 726 of 2661 Collier County ICE Evaluation – Oakes Boulevard at Spanish Oakes Lane Page 3 of 4 Task 6 - Public Meeting Public Meeting to present summary of evaluation and recommendations (in-person). (Assumes Roundabout option can be included into the overall project corridor roll plot or if it is just the Roundabout option being presented, we propose to include as a Power Point slide as part of a presentation or use a board instead of roll plots). SCHEDULE The estimated time to complete the draft submittal is 30 days from notice to proceed (NTP). An additional 15 days will be required to allow for agency review and for BCC to incorporate feedback received from such review. The total duration for this study is estimated at 60 days to allow for coordination with the County after completion of the report. FEE AND BILLING BCC will perform all services described in Tasks 1 through 6 of the Scope of Services for a limiting amount not to exceed $11,402.40 without prior approval from the County. Following is a summary of estimated breakdown of the associated fee for each task described in this scope of services: A detailed breakdown of the Fee by task is presented as Exhibit ‘A’. Task Fee Cost Basis Task 1 - Methodology Review $321.97 Limiting Amount Task 2 - Traffic Data Collection & Existing Conditions Review $1,643.64 Limiting Amount Task 3 - ICE Evaluation $4,076.93 Limiting Amount Task 4 - Report Documentation $1,828.19 Limiting Amount Task 5 - Project Coordination & Meetings $1,359.85 Limiting Amount Task 6 - Public Meeting $2,171.82 Limiting Amount Total $11,402.40 Limiting Amount Page 727 of 2661 Collier County ICE Evaluation – Oakes Boulevard at Spanish Oakes Lane Page 4 of 4 EXHIBIT ‘A’ FEE BREAKDOWN Page 728 of 2661 Senior Engineer 2Senior Engineer 1Engineer 2Engineer 1Engineering InternChief PlannerSenior PlannerPlannerCADD TechStaff Class 10Staff Class 11Staff Class 12Staff Class 13Rates$225.00 $185.00 $173.01 $136.97 $99.88 $185.00 $165.42 $89.23 $91.55 $50.00 $50.00 $50.00 $50.00Explanatio0 1 0 1 0 0 0 0 0 0 0 0 0 2 $321.97 $160.99- Preliminarrequiremenal 0 1 0 1 0 0 0 0 0 0 0 0 0 2 $321.97 $160.990 0 0 1 0 0 0 0 0 0 0 0 0 1 $136.97 $136.97CoordinateSupplemenpreliminary0 0 0 3 0 0 0 0 0 0 0 0 0 3 $410.91 $136.97CoordinateQualitative person x 2 hours.0 0 0 4 0 0 0 0 0 0 0 0 0 4 $547.88 $136.97Opening yeyears @ 2 0 0 0 1 0 0 0 0 0 0 0 0 0 1 $136.97 $136.97Gather cras0 0 0 2 0 0 0 0 0 0 0 0 0 2 $273.94 $136.97Review pot0 0 0 1 0 0 0 0 0 0 0 0 0 1 $136.97 $136.97Collect as-bal 0 0 0 12 0 0 0 0 0 0 0 0 0 12 $1,643.64 $136.970 0 0 2 0 0 0 0 0 0 0 0 0 2 $273.94 $136.97Includes allTask 2 intopopulating strategies. spreadsheestrategy = 20 0 0 2 0 0 0 0 0 0 0 0 0 2 $273.94 $136.97Includes all(D) into thealternativesaspects. (2 0 0 0 2 0 0 0 0 0 0 0 0 0 2 $273.94 $136.97Includes allpackage tointo the Stasupporting spreadsheestrategy * 12 0 0 10 8 0 0 0 0 0 0 0 0 20 $2,618.74 $130.94Includes woalternative.labeling, anrecommend0 0 0 1 2 0 0 0 0 0 0 0 0 3 $336.73 $112.24Includes theconstructiodeveloped information0 0 0 1 1 0 0 0 0 0 0 0 0 2 $236.85 $118.43Includes allDelay from each selectcontrol stra0 0 0 1 1 0 00000002$236.85$118.43Includes allBenefit-CosEstimate anBCC Negotiated RatesStaff Hours By ActivityStaff Cost By ActivityAverage Rate Per TaskPage 729 of 2661 Senior Engineer 2Senior Engineer 1Engineer 2Engineer 1Engineering InternChief PlannerSenior PlannerPlannerCADD TechStaff Class 10Staff Class 11Staff Class 12Staff Class 13Rates$225.00 $185.00 $173.01 $136.97 $99.88 $185.00 $165.42 $89.23 $91.55 $50.00 $50.00 $50.00 $50.00ExplanatioBCC Negotiated RatesStaff Hours By ActivityStaff Cost By ActivityAverage Rate Per Task0 0 0 1 1 0 0 0 0 0 0 0 0 2 $236.85 $118.43Includes allthe proposeproperties. proposed cenvironmenparticular astrategy = 20 0 0 1 0 0 0 0 0 0 0 0 0 1 $136.97 $136.97Includes allaccommodaoverview suaccommodaneeds. (1 h0 0 0 2 0 0 0 0 0 0 0 0 0 2 $273.94 $136.97Includes allthe findingsconcurrenccontrol stradata. (2 houal 2 0 0 17 13 0 0 0 0 0 0 0 0 38 $4,076.93 $107.290 2 0 6 4 0 0 0 0 0 0 0 0 12 $1,591.34 $132.61Write-up, gAssume 120 0 0 1 1 0 0 0 0 0 0 0 0 2 $236.85 $118.43Incorporateal 0 2 0 7 5 0 0 0 0 0 0 0 0 14 $1,828.19 $130.591 0 0 1 0 0 0 0 0 0 0 0 0 2 $361.97 $180.99Kickoff Mee1 0 0 2 0 0 0 0 0 0 0 0 0 3 $498.94 $166.311 meeting x1 0 0 2 0 0 0 0 0 0 0 0 0 3 $498.94 $166.311 meeting xal 3 0 0 5 0 0 0 0 0 0 0 0 0 8 $1,359.85 $169.986 0 0 6 0 0 0 0 0 0 0 0 0 12 $2,171.82 $180.99- 3 hour mefor meetingincluded intRoundabouof roll plots al 6 0 0 6 0 0 0 0 0 0 0 0 0 12 $2,171.82 $180.9911 3 0 48 18 0 0 0 0 0 0 0 0 86 - -$2,475.00 $555.00 $0.00 $6,574.56 $1,797.84 $0.00 $0.00 $0.00 $0.00 $0.00 $0.00 $0.00 $0.00 - $11,402.40 $132.59 Page 730 of 2661 f AIM Engineering & Surveying, Inc. Corporate Office • 2161 Fowler Street, Suite 100 • Fort Myers, FL 33901 239-332-4569 • 800-226-4569 • Fax: 855-731-7971 www.aimengr.com AIM Engineering & Surveying, Inc. Successfully providing our clients and the community with quality planning, engineering and surveying since 1980. Corporate Office 2161 Fowler Street Suite 100 Fort Myers, FL 33901 239-332-4569 800-226-4569 www.aimengr.com March 18, 2022 Zach Smieriak, E.I. Civil Engineer II, Water Black & Veatch 3405 W. Dr. M.L. King Jr. Blvd, Suite 125 Tampa, FL 33607 813-207-7933 SmierciakZS@BV.com RE: Oakes Blvd. Sidewalk Improvement Project Dear Mr. Smieriak, SCOPE OF SERVICE-Survey & SUE 1) Research the public records available on the Collier Country Property Appraiser and Collier County Clerk of Court websites to locate parcel deeds and recorded plats to identify existing ROW. Perform a field survey to locate, verify, or establish ROW lines within project limits. 2) Perform a field survey to obtain horizontal and vertical data of visible above ground improvements and visible above ground utilities within the project limits and measure cross-sections at 50-foot intervals within existing ROW on both side of Oakes Blvd. through the project limits. Prepare a survey base map delineating property boundary lines and ROW lines. Base map will be included in the final deliverable as an AUTOCAD file and will be supported by a signed and sealed surveyor’s report. 3) Prepare a digital terrain model (DTM) for the project area and map the horizontal and vertical data collected for visible above ground improvements and visible above ground utilities within the project limits. Survey data will be provided in AUTOCAD. 4) The horizontal data will be in feet and shall be project on the Florida State Plane Coordinate System, East Zone, North American Datum of 1983 (2011 adjustment). The vertical data will be in feet and shall be referenced to the North American Vertical Datum 1988 (NAVD 88). Page 731 of 2661 Oakes Blvd. Survey/SUE Proposal f AIM Engineering & Surveying, Inc. Corporate Office • 2161 Fowler Street, Suite 100 • Fort Myers, FL 33901 239-332-4569 • 800-226-4569 • Fax: 855-731-7971 www.aimengr.com 5) Perform SUE Quality Level-B Designates at the intersection of Spanish Oaks Ln and Oakes Blvd to identify and depict horizontal locations of existing underground utilities within 250’ each way of the center of the intersection. 6) Perform and estimated (10) SUE Quality Level-A Locates on existing utilities that require verification of size, type, elevation, and type of utility. This information will be shown in CAD files and also shown in a summary of verified utilities spreadsheet. 7) Provide survey data in Civil 3D AutoCAD with signed and sealed surveyor’s report. PROPOSED SURVEY FEE $52,969.00 Staff-hour Breakdown: CLOSING Thank you for the opportunity to provide these Professional Survey Services. If there are any questions, please do not hesitate to contact the undersigned. We look forward to working with you now and in the future. Sincerely, Grant Fichter Survey Manager, AIM Engineering & Surveying Inc. PROPOSED SURVEY BUDGET -COLLIER COUNTY, FL Oakes Blvd. Surveyor & Mapper 3 Person Survey Crew CAD/Computer Technician SUE Designate Crew SUE Locate Crew Expense Total $ by Task $142.00 $185.00 $95.00 $160.00 $185.00 $95.00 Survey Tasks: 1. Horizontal and Vertical Control 4.00 15.00 6.00 - 2.00 - 4,103.00$ 2. Right of Way Survey 25.00 25.00 35.00 3.00 - 11,785.00$ 3. Topographic Data & X-Sections 12.00 85.00 70.00 35.00 - 27,404.00$ 7. Construction Staking - - - -$ 1. Designating (Level-B) 0.50 2.00 6.00 20.00 1.00 - 4,306.00$ 2. Locating (Level-A) Soft Digs 0.50 3.00 10.00 20.00 1.00 - 5,371.00$ Sub-totals by rate 42.00 130.00 127.00 20.00 20.00 42.00 - 5,964.00$ 24,050.00$ 12,065.00$ 3,200.00$ 3,700.00$ 3,990.00$ -$ 52,969.00$ Proposed Fee Field Crew Supervisor Page 732 of 2661 Ardaman & Associates, Inc. Geotechnical, Environmental and Materials Consultants 9970 Bavaria Road, Fort Myers, Florida 33913 Phone: (239) 768-6600 Fax: (239) 768-0409 Louisiana: Baton Rouge, New Orleans, Shreveport Florida: Bartow, Cocoa, Fort Myers, Miami, Orlando, Port St. Lucie, Sarasota, Tallahassee, Tampa, W. Palm Beach January 31, 2022 Proposal No. 22-417 Black & Veatch 3405 W. M.L. King Jr. Blvd, Suite 125 Tampa, FL 33607 Attention: Zach Smierciak, E.I. Civil Engineer II Via E-mail: SmierciakZS@BV.com SUBJECT: Proposal for Preliminary Geotechnical Engineering Services Oakes Blvd Sidewalk and Roundabout Intersection of Oakes Blvd and Spanish Oaks Ln Naples, Collier County, Florida Dear Mr. Smierciak: Ardaman & Associates, Inc. (Ardaman) is pleased to submit this proposal to Black & Veatch (B&V) for geotechnical engineering services to perform a preliminary subsurface soil exploration for the proposed project. The project site is generally located at the intersection of Oakes Boulevard and Spanish Oaks Lane in Naples, Collier County. We understand that B&V intends to redesign the Oaks Boulevard at Spanish Oaks Lane intersection and a roundabout is considered for it. We understand that preliminary information about the subsurface soil conditions is needed for your due diligence. We prepared this proposal based on the proposed roundabout site plan you supplied and your request for four soil borings. The proposed boring locations can be seen in the attached aerial image of the project site. This proposal was prepared under the assumption that the subject site is accessible with our truck-mounted drilling equipment. PRE- EXPLORATION TASKS Prior to beginning our field operations, Ardaman will perform the following tasks: - Review all available information provided by you. - Develop a boring plan. - Submit permit applications to the applicable permitting agencies. - Layout the proposed test boring locations in the field. - Submit utility tickets to Sunshine State One-Call in general accordance with Florida Statute 556.101-111 (Underground Facility Damage Prevention and Safety Act). - Coordinate boring locations with utility companies for potential conflicts. FIELD EXPLORATION Our proposed subsurface soil exploration will consist of conducting four (4) Standard Penetration Page 733 of 2661 Black & Veatch Ardaman Proposal No. 22-417 Page No. 2 Ardaman & Associates, Inc. Test (SPT) borings to a depth of 20 feet. We will also estimate the seasonal high water table will be estimated at the four quadrants of the subject intersection. The SPT borings will be drilled using a procedure consistent with the one outlined in ASTM D-1586. The borings will be sampled at 18-inch intervals to 10 feet deep and at 5-foot intervals thereafter. Each sample will be removed from the sampler in the field and then examined and visually classified by our crew chief. Water level observations will be made in the boreholes during the drilling operation. Representative portions will be sealed and packaged for transportation to our laboratory for further analysis as required. Ardaman will use a handheld Global Positioning System (GPS) device and aerial images to stake and conduct the borings. We recommend that the project surveyor locate our borings horizontally and vertically (i.e., determine the elevation of the ground surface at the boring locations). This information will increase the accuracy of the data obtained. We assume that the surveyor will be retained by the client to provide these services. LABORATORY PROGRAM In addition, routine laboratory visual classification will be performed along with specific classification tests deemed necessary (i.e., percent fines, Atterberg limits, and organic content tests). ENGINEERING REPORT Engineering and technical support services will also be required to analyze the data and to prepare an engineering report. This report will present the results of our findings including a roadway soil survey, and provide you with recommendations for site preparation. ESTIMATED FEES Based on our knowledge of the project to-date, we estimate our total fees to be $9,887. The attached Fee Estimate has a breakdown of our fees. If initial findings indicate that additional services are necessary, then we will contact you for authorization. The report will be digitally signed and sealed and an electronic version will be provided in Adobe pdf format. Hard copies of the report can be provided for a cost of $50.00 per report plus express courier service costs if requested. TERMS AND CONDITIONS This proposal is subject to the following terms and conditions: (1) the proposed number of borings and the boring depths will be adequate, (2) undisturbed samples and consolidation tests on fine grained soils are not budgeted into the total cost, (3) Ardaman will not take responsibility for damages to underground structures and/or services that are not located by Sunshine State One- Call, (4) exploration or evaluation of the environmental (ecological or hazardous/toxic material related) condition of the site and subsurface is not included, (5) this proposed exploration is a relatively shallow exploration and is not intended to be an evaluation for sinkhole potential, and (6) soil test permits with Collier County are required to perform the work. Page 734 of 2661 Black & Veatch Ardaman Proposal No. 22-417 Page No. 3 Ardaman & Associates, Inc. This proposal is offered for an acceptance period of 90 days following its submittal to you. After this time, the proposed costs may be subject to change. At your request, after the acceptance period has elapsed, we will re-evaluate our proposal, and reissue it reflecting changes in work scope and cost, if necessary. CLOSURE If this proposal meets with your approval, please return a copy of the attached Project/Proposal Acceptance (PPA) form complete with client name and signature to this office as our authorization to proceed. The party whose signature appears on the acceptance form will be invoiced for our services. The specific terms and conditions stated in this proposal, as well as the General Terms and Conditions stated following the PPA form are an integral part of our proposal. We appreciate the opportunity to offer our services to your project and look forward to working with you. Should you have any questions regarding this proposal, please do not hesitate to contact this office. Very truly yours, ARDAMAN & ASSOCIATES, INC. Mathew Lundgren, E.I. Ivan F. Sokolic, P.E. Staff Geotechnical Engineer Senior Engineer/Branch Manager Attachments: - Aerial Image with Proposed Test Locations - Proposal/Project Acceptance and Agreement Form - General Conditions Page 735 of 2661 Ardaman Proposal No. 22-417 Project Name:County:Collier Client:Date:1/31/2022 Item Unit Rate Quantity Sub-Total Engineering Man-Hours yes Principal Engineer Hour $210.00 1 $210.00 Senior Project Engineer Hour $170.00 2 $340.00 Project Engineer Hour $140.00 4 $560.00 Staff Engineer Hour $110.00 16 $1,760.00 Senior Engineering Technician Hour $80.00 6 $480.00 Technician Hour $65.00 6 $390.00 Technical Draftsperson Hour $70.00 8 $560.00 Technical Secretary Hour $65.00 2 $130.00 $4,430.00 Pay Items yes 1.0 MOBILIZATION yes 1.1 Mobilization and Demobilization of Drill Crew and Equipment Each $410.00 1 $410.00 2.0 STANDARD DRILLING yes 2.1 Auger Borings (4-inch) ft $13.50 20 $270.00 2.3 Standard Penetration Test (SPT) Borings (ASTM D-1586) in Soil (N-Values <50) 2.3.1 from surface to 25 feet ft $20.30 80 $1,624.00 2.3.2 from 25 to 50 feet ft $22.60 0 $0.00 2.4 SPT Borings in High Resistance Soil/Rock (N-Values >50) ft $4.10 20 $82.00 2.5 Furnish, Install and Remove Casing (up to 4-inch) 2.5.1 from surface to 50 feet ft $12.00 20 $240.00 4.0 OTHER CHARGES yes 4.1 Clearing Difficult Access, Hole location and set-up Crew Hr $225.00 2 $450.00 4.2 Grouting and Sealing (plus cement) Crew Hr $250.00 1 $250.00 4.4 ROW & Soil Test Boring Permits (required by Collier Co) (Cost +15%) Permit $350.00 4 $1,400.00 4.5 Cement – 47 lbs. Bag $14.00 4 $56.00 9.0 SOIL CLASSIFICATION TESTS yes 9.1 Moisture Content (ASTM D-2216) Each $19.00 4 $76.00 9.2 Organic Content (ASTM D 2974) Each $41.00 1 $41.00 9.4 Sieve Analysis (ASTM D-421, D-422) Each $61.00 2 $122.00 9.5 Percent Fines (ASTM D-1140) Each $42.00 4 $168.00 9.8 Atterberg Limits (ASTM D-4318) Set $134.00 2 $268.00 $5,457.00 $9,887.00 Engineering Man-Hours - Sub-Total: Pay Items - Sub-Total: Total Estimated Fees: Oakes Blvd Sidewalk and Roundabout Black & Veatch Fee Schedule Page 736 of 2661 Ardaman & Associates, Inc. ATTACHMENTS Page 737 of 2661 Page 738 of 2661 REVISION 8.2017 - FL Ardaman & Associates, Inc. Geotechnical, Environmental and Materials Consultants PROPOSAL/PROJECT ACCEPTANCE AND AGREEMENT PROJECT INFORMATION: Client Name: Project Name:Oakes Blvd Sidewalk and Roundabout Project Location:Naples, Collier County, Florida 22-417 –January 31, 2022 Subsurface Soil Exploration & Geotechnical Engineering Services Proposal Number and Date: Description of Services: Estimated Fee: $9,87 PROPERTY OWNER IDENTIFICATION: Name: Property Identification Number: Address: City/State:Zip Code:Phone: Attention:Title: SPECIAL INSTRUCTIONS: PAYMENT TERMS: Payment shall be due within 30 days after date of each periodic invoice. Interest at the rate of 18% per annum (or the highest rate allowable by law) shall accrue on all amounts not paid within 30 days after date of invoice. All attorney fees and expenses associated with collection of past due invoices will be paid by Client. Failure to timely pay any invoice shall constitute a waiver of any and all claims arising from or related to Ardaman & Associates, Inc.’s services, including but not limited to the services described in this Proposal. PROPOSAL ACCEPTANCE: By accepting this Proposal, the Terms and Conditions of this Proposal, including the Terms on this page, and Ardaman & Associates, Inc.’s General Conditions appearing on the following page of this Proposal, are incorporated herein by reference. In the event this Proposal Acceptance was received by facsimile, Client hereby confirms that the above -described Proposal, the Terms and Conditions of this Proposal, including the Terms on this page, and Ardaman & Associates, Inc.’s General Conditions have been made available and are incorporated in this agreement. Accepted this day of , 2022. (Print or type individual, firm or corporate body name) (Signature of authorized representative) (Print or type name of authorized representative and title) BILLING ADDRESS OF SIGNEE (include phone and fax number: Phone: Fax: Page 739 of 2661 REVISION 8.2017 - FL GENERAL CONDITIONS - FLORIDA Parties And Scope Of Work – Ardaman & Associates, Inc. (hereinafter referred to as “A&A”) shall include said company, its division, subsidiary, parent or affiliate performing the Work. “Work” means the specific services to be performed by A&A as set forth in A&A’s proposal as well as any additional services requested or accepted by Client. “Client” refers to the person or business entity ordering the Work to be done by A&A. If the Client is ordering the Work on behalf of a third party, the Client represents and warrants that the Client is the duly authorized agent of said third party for the purpose of ordering and directing said Work. In the event Client is not the authorized agent of said third party, Client shall be individually liable hereunder. Further, Client shall disclose any such agency relationship to A&A in writing before the commencement of A&A’s Work hereunder. Client agrees that A&A’s professional duties are specifically limited to the Work as set forth in A&A’s proposal. The Client assumes sole responsibility for determining whether the quantity and the nature of the Work ordered by the Client is adequate and sufficient for the Client’s intended purpose. A&A’s Work is for the exclusive use of Client, and its properly disclosed principal. In no event shall A&A have any duty or obligation to any third party. Directing A&A to proceed with the Work shall constitute acceptance of the terms of A&A’s proposal and these General Conditions. On-Call Services – In the event A&A is retained to perform construction materials testing (“CMT”), including but not limited to proctor and soil density tests, concrete tests, etc., on an On-Call basis such that A&A is not retained to perform continuous observations of construction, Client assumes sole responsibility for determining the location and frequency of sampling and testing. In such On-Call testing, A&A’s test results are only representative of conditions at the test location and elevation, and different conditions may exist at other locations and other elevations. Furthermore, in the event Client fails to properly determine the location or frequency of sampling and testing, under no circumstances will A&A assume that duty by performing its CMT services. Right-of-Entry – Unless otherwise agreed, Client will furnish right-of-entry on the property for A&A to make the planned borings, surveys, and/or explorations. A&A will take reasonable precautions to minimize damage to the property caused by its equipment and sampling procedures, but the cost of restoration or damage which may result from the planned operations is not included in the contracted amount. Damage to Existing Man-made Objects – It shall be the responsibility of the Client to disclose the presence and accurate location of all hidden or obscure man-made objects relative to field tests, sampling, or boring locations. Client waives any claim against A&A arising from any damage to existing man-made objects. In addition, Client shall defend, indemnify and hold A&A harmless from any third party claim arising from damage to existing man-made objects. Limitation of Liability - A&A shall perform services for Client in a professional manner, using that degree of care and skill ordinarily exercised by and consistent with the standards of competent consultants practicing in the same or a similar locality as the project. In the event any portion of the services fails to comply with this obligation and A&A is promptly notified in writing prior to one year after completion of such portion of the services, A&A will re-perform such portion of the services, or if re-performance is impracticable, A&A will refund the amount of compensation paid to A&A for such portion of the services. In no event shall A&A be liable for any special, indirect, incidental, or consequential damages. The remedies set forth herein are exclusive and the total liability of A&A whether in contract, tort (including negligence whether sole or concurrent), or otherwise arising out of, connected with or resulting from any and all services provided by A&A, including but not limited to the Work, shall not exceed the total fees paid by Client or $50,000.00, whichever is greater. Client may, upon written request received within five days of Client’s acceptance hereof, increase the limit of A&A’s liability by agreeing to pay A&A an additional sum as agreed in writing prior to the commencement of A&A’s services. This charge is not to b e construed as being a charge for insurance of any type, but is increased consideration for the greater liability involved. A&A’s individual professionals, employees, and agents are third party beneficiaries to these General Conditions, PURSUANT TO §558.0035, FLORIDA STATUTES, CONSULTANT’S INDIVIDUAL EMPLOYEES AND/OR AGENTS MAY NOT BE HELD INDIVIDUALLY LIABLE FOR NEGLIGENCE ARISING OUT OF, CONNECTED WITH, OR RESULTING FROM THEIR SERVICES PROVIDED PURSUANT TO THIS AGREEMENT. Sampling or Testing Location – Unless specifically stated to the contrary, the unit fees included in this proposal do not include costs associated with professional land surveying of the site or the accurate horizontal and vertical locations of tests. Field tests or boring locations described in our report or shown on our sketches are based on specific information furnished to us by others or estimates made in the field by our technicians. Such dimensions, depths or elevations should be considered as approximations unless otherwise stated in the report. Sample Handling and Retention – Generally test samples or specimens are consumed and/or substantially altered during the conduct of tests and A&A, at its sole discretion, will dispose (subject to the following) of any remaining residue immediately upon completion of test unless required in writing by the Client to store or otherwise handle the samples. (a) NON HAZARDOUS SAMPLES: At Client’s written request, A&A will maintain preservable test samples and specimens or the resi due therefrom for thirty (30) days after submission of A&A’s report to Client free of storage charges. After the initial 30 days and upon written request, A&A will retain test specimens or samples for a mutually acceptable storage charge and period of time. (b) HAZARDOUS OR POTENTIALLY HAZARDOUS SAMPLES: In the event that samples contain substances or constituents hazardous or detrimental to human health, safety or the environment as defined by federal, state or local statutes, regulations, or ordinances (“Hazardous Substances” and “Hazardous Constituents”, respectively), A&A will, after completion of testing and at Client’s expense: (i) return such samples to Client; (ii) using a ma nifest signed by Client as generator, will have such samples transported to a location selected by Client for final disposal. Client agrees to pay all costs associated with the storage, transport, and disposal of such samples. Client recognizes and agrees that A&A is acting as a bailee and at no time does A&A assume title of said waste. Discovery of Unanticipated Hazardous Materials – Hazardous materials or certain types of hazardous materials may exist at a site where there is no reason to believe they could or should be present. A&A and Client agree that the discovery of unanticipated hazardous materials constitutes a changed condition mandating a renegotiation of the scope of work or termination of services. A&A and Client also agree that the discovery of unanticipated hazardous materials may make it necessary for A&A to take immediate measures to protect health and safety. A&A agrees to notify Client as soon as practicable should unanticipated hazardous materials or suspected hazardous materials be encountered. Client encourages A&A to take any and all measures that, in A&A’s professional opinion, are justified to preserve and protect the health and safety of A&A’s personnel and the public. Client agrees to compensate A&A for the additional cost of working to protect employees’ and the public’s health and safety. In addition, Client waives any claim against A&A arising from A&A’s discovery of unanticipated hazardous materials or suspected hazardous materials. Indemnification – Client agrees to defend, indemnify and save harmless A&A from all claims, including negligence claims, suits, losses, personal injuries, death and property liability resulting from the actions or inactions of Client, Client’s contractors, representatives, agents and employees. Legal Jurisdiction – The parties agree that any litigation shall only be brought in a court of competent jurisdiction located in Orlando, Orange County, Florida. All causes of action, including but not limited to actions for indemnification and contribution, arising out of A&A’s Work shall be deemed to have accrued and the applicable statutes of limitation shall commence to run not later than the date of issuance of A&A’s final invoice for the Work. Each of the parties hereto irrevocably waives any and all right to trial by jury in any legal proceeding arising out of or relating to this agreement. Force Majeure - A&A shall not be held responsible for any delay or failure in performance caused by fire, flood, explosion, war, strike, embargo, government requirement, civil or military authority, acts of God, act or omission of subcontractors, carrier, clients or other similar causes beyond its control. Drafting and Severability – This Agreement has been drafted by all Parties hereto and shall not be construed against one Party or in favor of any other Party. In the event that any provision of this Agreement is held invalid, the remainder of this Agreement shall be fully enforceable. Page 740 of 2661 6ZHHW&KDG )URP0F&DQQD&\QWKLD 6HQW:HGQHVGD\0DUFK30 7R6ZHHW&KDG &F6FKQHHEHUJHU6DUD 6XEMHFW&(&RQVXOWDQW5RWDWLRQ$VVLJQPHQW2DNHV%OYG6LGHZDONV ,ŝŚĂĚ͕ ƐůŽŶŐĂƐǇŽƵĂƌĞƐƚŝůůŶĞŐŽƚŝĂƚŝŶŐƚŚĞŶƚŚĂƚŝƐĨŝŶĞ͘dŚĂŶŬǇŽƵĨŽƌŐŝǀŝŶŐŵĞĂŶƵƉĚĂƚĞ͘/ĂƉƉƌĞĐŝĂƚĞŝƚ͘ 5HVSHFWIXOO\ &\QWKLD0F&DQQD 3URFXUHPHQW6WUDWHJLVW Procurement Services Division 7DPLDPL7UDLO(DVW%OGJ&_1DSOHV)/ 2IILFH F\QWKLDPFFDQQD#FROOLHUFRXQW\IOJRY ͞,KtZtK/E'͍͟3OHDVH7DNH2XU6XUYH\ tĞĂƉƉƌĞĐŝĂƚĞǇŽƵƌĨĞĞĚďĂĐŬ͊ %LG6\QFQRZNQRZQDV3HULVFRSH6285&(LV&ROOLHU&RXQW\¶VELGSODWIRUPDQGUHJLVWUDWLRQLVIUHH 5HJLVWHUWRGD\DWZZZELGV\QFFRP )RUUHJLVWUDWLRQDVVLVWDQFHSOHDVHFRQWDFW%LG6\QFFXVWRPHUVHUYLFHDWRUHPDLO VXSSRUW#ELGV\QFFRP &ƌŽŵ͗^ǁĞĞƚŚĂĚфŚĂĚ͘^ǁĞĞƚΛĐŽůůŝĞƌĐŽƵŶƚǇĨů͘ŐŽǀх ^ĞŶƚ͗tĞĚŶĞƐĚĂǇ͕DĂƌĐŚϵ͕ϮϬϮϮϭ͗ϮϱWD dŽ͗DĐĂŶŶĂǇŶƚŚŝĂфǇŶƚŚŝĂ͘DĐĂŶŶĂΛĐŽůůŝĞƌĐŽƵŶƚǇĨů͘ŐŽǀх Đ͗^ĐŚŶĞĞďĞƌŐĞƌ^ĂƌĂф^ĂƌĂ͘^ĐŚŶĞĞďĞƌŐĞƌΛĐŽůůŝĞƌĐŽƵŶƚǇĨů͘ŐŽǀх ^ƵďũĞĐƚ͗&t͗ϭϴͲϳϰϯϮ;ͿŽŶƐƵůƚĂŶƚZŽƚĂƚŝŽŶƐƐŝŐŶŵĞŶƚͲKĂŬĞƐůǀĚ͘^ŝĚĞǁĂůŬƐ ,ŝǇŶƚŚŝĂ͕ǁĞĂƌĞƐƚŝůůŶĞŐŽƚŝĂƚŝŶŐǁŝƚŚůĂĐŬĂŶĚsĞĂƚĐŚ͘:ƵƐƚǁĂŶƚĞĚƚŽĐŚĞĐŬƚŚĂƚWƌŽĐƵƌĞŵĞŶƚǁŝůůƐƚŝůůĂůůŽǁ͘ dŚĂŶŬƐ͕ ŚĂĚ Page 741 of 2661 Page 742 of 2661 Page 743 of 2661 Page 744 of 2661 Page 745 of 2661 Page 746 of 2661 Page 747 of 2661 Page 748 of 2661 Page 749 of 2661 Page 750 of 2661 Page 751 of 2661 Page 752 of 2661 Page 753 of 2661 Page 754 of 2661 Page 755 of 2661 Page 756 of 2661 Page 757 of 2661 Page 758 of 2661 Page 759 of 2661 Page 760 of 2661 Page 761 of 2661 Page 762 of 2661 Page 763 of 2661 Page 764 of 2661 Page 765 of 2661 Page 766 of 2661 Page 767 of 2661 Page 768 of 2661 Page 769 of 2661 Page 770 of 2661 Page 771 of 2661 Page 772 of 2661 Page 773 of 2661 Page 774 of 2661 Page 775 of 2661 Page 776 of 2661 Page 777 of 2661 Page 778 of 2661 Page 779 of 2661 Page 780 of 2661 Page 781 of 2661 Page 782 of 2661 Page 783 of 2661 Page 784 of 2661