Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
CCPC Agenda 05/26/2021
Collier County Planning Commission Page 1 Printed 5/20/2021 COLLIER COUNTY Collier County Planning Commission AGENDA Board of County Commission Chambers Collier County Government Center 3299 Tamiami Trail East, 3rd Floor Naples, FL 34112 May 26, 2021 9: 00 AM Edwin Fryer- Chairman Karen Homiak - Vice-Chair Karl Fry- Secretary Christopher Vernon Paul Shea, Environmental Joseph Schmitt, Environmental Robert Klucik, Jr. Thomas Eastman, Collier County School Board Note: Individual speakers will be limited to 5 minutes on any item. Individuals selected to speak on behalf of an organization or group are encouraged and may be allotted 10 minutes to speak on an item if so recognized by the chairman. Persons wishing to have written or graphic materials included in the CCPC agenda packets must submit said material a minimum of 10 days prior to the respective public hearing. In any case, written materials intended to be considered by the CCPC shall be submitted to the appropriate county staff a minimum of seven days prior to the public hearing. All material used in presentations before the CCPC will become a permanent part of the record and will be available for presentation to the Board of County Commissioners if applicable. Any person who decides to appeal a decision of the CCPC will need a record of the proceedings pertaining thereto, and therefore may need to ensure that a verbatim record of the proceedings is made, which record includes the testimony and evidence upon which the appeal is to be based. May 2021 Collier County Planning Commission Page 2 Printed 5/20/2021 1. Pledge of Allegiance 2. Roll Call By Secretary 3. Public Hearings A. Advertised 1. PL20200001865 - CU: A Resolution of the Board of Zoning Appeals of Collier County, Florida providing for the establishment of a conditional use to allow a solar energy plant under the conditional use within the Agricultural-Mobile Home Overlay Rural Lands Stewardship Area Overlay (A-MHO RLSAO) zoning district pursuant to Subsection 2.01.03.G.1.a of the Collier County Land Development Code for property located on the east side of the intersection at SR 29 and SR 82 in Sections 4, 9 and 16, Township 46 South, Range 29 East, Collier County, Florida. [Coordinator: Timothy Finn, AICP, Principal Planner] 2. PL20200002161 - VA: A Resolution of the Board of Zoning Appeals of Collier County, Florida, relating to a request for a variance from Section 4.06.02.c Table 2.4 of the Collier County Land Development Code which requires a 20 foot landscape buffer along road right-of-way and a 10 foot landscape buffer abutting adjacent agricultural property to allow no buffer on the perimeter of the property, to be mitigated by supplementary native plantings along portions of SR 29, for the Immokalee Solar project, which property is in the Agricultural-Mobile Home Overlay Rural Lands Stewardship Area Overlay (A-MHO RLSAO) zoning district and located on the east side of the intersection at SR 29 and SR 82 in Sections 4, 9 And 16, Township 46 South, Range 29 East, Collier County, Florida. [Coordinator: Timothy Finn, AICP, Principal Planner] 4. Public Comment 5. Adjourn 05/26/2021 COLLIER COUNTY Collier County Planning Commission Item Number: 3.A.1 Item Summary: PL20200001865 - CU: A Resolution of the Board of Zoning Appeals of Collier County, Florida providing for the establishment of a conditional use to allow a solar energy plant under the conditional use within the Agricultural-Mobile Home Overlay Rural Lands Stewardship Area Overlay (A-MHO RLSAO) zoning district pursuant to Subsection 2.01.03.G.1.a of the Collier County Land Development Code for property located on the east side of the intersection at SR 29 and SR 82 in Sections 4, 9 and 16, Township 46 South, Range 29 East, Collier County, Florida. [Coordinator: Timothy Finn, AICP, Principal Planner] Meeting Date: 05/26/2021 Prepared by: Title: – Zoning Name: Tim Finn 05/11/2021 2:21 PM Submitted by: Title: Planner, Principal – Zoning Name: Anita Jenkins 05/11/2021 2:21 PM Approved By: Review: Planning Commission Diane Lynch Review item Completed 05/13/2021 2:09 PM Growth Management Operations & Regulatory Management Donna Guitard Review Item Completed 05/18/2021 11:50 AM Zoning Ray Bellows Additional Reviewer Completed 05/18/2021 1:47 PM Zoning Anita Jenkins Zoning Director Review Completed 05/19/2021 8:49 AM Growth Management Department James C French Additional Reviewer Completed 05/19/2021 1:43 PM Planning Commission Edwin Fryer Meeting Pending 05/26/2021 9:00 AM 3.A.1 Packet Pg. 3 CU-PL20200001865, IMMOKALEE SOLAR Revised Date: May 11, 2021 Page 1 of 12 STAFF REPORT TO: COLLIER COUNTY PLANNING COMMISSION FROM: ZONING DIVISION – ZONING SERVICES SECTION GROWTH MANAGEMENT DEPARTMENT HEARING DATE: MAY 26, 2021 SUBJECT: CU-PL20200001865; IMMOKALEE SOLAR COMPANION ITEM: VA-PL20200002161; BUFFER VARIANCE ______________________________________________________________________________ PROPERTY OWNER/CONTRACT PURCHASER/AGENT: Owner: Contract Purchaser: Barron Collier Partnership 2600 Golden Gate Parkway, Suite 200 Naples, FL 34105 Scott Scovill Florida Power and Light Company 700 Universe Boulevard Juno Beach, FL 33408 Agent: Alexis Crespo, AICP Waldrop Engineering, P.A. 28100 Bonita Grande Drive Bonita Springs, FL 34135 Note: FPL is also an applicant REQUESTED ACTION: To have the Collier County Planning Commission (CCPC) consider an application for a Conditional Use to allow a solar energy plant within the Agricultural-Mobile Home Overlay Rural Lands Stewardship Area Overlay (A-MHO RLSAO) zoning district pursuant to Subsection 2.01.03.G.1.a of the Collier County Land Development Code. GEOGRAPHIC LOCATION: The subject property is 578 +/- acres and is located on the east side of the intersection at SR 29 and SR 82 in Sections 4, 9 and 16, Township 46 South, Range 29 East, Collier County, Florida. (See location map on the following page) 3.A.1.a Packet Pg. 4 Attachment: Staff Report - Immokalee Solar (15591 : PL20200001865 Immokalee Solar CU) CU-PL20200001865, IMMOKALEE SOLAR Revised Date: May 11, 2021 Page 2 of 12 3.A.1.aPacket Pg. 5Attachment: Staff Report - Immokalee Solar (15591 : PL20200001865 Immokalee Solar CU) CU-PL20200001865, IMMOKALEE SOLAR Revised Date: May 11, 2021 Page 3 of 12 PURPOSE/DESCRIPTION OF PROJECT: The subject property consists of ± 578 acres, under multiple parcels but one ownership who provided authorization via affidavit. The petitioner seeks a Conditional Use to redevelop the property for a solar energy plant for the purpose of providing Collier County with a unique project that benefits the public by providing solar power to the overall power grid, which in time reduces the cost of power for all customers without generating toxic emissions. There are numerous benefits associated with the Florida Power & Light (FPL) solar project that include creating employment opportunities during construction, procurement of local resources when possible, economic boost to local businesses during construction, zero-emissions electricity generation, increased awareness of sustainable energy sources, and increased tax revenues for the county. FPL’s new solar plants generate zero emissions energy, using only the sun for fuel. When the sun is shining, the panels absorb the sunlight and convert it into direct current energy. The energy then flows through an inverter where it is transformed into alternating current electricity, the kind that is used in a residential home. The energy travels through FPL’s energy grid, where it is delivered to homes and businesses. The conceptual site plan (see page 4) provides ingress/egress from S.R. 29, supplemental native planting clusters, solar array development areas with access paths, gates, fences, a preserve, and an electrical collector yard. There is also a companion variance to this conditional use petition. The variance is from Section 4.06.02.c Table 2.4 of the Collier County Land Development Code which requires a 20-foot landscape buffer along road right-of-way and a 10-foot landscape buffer abutting adjacent agricultural property to allow no buffer on the perimeter of the property, to be mitigated by supplementary native plantings along portions of SR 29, for the Immokalee Solar project. Intentionally blank 3.A.1.a Packet Pg. 6 Attachment: Staff Report - Immokalee Solar (15591 : PL20200001865 Immokalee Solar CU) CU-PL20200001865, IMMOKALEE SOLAR Revised Date: May 11, 2021 Page 4 of 12 3.A.1.a Packet Pg. 7 Attachment: Staff Report - Immokalee Solar (15591 : PL20200001865 Immokalee Solar CU) CU-PL20200001865, IMMOKALEE SOLAR Revised Date: May 11, 2021 Page 5 of 12 SURROUNDING LAND USE AND ZONING: This section of the staff report identifies the land uses and zoning classifications for properties surrounding the boundaries of the subject property, which is developed agricultural and zoned Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO): North: Developed agricultural, with a current zoning designation of Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO) East: Developed agricultural, with a current zoning designation of Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO) South: Developed agricultural, with a current zoning designation of Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO) West: SR-29 (two-lane state road), then developed as agricultural and sparce single family residential with a current zoning designation of Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO) Aerial (Waldrop Engineering) 3.A.1.a Packet Pg. 8 Attachment: Staff Report - Immokalee Solar (15591 : PL20200001865 Immokalee Solar CU) CU-PL20200001865, IMMOKALEE SOLAR Revised Date: May 11, 2021 Page 6 of 12 GROWTH MANAGEMENT PLAN (GMP) CONSISTENCY: Comprehensive Planning staff has reviewed this request and offered the following comments: Future Land Use Element (FLUE): Florida Power and Light, Inc. (Applicant) is requesting approval of a Conditional Use to allow a solar power plant on 578+/- acres of land (Property) located directly to the east of the SR 29 and SR 82 intersection in unincorporated Collier County, Florida. The subject site is Agricultural/Rural Designation; Rural Lands Stewardship Area Overlay (RLSA) on the Future Land Use Map of the Growth Management Plan. Although the Future Land Use Element (FLUE) lists essential services uses on page 72, it does not specifically list electric generating plants. The LDC does allow a CU for this use in the RLSA. The LDC Ch. 2.01.03 Essential Services G. states: G. Conditional uses. The following uses require approval pursuant to section 10.08.00 conditional uses: 1. Conditional essential services in every zoning district excluding the RFMU district sending lands, CON districts, NRPAs, and RLSA designated HSAs and FSAs. In every zoning district, unless otherwise identified as permitted uses, and excluding RFMU district Sending Lands, CON districts, and NRPAs, the following uses shall be allowed as conditional uses: a. Electric or gas generating plants. Comprehensive Planning reviewed Immokalee Solar (CU) (PL20200001865) twice and found it consistent with the Growth Management Plan (GMP) in both reviews. Transportation Element: The project is consistent with Policy 5.1 of the Transportation Element of the Growth Management Plan, which states, “The County Commission shall review all rezone petitions, SRA designation applications, conditional use petitions, and proposed amendments to the Future Land Use Element (FLUE) affecting the overall countywide density or intensity of permissible development, with consideration of their impact on the overall County transportation system, and shall not approve any petition or application that would directly access a deficient roadway segment as identified in the current AUIR or if it impacts an adjacent roadway segment that is deficient as identified in the current AUIR, or which significantly impacts a roadway segment or adjacent roadway segment that is currently operating and/or is projected to operate below an adopted Level of Service Standard within the five year AUIR planning period, unless specific mitigating stipulations are also approved. A petition or application has significant impacts if the traffic impact statement reveals that any of the following occur: a. For links (roadway segments) directly accessed by the project where project traffic is equal to or exceeds 2% of the adopted LOS standard service volume; b. For links adjacent to links directly accessed by the project where project traffic is equal to or exceeds 2% of the adopted LOS standard service volume; and c. For all other links, the project traffic is considered to be significant up to the point where it is equal to or exceeds 3% of the adopted LOS standard service volume. 3.A.1.a Packet Pg. 9 Attachment: Staff Report - Immokalee Solar (15591 : PL20200001865 Immokalee Solar CU) CU-PL20200001865, IMMOKALEE SOLAR Revised Date: May 11, 2021 Page 7 of 12 Mitigating stipulations shall be based upon a mitigation plan prepared by the applicant and submitted as part of the traffic impact statement that addresses the project’s significant impacts on all roadways.” According to the information provided by the applicant the proposed Solar Facility will generate a deminimis number of maintenance related trips monthly based on similar facilities in Florida. Normally this can be +/- 4 trips per month depending on the facility. Therefore, the subject Conditional Use is found consistent with Policy 5.1 of the Transportation Element of the Growth Management Plan. Transportation Review: Transportation Planning staff has reviewed the petition request and is recommending approval. Stormwater Review: The proposed conditional use and variance requests are not anticipated to create drainage problems or adverse impacts to surrounding properties in the area. Stormwater best management practices, treatment, and storage will be addressed through the environmental resource permitting process. Landscape Review: Due to the companion variance to allow for no formal landscape buffers, the Landscape Buffer Easements typically shown on CU Master Plans are not shown. Environmental Review: Environmental Planning staff has reviewed the petition to address environmental concerns. The property is located within Rural Lands Stewardship Area Overlay (RLSAO) on lands designated as “Open.” The property has been historically cleared and used for agricultural uses since the early 1960’s. The minimum preserve requirement is 4.96 acres (40% of 12.4acres); the applicant has provided 5.74 acres of preservation onsite. The environmental data indicates the proposed project is in an area that has the potential to contain a variety of protected animal species. The two listed species observed onsite were American Alligator (Alligator mississippiensis) and Tricolored Heron (Egretta tricolor). The proposed project does not impact the existing habitats for the American Alligator since the project boundary does not include the large freshwater marshes areas located to the east of the subject property and preserves the remaining freshwater marshes within the subject property. It is anticipated that the suitable foraging habitat (freshwater marshes and drainage ditches) will not be impacted by the proposed project; therefore, any Tricolored Heron utilizing the site will be unaffected by the proposed project. The subject property is located within core foraging ranges for three Wood stork (Mycteria americana) colonies and contains foraging habitat for the Florida Sandhill Crane (Antigone candensis pratensis). Suitable foraging habitat for both the Florida Sandhill Crane and Wood Stork is present within the subject property (Drainage ditches, preserved marsh areas); however, no individuals were observed onsite. The proposed project is located within the U.S. Fish and Wildlife Service (FWS) consultation area for Bonneted Bat (Eumops floridanus). Although there are native vegetated areas present onsite, no evidence was found indicating the trees were being utilized by Bonneted Bat. Finally, the property contains potential habitat for caracara (Caracara cheriway); however, no caracara was observed onsite. Consultation with the US Federal Wildlife Service (USFWS) and the Florida Fish and Wildlife Conservation Commission (FWCC) regarding guidelines and permitting requirements will be required prior to construction. 3.A.1.a Packet Pg. 10 Attachment: Staff Report - Immokalee Solar (15591 : PL20200001865 Immokalee Solar CU) CU-PL20200001865, IMMOKALEE SOLAR Revised Date: May 11, 2021 Page 8 of 12 The Florida Fish and Wildlife Conservation Commission (FWC) wildlife data indicates the presence of Black Bear (Ursus americanus floridanus) in the area. A black bear management plan will need to be included at PPL or SDP review to provide awareness for employees working onsite. The Environmental Data indicates the subject property falls within (FWS) Secondary Florida Panther (Felis concolor coryi) habitat. There were no observations of panther onsite and the telemetry data indicates Florida panther are not abundant within the boundary of the proposed project. The property contains habitats preferred by the Florida panther, including 4 acres of Cabbage Palm (FLUCFCS 428) and 7.8 acres of Freshwater Marshes (FLUCFCS 641); therefore, consultation with FWS to obtain panther mitigation may be required. Prior to approval of the first development order, a second protected species survey of the subject property will be required to ensure construction activity will not impact listed species. The second listed species survey will primarily be focused on avian species; however, all listed species will be evaluated for their presence in and adjacent to the subject property. Environmental Services staff recommends approval of the proposed petition. Historic Preservation Review: Several Historical/Archaeological Probability Areas lie within the project boundaries. As such the petitioner was required to either submit a waiver application from the required historical and archaeological survey and assessment application or submit a historical and archaeological survey and assessment. In November 2020, the agent submitted a Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract conducted by Terracon Consultants, Inc. (See Attachment B) The conclusions of this survey resulted in no archaeological sites, archaeological occurrences, or historic structures encountered at the site. This application was heard before the Historic/Archaeological Preservation Board (HAPB) at its March 19, 2021 meeting and agreed with their conclusions and approved the Cultural Resource Assessment Survey. Solid and Hazardous Waste Management Division Review: Does not foresee any direct negative impact. Pollution Control Review: Pollution Control staff has reviewed the petition request, and support this project and the actions FPL is taking to provide clean energy and is recommending approval with the following Conditions of Approval: Pollution Control Conditional of Approval 1: “All hazardous products as defined in LDC Section 1.08.02 and petroleum products are required to be stored in secondary containment. The containment structure shall be capable of containing 110% of the volume of the largest container located within, be composed of materials impervious to the regulated substance, and be able to withstand deterioration from external environmental conditions. For containment areas with more than one storage container, capacity calculations shall be made after deducting the volume of the storage containers, other than the largest container. All regulated substances must be removed from the containment structure within 24-hours of a spill or accidental release. Containment structures shall be sheltered so that the intrusion of precipitation is effectively prevented.” Pollution Control Conditional of Approval 2: “The applicant shall provide a pollution prevention and response plan with at the time of SDP or SIP submittal.” Hendry and Lee County Reviews: Both counties have reviewed this petition and have no issues. (See Attachment C) 3.A.1.a Packet Pg. 11 Attachment: Staff Report - Immokalee Solar (15591 : PL20200001865 Immokalee Solar CU) CU-PL20200001865, IMMOKALEE SOLAR Revised Date: May 11, 2021 Page 9 of 12 Conservation & Coastal Management Element (CCME): Environmental review staff has found this project to be consistent with the Conservation & Coastal Management Element (CCME). The project site consists of 12.4 acres of native vegetation. A minimum of 4.96 (40%) acres of native vegetation shall be placed under preservation and dedicated to Collier County. STAFF ANALYSIS: When considering a Conditional Use petition, the CCPC must make findings that: 1) approval of the Conditional Use will not adversely affect the public interest and will not adversely affect other property of uses in the same district of neighborhood; and 2) all specific requirements for the individual Conditional Use will be met; and 3) satisfactory provisions have been made concerning the following matters, where applicable: 1. Section 2.01.03.G.1.a, of the LDC permits conditional uses in the Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO). The requested use for a solar energy plant is allowed as a conditional use in the Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO), subject to the standards and procedures established in section 10.08.00, conditional uses procedures, of the LDC. 2. Consistency with the Land Development Code (LDC) and the Growth Management Plan (GMP). This request is consistent with the GMP and, with the conditions proposed by staff, this project will be in compliance with the applicable provisions of the Land Development Code (LDC). 3. Ingress and egress to the property and proposed structures thereon, with particular reference to automotive and pedestrian safety and convenience, traffic flow and control, and access in case of fire or catastrophe. Ingress and egress to the subject property will be limited to a single access point on SR 29 as shown on the master site plan. The Transportation Impact Letter submitted by the applicant indicates that four trips per month will made to the site, which results in a de minimis impact to the surrounding roadway network. The roadway infrastructure (as noted above consistent with Florida State Statues) has adequate capacity to serve the proposed project at this time, i.e., GMP consistent at the time of rezoning as evaluated as part of the GMP Transportation Element consistency review. The project’s development must also comply with all other applicable concurrency management regulations and operational improvements when development approvals are sought at time of Site Development Plan (SDP) review. 4. The effect the Conditional Use would have on neighboring properties in relation to noise, glare, economic or odor effects. 3.A.1.a Packet Pg. 12 Attachment: Staff Report - Immokalee Solar (15591 : PL20200001865 Immokalee Solar CU) CU-PL20200001865, IMMOKALEE SOLAR Revised Date: May 11, 2021 Page 10 of 12 The proposed solar power field is virtually silent in terms of noise and will therefore generate little to no impact from a noise standpoint on neighboring properties. In terms of glare, the Applicant will provide a Glint and Glare study at the time of Site Development Plan approval, which outlines how the proposed solar panels create little glare due to the positioning of the panels and their significant setback from nearby roadways. The issue of glint and glare, as it pertains to photovoltaic systems, has been studied by the Federal Aviation Administration (FAA) and the US Air Force extensively. The Applicant takes precautionary design measures to ensure any glare from the placement of the solar panels does not cause travel hazards or impair the quality of life of the surrounding residences or buildings. The proposed 100-foot minimum setback of the solar panels from the SR 29 ROW will also assist in mitigating any visibility of glare by vehicles traveling north or south along SR 29. Beyond the environmental benefits the proposed solar field will generate, a new solar power plant can also be a facility of which construction will stimulate the local economy. The economic impact of the construction of the project will have a positive impact to the County and the local area. At the height of construction, the solar site is expected to employ approximately 200 construction workers for a period of six (6) to eight (8) months. Those workers in turn will provide a boost to the surrounding economy by dining and shopping at local conveniences while in the area. In the long run, the project provides the County and all FPL customers the advantage of lower utility bills once the solar field is up and running and inputting power into the overall power grid. The proposed solar project will not produce any odor that would impact neighboring properties. A solar energy center supports a clean and green method of producing energy. Unlike ground-level ozone and other pollutants produced by cars, power plants, industrial boilers, refineries, and chemical plants, a solar energy plant eliminates the potential for harmful toxic emissions caused by fossil fuels. Solar provides healthy air for future generations. 5. Compatibility with adjacent properties and other properties in the district. The site and proposed use are compatible with adjacent properties and other properties in the district. As outlined above, the proposed solar project will not create a compatibility issue in terms of noise, light, glare, or odor. Solar energy centers are virtually silent, operate autonomously and require no water for operation or maintenance. The panels sit low to the ground, and the layout of the site is uniquely designed to avoid impacts to wetlands and preserve areas. A solar center does not require staff to operate, so it will not bring more traffic to the area after construction. The surrounding area is comprised of mostly rural agricultural lands, with the nearest residential structure being approximately 440 feet from the closest solar panel development area. The proposed development standards comply with the underlying zoning district setbacks, and an enhanced 100-foot setback is proposed from the SR 29 frontage above and beyond what is required by the LDC. In addition to the proposed setbacks, the SR 29 frontage is comprised of an expansive area of existing vegetation, inclusive of preserve areas, ranging in width from 80+/- feet to more than 500 feet in some areas. This enhanced visual 3.A.1.a Packet Pg. 13 Attachment: Staff Report - Immokalee Solar (15591 : PL20200001865 Immokalee Solar CU) CU-PL20200001865, IMMOKALEE SOLAR Revised Date: May 11, 2021 Page 11 of 12 screening will assist in mitigating any visual impacts from the solar panels to the nearby roadway. In addition to the significant setback from SR 29, there is a noticeable elevation difference between the project boundary and the existing conditions on SR 29, where the site is much lower than the travel lanes of the roadway. Due to the difference in elevation, the solar panels are lower to the ground, and will be difficult to see from the roadway or from any surrounding properties. The project will not utilize fill dirt to raise the solar panels up as is typical on most residential or commercial projects. In terms of maintenance and cleaning of the solar panels, the project will rely on rainwater to wash off the panels from any naturally occurring dust, dirt, or debris. There will be no use of industrial-grade solvents, washes, or soaps of any kind. There are no solar sites in the state of Florida that utilize anything other than rainwater. Therefore, the development will not result in a negative impact to the surrounding properties from a drainage and runoff standpoint. If the proposed Conditions of Approval are adopted, the proposed solar energy plant can be found compatible with adjacent properties and other properties in the immediate area. Based on the above findings, this conditional use should, with stipulations as outlined in this staff report be recommended for approval. ENVIRONMENTAL ADVISORY COUNCIL (EAC) RECOMMENDATION This project does not require Environmental Advisory Council (EAC) review, as this project did not meet the EAC scope of land development project reviews as identified in Section 2 -1193 of the Collier County Codes of Laws and Ordinances. NEIGHBORHOOD INFORMATION MEETING (NIM): The NIM was scheduled for Thursday, February 25, 2021, 5:30 pm at the North Collier Regional Park, Exhibit Hall A, located at 15000 Livingston Rd, Naples, Fl 34109. No members of the public were present or participating remotely and therefore no recording or transcript has been available. A copy of the NIM advertising are included in Attachment D – Backup Materials. COUNTY ATTORNEY OFFICE REVIEW: The County Attorney’s Office reviewed the staff report on 5-7-21. RECOMMENDATION: Staff recommends that the Collier County Planning Commission (CCPC) approve Petition CU- PL20200001865, subject to the following conditions: 1. Immokalee Solar Conditional Use shall be limited to what is depicted on the “Conceptual Site Plan, revised 03/09/2021,” prepared by Jacobs. 2. All hazardous products as defined in LDC Section 1.08.02 and petroleum products are required to be stored in secondary containment. The containment structure shall be 3.A.1.a Packet Pg. 14 Attachment: Staff Report - Immokalee Solar (15591 : PL20200001865 Immokalee Solar CU) CU-PL20200001865, IMMOKALEE SOLAR Revised Date: May 11, 2021 Page 12 of 12 capable of containing 110% of the volume of the largest container located within, be composed of materials impervious to the regulated substance, and be able to withstand deterioration from external environmental conditions. For containment areas with more than one storage container, capacity calculations shall be made after deducting the volume of the storage containers, other than the largest container. All regulated substances must be removed from the containment structure within 24-hours of a spill or accidental release. Containment structures shall be sheltered so that the intrusion of precipitation is effectively prevented. 3. The applicant shall provide a Stormwater Pollution Prevention Plan (SWPPP) compliant with Chapter 62-621.300(5), FAC., at the time of SDP or SIP submittal. 4. A follow up listed species survey observation will be needed prior to construction. Soil ground water testing will be needed at first development order. Attachments: A) Proposed Resolution B) Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract C) Hendry and Lee County Reviews D) Application/Backup Materials E) Hybrid Waiver 3.A.1.a Packet Pg. 15 Attachment: Staff Report - Immokalee Solar (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.b Packet Pg. 16 Attachment: Attachment A - Proposed Resolution (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.b Packet Pg. 17 Attachment: Attachment A - Proposed Resolution (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.b Packet Pg. 18 Attachment: Attachment A - Proposed Resolution (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.b Packet Pg. 19 Attachment: Attachment A - Proposed Resolution (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.b Packet Pg. 20 Attachment: Attachment A - Proposed Resolution (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.b Packet Pg. 21 Attachment: Attachment A - Proposed Resolution (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.b Packet Pg. 22 Attachment: Attachment A - Proposed Resolution (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.b Packet Pg. 23 Attachment: Attachment A - Proposed Resolution (15591 : PL20200001865 Immokalee Solar CU) CULTURAL RESOURCE ASSESSMENT SURVEY OF THE IMMOKALEE SOLAR ENERGY CENTER TRACT Collier County, Florida Project No. HK207363 November 2020 Prepared for: Florida Power & Light 700 Universe Blvd. Juno Beach FL, 33408-2657 Prepared by: Terracon Consultants, Inc. Jacksonville, Florida 3.A.1.c Packet Pg. 24 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee CULTURAL RESOURCE ASSESSMENT SURVEY OF THE IMMOKALEE SOLAR ENERGY CENTER, COLLIER COUNTY, FLORIDA By Brian McNamara, M.A., R.P.A., And Brent Handley, M.A., R.P.A. Prepared For: Florida Power & Light, Juno Beach Office 700 Universe Blvd. Juno Beach, Florida 33408-2567 Report of Investigations No: 1953 ___________________________ _____________________________ Brent M. Handley, M.A., R.P.A. Gary K. Howalt, PWS Cultural Resource Department Manager Senior Principal/Department Manager 3.A.1.c Packet Pg. 25 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Responsive ■ Resourceful ■ Reliable i TABLE OF CONTENTS Page TABLE OF CONTENTS .............................................................................................................. i LIST OF FIGURES ...................................................................................................................... ii LIST OF TABLES ........................................................................................................................ ii 1 INTRODUCTION................................................................................................................... 1-1 2 ENVIRONMENTAL SETTING ........................................................................................... 2-1 Physiography............................................................................................................................ 2-1 Soils.......................................................................................................................................... 2-1 Hydrology ................................................................................................................................ 2-1 Current Conditions ................................................................................................................... 2-1 3 CULTURAL HISTORY OF FLORIDA ............................................................................... 3-1 Archaic Period ......................................................................................................................... 3-2 Woodland Period (500 BC - AD 750) ..................................................................................... 3-3 Contact and Mission Period (AD 1539-1704) ......................................................................... 3-3 British Florida (1763-1784) ..................................................................................................... 3-6 Second Spanish Period ............................................................................................................. 3-8 Seminole Period (AD 1750-1840) ........................................................................................... 3-8 American Territorial (1821-1845) to the Early 20th Century ................................................... 3-8 4 BACKGROUND RESEARCH .............................................................................................. 4-1 Regional History ...................................................................................................................... 4-1 Florida Master Site File ........................................................................................................... 4-2 Historic Map Research ............................................................................................................. 4-5 5 RESEARCH DESIGN AND METHODOLOGY ................................................................ 5-1 Expected Results ...................................................................................................................... 5-1 Field Methodology ................................................................................................................... 5-1 Laboratory Methods ................................................................................................................. 5-2 Site Significance ...................................................................................................................... 5-2 Informant Interviews ................................................................................................................ 5-3 Procedures to Deal with Unexpected Results .......................................................................... 5-3 6 RESULTS ................................................................................................................................ 6-1 Pedestrian Inspection: .............................................................................................................. 6-1 Subsurface Testing: .................................................................................................................. 6-1 Historic Structure Review and Indirect APE ........................................................................... 6-1 7 CONCLUSIONS AND RECOMMENDATIONS ................................................................ 7-1 8 REFERENCES CITED .......................................................................................................... 8-8 APPENDIX A: Survey Log Sheet 3.A.1.c Packet Pg. 26 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Responsive ■ Resourceful ■ Reliable ii LIST OF FIGURES Page Figure 1.1: Project Location Map ........................................................................................... 1-1 Figure 2.1: Soils Map ............................................................................................................. 2-2 Figure 2.2: View of fallow citrus grove ................................................................................. 2-3 Figure 2.3: View of northern tree island ................................................................................ 2-3 Figure 3.1: Regions of Pre-Columbian Florida ...................................................................... 3-3 Figure 3.2: Detail of A Map of the Southern British Colonies by Capt. William DeBrahm, depicting East and West Florida. ....................................................................... 3-10 Figure 4.1: Previously Recorded Cultural Resources ............................................................. 4-3 Figure 4.2: Original 1872 survey by Deputy Surveyor William Apthorp .............................. 4-6 Figure 4.3: USGS 1958 Topographical Map of West Palm Beach ........................................ 4-7 Figure 4.4: USGS 1987 Topographic map of West Palm Beach ........................................... 4-7 Figure 4.5: Aerial Photograph of Hendry County (Flidght 1D, 1947) ................................... 4-8 Figure 4.6: USGS 1994 Satellite Image ................................................................................. 4-9 Figure 6.1: Testing Results ..................................................................................................... 6-2 LIST OF TABLES Page Table 4.1: Previously Recorded Cultural Resources in Project Vicinity .............................. 4-1 3.A.1.c Packet Pg. 27 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 Responsive ■ Resourceful ■ Reliable 1-1 1. INTRODUCTION In November 2020, Environmental Services, Inc. (ESI), a Terracon Company, conducted a cultural resource assessment survey (CRAS) of the approximately 632-acre Immokalee Solar Energy Center Energy Center in Collier County, Florida (Figure 1.1). The project area comprises all, or portions of Township 46 South, Range 29 East, Sections 04, 03, 09, 10, 16, 15, 21, 22 as seen on the Immokalee (1987 Edition) United States Geological Surveys (USGS) topographical quadrangle map. According to the Collier County Property Appraiser (CCPA), the parcels ID numbers are 00063280003, 00064320001, and 00065000003. The investigation was undertaken on behalf of Florida Power & Light (FPL) in compliance with State regulations. The goals of the survey were to locate, delineate, identify and evaluate all cultural resources within the proposed project area, and to assess their significance and potential eligibility for listing in the National Register of Historic Places (NRHP) The term "cultural resources" as used herein is meant to refer to sites or objects that are archaeological, architectural, and/or historical in nature. All work was conducted with respects to the cultural resources provisions of Section 106 of the National Historic Preservation Act of 1966 (PL 89-190, as amended) and its implementing regulation 36 CFR Part 800 (Protection of Historic Properties); Chapter 267, Florida Statutes, as well as the Florida Division of Historical Resources (DHR) recommendations for such projects as stipulated in the Division’s Historic Preservation Compliance Review Program manual and Rule Chapter 1A-46, Florida Administrative Code. The proposed direct effect area (DEA) for this project includes the property boundaries as direct effect area (DEA), and the neighboring parcels for visual effect areas (VEA). Given the nature of the proposed solar project, it was assumed that the VEA of 500-feet around the project boundaries was adequate for potential future projects. Prior to fieldwork, a search of the Florida Master Site File (FMSF) identified no previously recorded cultural resources within the project area. Fieldwork consisted of a pedestrian inspection along with 168 shovel tests. The fieldwork was conducted by archaeologists Brian McNamara, Joshua Newman, Robert Lundin, and Katie Ulewicz under the direction of Brent Handley, who served as Principal Investigator. Architectural survey methods consisted of a review of the Collier County property appraiser’s website, a review of the FMSF for any previously recorded resources, and a pedestrian investigation to field verify all architectural resources within the project area. As a result of the survey, no archaeological sites, isolated artifacts, or historic structural remains were encountered. Based on the findings of the CRAS, it is the recommendation of Terracon Consultants Inc. that no historic properties will be affected by the proposed project. 3.A.1.c Packet Pg. 28 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 Responsive ■ Resourceful ■ Reliable 1-2 Figure 1.1: Project Location Cultural Resource Assessment Survey Immokalee Solar Energy Center Collier County, Florida 3.A.1.c Packet Pg. 29 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 Responsive ■ Resourceful ■ Reliable 2-1 2. ENVIRONMENTAL SETTING Environmental variables have always had an important influence on the selection of habitation and special use sites by human groups. The availability of water, dry land, and associated natural resources (i.e., food, material for tools, etc.) has had a pronounced effect on prehistoric technological organization and mobility strategies (Anderson 1990:198). Therefore, knowledge of past environments coupled with archaeological data is critical to the reconstruction of past lifeways and in drawing appropriate conclusions regarding site location and interpretation. Physiography The project area is within the Estero Bay-Cape Romano Coastal Strip of the Southwestern Flatwoods district. The area is a low energy coast with few well-developed beaches and mangrove swamps. The poorly drained mainland is a flatwood plain with less than 12 feet in elevation. On a larger scale, the district is made up of Miocene and Pliocene sedimentary rocks (Brooks 1981). Soils According to the soil survey of Collier County, Florida (USDA), the project area is comprised of four distinct soil types (Figure 2.1). These soil types are described as the, poorly drained Oldsmar fine sand (0-2% slopes); Chobee, Winder, and Gator soils, (depressional); Holopaw fine sand; and Hilolo, Jupiter, and Margate find sands. Hydrology Running through the project area is a system or large drainage canals and smaller irrigation ditches. The irrigation ditches are furrowed in between planted orange grove rows in a north – south orientation. Also present in proximity to the project area are several low-lying wet areas. According to the soil survey, portions of the tract contain poorly drained soils. Current Conditions The project area is currently a fallow citrus grove. (Figure 2.2). Located in the north of the project area is an island of uncleared palm trees with a dense tropical understory (Figure 2.3). The southern area of the project tract is bisected by a large overhead power transmission line and corridor. 3.A.1.c Packet Pg. 30 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 Responsive ■ Resourceful ■ Reliable 2-2 Figure 2.1: Area Soils Cultural Resource Assessment Survey Immokalee Solar Energy Center Collier County, Florida 3.A.1.c Packet Pg. 31 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 Responsive ■ Resourceful ■ Reliable 2-3 Figure 2.2: View of fallow citrus grove Figure 2.3: View of northern tree island 3.A.1.c Packet Pg. 32 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 Responsive ■ Resourceful ■ Reliable 3-1 3. CULTURAL HISTORY OF FLORIDA Evidence for the earliest human occupations in the southeastern United States dates from the Paleoindian period (10,000 and 12,000 BC) to present time. This section will provide a board view of the major cultural traditions ranging from the Paleoindian period to the mid-20th century. Paleoindian Period The earliest radiocarbon dates firmly associated with human artifacts in unquestioned contexts indicate people were living in North Florida by at least 11,050 BP (Hemmings 2004). This was during the Clovis phase of the Early Paleoindian subperiod. Evidence for occupation of Florida during the subsequent Middle Paleoindian subperiod is much more secure. The diagnostic Suwannee and Simpson lanceolate bifaces are relatively common in north and central Florida, and although no radiocarbon dates have been obtained in association with these artifacts, they are believed to date sometime around 11,000-10,500 BP (Goodyear 1999). Prior to 2016, radiocarbon dates clustering at 10,000 BC have been generated from sites located in counties along the gulf coast (Cockrell and Murphy 1978; Clausen et al. 1979). However, by 2016, pre-Clovis occupation was indicated at the Page-Ladson Site within the Aucilla River in Florida (Halligan et al. 2016). This is the earliest evidence for human habitation in Florida, and the Southeast. The Page-Ladson site was calculated at 14,550 calendar years before present. This demonstrates that the earliest peopling of the North American was within the Gulf Coast region at the same time as other locations in North America. The Page-Ladson Site also indicated that the possibility of co-existence of humans and megafauna in the Southeast. Based on the recovery of diagnostic Paleoindian artifacts (i.e., stone projectile points), the major areas of Paleoindian site concentration are within the Northern Panhandle and central Gulf Coast regions of Florida, including the Suwannee and Santa Fe rivers of North Florida (Dunbar and Waller 1983). These localities are characterized by areas of exposed Tertiary age limestone that served as important sources of stone tool material to these early peoples. Theories about Paleoindian existence are based primarily upon site size and the uniformity of the known stone tool kit of the period. These Indians were nomadic hunters who supplemented their carnivorous diet by gathering various edible plants. The most widely accepted model for the peopling of North and South America argues that Asian populations migrated to North America over the Beringia land bridge that formerly linked Siberia and Alaska some 12,000 years ago (Smith 1986). However, archaeological data are mounting in support of migrations that date to before 12,000 years ago (Adovasio et al. 1990; Dillehay et al. 2008). Alternative pre-12,000 BP migration routes that have been hypothesized include populations travelling along the Pacific and Atlantic coasts using boats or following an exposed shoreline (Anderson and Gillam 2000; Bradley and Stanford 2004; Dixon 1993; Faught 2008; Fladmark 1979). These sites would now be inundated as a result of higher sea levels. Regardless of the precise timing of the first occupations, the current evidence suggests that Florida was not intensively inhabited by humans prior to about 12,000 years ago. Due to preservation biases in the archaeological record, lithic tools, generally associated with past hunting and butchering activities, are the most frequently recovered artifacts at Paleoindian sites. The most common Paleoindian implement was the stone lanceolate projectile point. 3.A.1.c Packet Pg. 33 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 Responsive ■ Resourceful ■ Reliable 3-2 Diagnostic spear point types found in Florida include Clovis, Simpson, Suwannee, and Dalton (Bullen 1975). Archaeological evidence also suggests that bone pins, stone knives, lithic scrapers and atlatls were also used by Paleoindian hunters (Milanich 1994). Archaic Period The environment of the Archaic period (7500-500 B.C.) was characterized by warmer climatic conditions and higher sea levels, resulting in the emergence of a mesic oak-hickory forest (Milanich and Fairbanks 1980). Modern sea levels were reached around 5000 B.P. during the middle Holocene changing the climate of the area. The Pleistocene megafauna were unable to adapt to the more arid Holocene environment. This period happens in this Holocene environmental time of change between 10,000 to 3000 B.P. As a result, Archaic period Indians focused their subsistence strategies on the procurement of smaller game, fish, wild plant foods, and in some cases, shellfish. Thus, the period seems to have been characterized by changes in human subsistence patterns, tool manufacturing techniques, and the surrounding environment itself. As the population became more sedentary, a variety of site types evolved, including base camps, short-term camps, procurement camps, and cemeteries. These site sizes increased during the transition of sub-stages (Early, Middle, Late Archaic) that were necessary for the changing systems of increased social complexity. By about 6500 BC, the Florida populace had developed a sedentary, or semi-sedentary, settlement system wherein groups seem to have established permanent habitation sites of larger size than had been utilized previously. However, small groups continued to roam the interior, periodically aggregating at large centralized settlements within the central highlands of North Florida (Hemmings and Kohler 1974). Recent excavation at the Wedgeworth site in south Florida revealed patterns that shed light on how Archaic people adapted, perhaps thrived in an environment long believed by archaeologist to have been unsuitable for the establishment of communities (Locascio 2019:4). While many small lithic scatter sites potentially dating to the Archaic period in Florida have been recorded, only a few large Archaic sites have been investigated archaeologically. Milanich and Fairbanks (1980:50-51) suggest that the increased variety of projectile points and tools may reflect ethnicity and perhaps, cultural relationships with similar groups located outside of Florida. Archaic groups produced a tool assemblage that was not as well executed as th ose of the Paleoindian period. Qualitatively, Archaic period stone tools are quite different from those of the earlier Paleo era in that, with some prominent exceptions, they appear to have been much more expediently produced. Observable wear patterns indicate varied uses of individual tools, and the degree of attrition is comparatively minimal in many cases, suggesting that tools were used sparingly before being discarded. Paleoindian tools, on the other hand, were manufactured for specific tasks, and were repeatedly used until they were lost, broken or worn out. The most well- known artifacts of the Archaic Period in Florida belong to a family of large, stemmed spear poi nt types that are variations of a basic design, and include Hillsborough, Newnan, Alachu a, Putnam and Marion types (Bullen 1975). Tools in other parts of the state where chert material for Archaic points were not available include bone and shell tools, bone awls, bone points, and manufactured antler tools. It can also be noted that different pottery manufacturing techniques emerged in the late archaic during the Orange period. Orange period Archaic sites have little difference from earlier Archaic sites in size, location, or artifact assemblages, except for the presence of this fiber-tempered pottery (Smith 2012). 3.A.1.c Packet Pg. 34 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 Responsive ■ Resourceful ■ Reliable 3-3 Woodland Period (500 BC - AD 750) According to Milianch (1994) Florida can be described regionally based upon distinctive cultures until after 500 BC. Though, regional culture existed in the Archaic, distinctive pottery styles were more regional, correlating with different geographical regions (Figure 3.1). Figure 3.1 Regions of Pre-Columbian Florida (Milanich 1994; xix) Region 7: Caloosahatchee Caloosahatchee I-V (AD 700- AD 1750) Charlotte and Lee counties were the primary locale of a people known as the Calusa. The Calusa were a sedentary group that harvested whelk, shellfish and other marine food sources. Part of the Calusa's success came from their prime location north of the swamps and south of the generally unproductive prairies. This area has a gradual runoff of nutrients into the shallow inshore marine waters, which supported a healthy supply of natural food production. Fishing in shallow pools and estuaries was of utmost importance to the subsistence ways of the Calusa; agriculture was not practiced. Archaeological research indicates the importance of fishing and shellfish to the 3.A.1.c Packet Pg. 35 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 Responsive ■ Resourceful ■ Reliable 3-4 Calusa's diet. This focus on marine animals was supplemented with animals such as white-tailed deer, fowl, turtle and alligators (Fradkin 1976; Milanich 1994). It also appears that certain areas were fished on a massive communal scale employing techniques to gather the food source en masse (Milanich 1994). Vegetables also made up a portion of the Calusa diet and plants such as mastic fruit, prickly pear cactus fruit, palm fruits, sea grapes, hogplum cocoplum, goosefoot and starchy grasses have been identified in the ethnohistoric and archaeological records (Fontaneda 1944; Zubillaga 1946; Scarry and Newsom in prep.). The ceramic sequence introduced by Widmer (1988) follows. Caloosahatchee I (500 BC- AD 700) this period’s dominant ceramic type are sand tempered and laminated sand tempered pottery. However, this period is more importantly marked by the lack of Belle Glades pottery, which is a distinguishing aspect of the Caloosahatchee II (AD 700-1200) period. Sites of this period include Solana (Windmer 1986); Useppa Island (Milanich et al 1984); Wightmand (Fradkin 1976); and Cash Mound (Marquardt 1992). Caloosahatchee II (AD 700-1200) was a period where the population among the Calusa had reached its critical level; where fissioning off into new villages along the periphery of an established village could no longer accommodate the population's stress on food levels. It is believed that the Calusa adopted a hegemonic rule over their neighbors in the region (Widmer 1988). Neighbors are gradually annexed into the Calusa culture by alliances or force. This increase in importance of leaders is reflected in the massive earthworks and other public works such as canals. An increase in leaders sway through the region starts to also be seen in the archaeological record by an increase in foreign goods. Various other hypotheses have been offered for the system of rule that persisted through Colonial Spanish times. These hypotheses explain the change from a hunter-gather lifestyle into a chiefdom by such rationales as prehistoric climate change and the protohistoric introduction of European artifacts (Marquardt 1986). In any event the Calusa were a people with a strong central power structure capable of organizing canal construction and large earthworks such as non-mortuary ceremonial mounds and having political sway over all of south Florida. The Buck Key midden and the John Quiet Site on the Cape Haze Peninsula have been dated to this period (Bullen and Bullen 1956; Marquardt 1992). Caloosahatchee III (AD 1200-1400) is a period that is mainly noted by the occasional inclusion of St. Johns, notably St. Johns Check Stamped and Englewood ceramics. It is thought that the St Johns ceramics are a trade item while the Englewood ceramics is believed to have been used in mortuary rituals. Galt, Josslyn Island, Pineland, and Buck Key contain shell middens that date to this period (Marquardt 1992). Caloosahatchee IV (AD 1400-1513) is a period when a lot of different ceramics from around Florida start being included in archaeological assemblages. Archaeological research has revealed the inclusion of Glades tooled ceramics coming into the Calusa region from the south. Safety Harbor Incised and Pinellas Plain ceramics, which are generally associated with the central Peninsular Coast Region around Tampa Bay, are also included in the Caloosahatchee IV assemblages. 3.A.1.c Packet Pg. 36 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 Responsive ■ Resourceful ■ Reliable 3-5 Caloosahatchee V (AD 1513-1750) is a period that is contemporaneous with European contact. European artifacts begin to appear in sites associated with aboriginal artifacts. Cultural materials from the Leon-Jefferson Mission period have also been recovered (Widmer 1988). Contact and Mission Period (AD 1539-1704) Accounts by Spanish explorers and missionaries, combined with archaeological data, have helped to specifically identify a number of the indigenous populations on the Florida peninsula. The major native groups of northern Florida were Timucuans, who were descendants of the St. Johns, Alachua, and other known prehistoric archaeological societies. Following the movement of the de Soto entrada through North Florida in 1539, the Florida natives were forced to adapt to a rapidly changing physical and cultural environment. During the Spanish Mission period, the native population was decimated by introduced European diseases, and groups were frequently relocated and consolidated to facilitate missionization and exploitation of their labor by the Spaniards. The historic period Indians of North Florida were a Western Timucua tribe known as the Utina, who are believed to have had the largest population of any Timucuan group (Milanich 1978:70; Milanich and Fairbanks 1980:217). The first documented contact with the Utina (Outina) was in 1528 by the Spaniard Panfilo de Narvaez (Milanich 1978:70). In 1539, the de Soto expedition traveled through the Utina territory, and visited three Utina towns including Aguacaleyquen, Uriutina, and Napituca (Milanich and Hudson 1993). It was in the Utina province that the entrada abandoned their northerly route and turned west toward Apalachee. After leaving the village of Aguacaleyquen, the entrada camped at a small, unnamed village that Milanich and Hudson (1993:177) place near Alligator Lake in Columbia County. At Napituca, located near the Suwannee River, de Soto and his men engaged in a battle with the Utina, whose warriors numbered over 300 (Milanich 1978:70). Several decades later, the French Huguenots, who occupied Fort Caroline near the mouth of the St. Johns River, reported interacting with the Utina, who lived a short distance (ca. 20 mil es) west of the St. Johns River (Bennett 1964). Recent research indicates that there were two distinct groups referred to as Utina by the Europeans (Hann 1990). The confusion presumably stems from the fact that Utina is the common Timucuan word for chief (Milanich and Hudson 1993:150). Following the lead of Johnson (1991), Milanich and Hudson (1993) distinguish between the two Utina groups and designate the St. Johns group as Eastern Utina and the North Florida group as Northern Utina. Spanish Missions were established in the North Florida or Utina region during the early seventeenth century and continued until around 1689 or 1690 (Milanich 1978:73). Weisman (1991:191) argues that the Spaniards never used the term Utina but referred to the area as the "land or province of the Timucua." Prior to the founding of missions in North Florida, European contact with the Utina-Timucua was intermittent. The mid-17th century Utina population was more consolidated and groups were concentrated in sedentary horticultural villages in the southern and western sections of the Utina territory along the St. Augustine to Apalachee trail (Milanich 1978:74). The appearance of Leon-Jefferson ceramics at mission-related sites dating to the seventeenth century marks the movement of Apalachee Indians into North Florida. Johnson 3.A.1.c Packet Pg. 37 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 Responsive ■ Resourceful ■ Reliable 3-6 (1991) has recorded several mission period sites in the vicinity of Alligator Lake, and one such mission (San Juan de Guacara) is located at Charles Springs (Loucks 1993:212; Worth 1992:59). British Florida (1763-1784) In 1764 Great Britain gained control of the Florida peninsula when Spain relinquished the province as part of treaty negotiations ending the Seven Years War, known better in the U.S. as the French and Indian War (1756-1763). Spanish colonists and their Native-American allies evacuated en masse. Most of the former Floridians moved to Cuba, while a few went to Mexico (Gannon, ed. 1996, 136; Gold 1961:29-54). Great Britain emerged from the war as the world’s most powerful empire. In Florida, unlike during the recently terminated centuries of Spanish rule, the British did not have to concern themselves with hostilities and attacks from nearby enemy colonies; the entire Atlantic coast of North America was in British possession after 1763. With Florida, Great Britain acquired a colony, which had been emptied of rival inhabitants of European origin. The remaining Native Americans and escaped Africans did not qualify as settler material in the eyes of the British. With the Proclamation of 1763, British administrators split the former Spanish colony into East and West Florida at the Apalachicola River (Figure 3.2). The Proclamation of 1763 assigned Native Americans to lands west of the Appalachians in the colonies north of Florida. A 1765 agreement between the Native Americans in Florida and the new British government in East Florida relegated Native activity to the west side of the St. Johns River, in a manner similar to the Proclamation of 1763. Migrating Creek groups of Native Americans had begun moving into Spanish Florida about 1715 and by the time of the arrival of the British, these groups were known as Seminoles. They were the Native American participants in the 1765 agreement (Gannon, ed. 1996:187-89). The new British owners hoped to turn the Florida peninsula into a land of profitable plantations. Entrepreneurs in the British Isles devised exotic schemes toward that end. Indigo and rice were crops that were particularly favored at the time. Surveyors and publicists visited Florida to encourage land sales on the Home Island and subsequent development. A proclamation provided for township grants of up to 20,000 acres or for family grants that were apportioned according to family size. James Grant, the new Governor of East Florida was anxious to colonize the province. He realized that good roads would increase trade, speed communications, permit rapid movement of military forces and supplies, and encourage settlers to locate along the way (Coomes 1976: 36). 3.A.1.c Packet Pg. 38 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 Responsive ■ Resourceful ■ Reliable 3-7 Figure 3.2 Detail of A Map of the Southern British Colonies by Capt. William DeBrahm, Depicting East and West Florida. Based on surveys by James Moncrief, Military Engineer, and by William Gerard De Brahm, Surveyor General for the Southern District of North America, Grant recommended the location for a future settlement, and proposed to build “… a road from this p lace to the Mosquetoes. It will be a continuation of the Subscription Road and will be a continuation of the Subscription Road...”. The location favored by Grant was selected some few years later by Dr. Andrew Turnbull for his New Smyrna colony (Coomes 1976: 37). The King’s Road had hardly been completed when the American Colonies declared their independence from British rule. When Georgia and South Carolina required their citizens to take a strict oath of allegiance to the Revolutionary cause, the province of East Florida became a haven for the Loyalists. A stream of some 7,000 refugees came in 1778 alone. Many arrived in St. Augustine over the King’s Road, and Governor Patrick Tonyn was hard pressed to take care of them (Coomes 1976: 43-44). Historian Leitch Wright thought that half of the 12,000 refugees were slaves brought by their fleeing owners. A community of Loyalist refugees sprang up at St. Johns Bluff, and at least 200 substantial houses appeared at the community, called St. Johns Town (Wright 1975:126). 3.A.1.c Packet Pg. 39 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 Responsive ■ Resourceful ■ Reliable 3-8 Second Spanish Period Spain’s support of the American revolutionaries was re-paid at the peace talks in 1782 with the restoration of the Floridas to the Spanish empire. This time it was the British who would evacuate, although quite a few British subjects chose to remain in now-Spanish East Florida. The majority chose to relocate to other parts of the British Empire. Many of the migrants had only resided in Florida for a short time. In July 1784 a Spanish governor once again took command of the Florida peninsula. Spain, however, lacked the resources to develop the area, and the presence of hostile Indian groups played into the decision not to expand. During the Second Spanish period, Florida provided a place for runaway slaves, contrab and trade, and slave smuggling. The combination of angry homeless Indians, escaped slaves, British arms merchants and slave traders, and frontiersmen created a land of lawlessness and unrest. To further add to the confusion, new settlers coming from Georgia, Alabama, and South Carolina were interested in adding Florida to the United States. When Andrew Jackson invaded Florida during the First Seminole War in 1818, it became clear that Spain could no longer control the region and it was transferred to the United States in 1821 as a territory (Adams 1990:4). Seminole Period (AD 1750-1840) Following Moore's destructive raids (1702-1704) on the Spanish Mission system, which stretched from St. Augustine westward to present day Tallahassee, the North Florida region was abandoned. It was later occupied by Creek Indian refugees, known today as Seminoles, who began to infiltrate into northern Florida from Georgia and Alabama during the mid-eighteenth century (Weisman 1989). The most notable Seminole settlement in the vicinity was Alligator Town, which existed somewhere near Alligator Lake as late as 1817. Between 1821 and 1845, central Florida was the scene of numerous hostilities between several bands of Seminoles and white settlers. To the south, the rich pasturelands around East Lake Tohopekaliga were used by Spanish ranchers and Seminole Indians during the 19th century. The 1823 Treaty of Moultrie Creek confined the Seminoles to an approximately 4 -million-acre tract in the center of the state (Mahon 1967:50). Over the next decade, two more treaties were forced upon the Seminoles in an attempt to remove the Seminole population to Oklahoma. The terms of the treaties were considered unfair by the Seminoles, and their signing led to the S econd Seminole War in 1835 (Mahon 1967:75-83). A military outpost, Fort Mason, was established on the eastern bank of Lake Eustis around 1830. With the end of the Second Seminole War, the Armed Occupation Act was approved in 1842 to encourage settlement of central Florida. As a result, any family head or male over the age of 18 was eligible to receive 160 acres provided they agreed to cultivate at least five acres, build a dwelling, and reside there for at least five years (Tebeau 1980:149). Soon settlers, mostly southern Anglo-American farmers, began to infiltrate American Territorial (1821-1845) to the Early 20th Century In 1821, the United States government created the Territory of Florida and named Andrew Jackson military governor. Jackson initiated the Americanization of Florida, naming Tallahassee the seat of the territorial government. St. Augustine lost its political influence as capital of the province of East Florida, and instead became the seat of government for St. Johns County. 3.A.1.c Packet Pg. 40 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 Responsive ■ Resourceful ■ Reliable 3-9 In 1822, Congress appointed a board of land commissioners with the task of confirming or rejecting private claims in Florida. A process that often-included translating Spanish documents, obtaining old surveys from archives, and deposing witnesses, the reviewing of claims slowed the public survey and land sales by the state and federal governments. Still, by the end of 1825, the East Florida commissioners had confirmed 325 claims and rejected sixty-one others. Congress furnished final adjudication for eighty-eight other claims that consisted of 3,000 or more acres, while several large grants were adjudicated in the courts during the 1830s (Tebeau 1980). 3.A.1.c Packet Pg. 41 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 4-1 4. BACKGROUND RESEARCH Regional History: Collier County Southwest Florida remained virtually uninhabited until after the Civil War when farmers and squatters made their way south. Early pioneers fished and hunted for a living, raised crops, dug clams, made charcoal, sold bird plumes and trapped otters and alligators for their pelts and hides. Trading posts started by Ted Smallwood on Chokoloskee Island and George Storter at Everglades City became important gathering places for the few isolated settlers and Indians. By the late 1880s, Naples and Marco Island were already gaining popularity as winter resorts for wealthy Northerners and sportsmen (https://www.paradisecoast.com/article/quick-history-naples- the-paradise-coast). Collier County was created from the southern portion of Lee County by an act of the Florida Legislature on May 8, 1923. The decision was signed into law by Governor Cary A. Hardee, Florida's 28th governor. It is Florida's 62nd county and the third largest in total land area - 2,305 square miles (http://www.fl-genweb.org/decole/collier/Index.html). Collier County and the Town of Naples’ creation in 1923, as well as its early economic growth, were closely tied to Memphis-born millionaire, Barron Gift Collier. With his fortune from streetcar advertising, Collier introduced paved roads, electric power, telegraphs and countless new businesses and homeowners to Florida’s last frontier. The completion of the Tamiami Trail in 1928 also unlocked the region’s enormous agricultural and resort potential. Florida’s first commercial oil well was brought in at Sunniland in 1943, and Collier County’s cypress logging industry flourished at Copeland well into the 1950’s. World War II introduced hundreds of aircraft servicemen to Naples when the U.S. Army Airfield (now Naples Airport) was activated in 1943 to train combat pilots. At one point, several hundred men and 53 aircraft were assigned to the Naples base. Many veterans returned after the war as prospective home buyers and businessmen. A direct hit by Hurricane Donna in 1960, actually stimulated Naples’ growth with an infusion of insurance money and loans. In the short span of thirty years, number of County residents swelled from 6,488 in 1950, to a phenomenal 85,000 by 1980. The County seat was transferred from Everglades City to East Naples in 1962 and signaled a new era of sustained growth in agriculture, tourism, and real estate that have made Naples and Collier County one of the fastest developing areas in the nation (https://www.paradisecoast.com/article/quick-history-naples-the-paradise-coast). 3.A.1.c Packet Pg. 42 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 4-2 Florida Master Site File (FMSF) A review of the archaeological site file records maintained by the FMSF indicated that no previously recorded cultural resources are within the project area. Extending the search to include the general vicinity of the project area revealed no archaeological sites, three resource groups, and three historic structures (Table 4.1, Figure 4.1). None of resources are within the VEA of the current project area. A brief description of the previously completed survey within the project boundaries and some of the more notable resources in the area follows below. Table 4-1 Previously Recorded Cultural Resources Site ID Site Name Resource Type Cultural Period / Year SHPO Evaluation CR00979 SR82 Linear Resource 1950-present Ineligible for NRHP CR01309 SR29 Linear Resource 1900-present Ineligible for NRHP HN00518 SR29 Linear Resource 1900-present Ineligible for NRHP CR00982 1660 SR 82 RD Historic Structure c1959 Ineligible for NRHP CR01187 3077 SR-29 N Historic Structure c1967 Ineligible for NRHP CR01188 3065 SR-29 N Historic Structure c1969 Ineligible for NRHP 3.A.1.c Packet Pg. 43 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 4-3 Figure 4.1 Previously Recorded Cultural Resources Cultural Resource Assessment Survey Immokalee Solar Energy Center Collier County, Florida 3.A.1.c Packet Pg. 44 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 4-4 FMSF Survey# 1108: 1986- Historical/architectural survey of Collier County, Florida. By Florida Preservation Services on behalf of Collier County. FMSF Survey# 8141: 2001- An Archaeological and Historical Survey of the Proposed DT Immokalee Tower Location in Collier County, Florida. By Julie Batategas on behalf of ATC Associates. FMSF Survey# 14907: 2007- Cultural Resource Assessment Survey of State Road 82 from Lee Boulevard to State Road 29 Lee, Hendry and Collier Counties. By Janus Research on behalf of Florida Department of Transportation. FMSF Survey# 16907: 2009- Cultural Resource Assessment Survey Project Development and Environment (PD&E) Study S.R. 29 from North of S.R. 82 to south of C.R. 80A Col lier and Hendry Counties, Florida. By Archaeological Consultants Inc. on behalf of Florida Department of Transportation, District One. FMSF Survey# 20705: 2014- Cultural Resource Assessment Survey Technical Memorandum Amendment, State Road (SR) 29 from North of SR 82 to South of County Road (CR) 80A, Collier and Hendry Counties, Florida; FPID No.: 417878-2-22-01, FAP No.: NA, County Section Nos: 03080 and 07060. By ACI on behalf of AIM Engineering & Surveying Inc. FMSF Survey# 20872: 2014- Cultural Resource Assessment Survey Lee County Electric Cooperative (LCEC) SR 82 and SR 29 Distribution Line Replacement, Co llier County, Florida. By ACI on behalf of W. Dexter Bender & Associates, Inc. FMSF Survey# 21923: 2015- Cultural Resource Assessment Survey Technical Memorandum Addendum Preferred Stormwater Treatment Areas, State Road (SR) 82 from Gator Slough Lane to SR 29, Collier County, Florida Financial Project ID No.: 430849-1-52-01. By ACI on behalf of HTNB. FMSF Survey# 21792: 2015- Cultural Resource Assessment Survey Technical Memorandum Preferred Stormwater Treatment Areas, State Road (SR) 82 from Gator Slough Lane to SR 29, Collier. By ACI on behalf of HTNB. FMSF Survey# 23126: 2016- Cultural Resource Assessment Survey Technical Memorandum, Regional Stormwater Pond 4B and Proposed Roundabout State Road 82 from Gator Slough Lane to SR 29, Collier County, Florida; Financial Project ID No. 430849-1-32-01. By ACI on behalf of Florida Department of Transportation. FMSF Survey# 24480: 2017- Cultural Resource Assessment Survey Technical Memorandum Preferred Ponds, Drainage Easements, and Right-of-Way, State Road (SR) 82 from the Hendry County Line to Gator Slough Lane, Collier County, Florida Financial Project ID No.: 430848-1- 52-01. By ACI. 3.A.1.c Packet Pg. 45 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 4-5 FMSF Survey# 25332: 2018- Lane, Collier County, Florida Financial Project ID No.: 430848-1- 52-01. By Janus Research. FMSF Survey# 26188: 2019- Cultural Resource Assessment Survey Orange River to Terrytown 500 kV Transmission Line Rebuild. By Janus Research on behalf of FPL. Historic Map Research A review of historic maps, along with aerial photography and satellite imagery indicates that the project parcel remained largely undeveloped throughout history. Deputy Surveyor William Apthorp depicted the property in 1872 as largely devoid of any landmark, trail or features. His map shows much of the region to be wetland (Figure 4.2). By 1958 highways 82 and 29 have been established, and together with the Atlantic Coastal Railroad to the east, are the main routes of travel through the region (Figure 4.3). Aerial photography from 1945 reveals the project tract to be mostly inundated grassland, with few trees (Figure 4.5). By 1987, area drainage and land reclamation efforts has brought more road development as the citrus industry begins to make use of the area (Figure 4.4.). A 1994 Satellite image shows the property fully established as a citrus farm, in a layout that remains virtually unchanged to the modern day (Figure 4.6). 3.A.1.c Packet Pg. 46 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 4-6 Figure 4.2, Original 1872 survey by Deputy Surveyor William Apthorp 3.A.1.c Packet Pg. 47 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 4-7 Figure 4.3 USGS 1958 Topographical Map of West Palm Beach Figure 4.4, USGS 1987 Topographic map of West Palm Beach 3.A.1.c Packet Pg. 48 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 4-8 Figure 4.5 Aerial Photograph of Hendry County (Flidght 1D, 1947) 3.A.1.c Packet Pg. 49 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 4-9 Figure 4.6 USGS 1994 Satellite Image 3.A.1.c Packet Pg. 50 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 Responsive ■ Resourceful ■ Reliable 5-1 5. RESEARCH DESIGN AND METHODOLOGY The fieldwork for this project was preceded by: a review of the Florida Master Site File (FMSF) to determine the presence of previously recorded cultural resources within the study area; an examination of soil maps; the attainment of familiarity with topographic maps of the project area so that elevation data could be utilized; a review of historic aerial photographs (UFDC); a review of the USGS maps; a review of historic topographic maps from the late 1800s and early 1900s (FCIT 2009; Topoview) and an investigation of previous archaeological research pertaining to the region. For the purpose of conducting a cultural resource investigation, it is important to focus on locations that are conducive to human settlement. The factors that are usually constant in locating sites include: well drained soils, availability of a water source, relative elevation and slope, and hardwood vegetation. While vegetation is usually an important indicator of elevation and soil type, native biotic communities are often not present today, owing to human induced environmental changes. Therefore, knowledge of past environments, coupled with archaeological data specific to a given area, is critical in predicting and interpreting site locations and in the reconstruction of past lifeways. Expected Results Given the size of the project area, and the scarcity of cultural resources in the general vicinity, it was expected that few archaeological deposits would be encountered during the pedestrian inspection and subsurface testing. The property drainage capacity is somewhat poorly to very poorly drained, which suggests a reduced probability. Field Methodology Fieldwork for direct effect area (DEA) consisted of pedestrian inspection coupled with subsurface testing throughout the project area. A 500-foot visual effects area (VEA) was established round the project area and was searched for any structures 50 years or older. Pedestrian Inspection: The walkover survey was conducted along transects spaced at 25 and 50- meter intervals that were aligned north-south and east-west. The pedestrian inspection focused primarily on areas of surface exposure and disturbance such as dirt trail roads, ditches, and agricultural fields. Subsurface Testing: The subsurface testing included the excavation of shovel tests throughout the project area at 25, 50, 100 and 200-meter intervals. Shovel tests (n=168) were square-shaped measuring 50 cm in diameter and extending to one-meter below ground surface whenever possible. All excavated soil was sifted through 6.35 mm (1/4”) mesh mounted upon a portable shaker screen. Locational accuracy in the field was maintained through the use of an aerial map, a compass, and GPS/collector applications. All field notes and maps from this survey were transported to the Terracon laboratory for curation. Historic Resource Survey: A historic resource survey was conducted to locate above ground historic properties within and adjacent to the study tract. The survey included a search of the FMSF database for known historic resources in the general vicinity, in additio n to a search of the Collier County Property Appraiser website. 3.A.1.c Packet Pg. 51 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 Responsive ■ Resourceful ■ Reliable 5-2 Laboratory Methods Materials recovered during the investigation were cleaned, analyzed, and entered in to a database. A standardized catalogue system, initiated during fieldwork, was employed to ensure that provenience data was recorded for all artifacts. This record-keeping method facilitated subsequent laboratory processing and analysis. Site Significance In order for a site to be considered a significant resource, it must meet one or more of four specific criteria established in 36 CFR Part 60, National Register of Historic Places, nominations by state and federal agencies, and 36 CFR Part 800, Advisory Council on Historic Preservation, Protection of Historic Properties. The evaluation of a prehistoric or historic cultural resource for inclusion on the National Register of Historic Places rests largely on its research potential, that is, its ability to contribute important information through preservation and/or additional study. The National Register criteria for evaluation are stated as follows: The quality of significance in American history, architecture, archaeology, engineering, and culture is present in districts, sites, buildings, structures, and objects that possess integrity of location, design, setting, materials, workmanship, feeling, and association, and; Criterion A: Properties that are associated with events that have made a significant contribution to broad patterns of our history; Criterion B: Properties that are associated with lives of persons significant in our past; Criterion C: Properties that embody the distinctive characteristics of a type, period, or method of construction or that represent the work of a master, or that possess high artistic values, or that represent a significant and distinguishable entity whose components may lack individual distinction; and Criterion D: Properties that have yielded, or may be likely to yield, important information in prehistory or history. While many archaeological sites are recommended as eligible to the NRHP under Criterion D, the potential to “yield information important in prehistory and history,” this criterion is rather ill- defined. In order to clarify the issue of site importance, the following attribute evaluations add a measure of specificity that can be used in assessing site significance and NRHP eligibility: a). Site Integrity – Does the site contain intact cultural deposits or is it disturbed? b). Preservation – Does the site contain material suited to in-depth analysis and/or absolute dating such as preserved features, botanical material, faunal remains, or human skeletal remains? 3.A.1.c Packet Pg. 52 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 Responsive ■ Resourceful ■ Reliable 5-3 c). Uniqueness – Is the information contained in the site redundant in comparison to that available from similar sites, or do the remains provide a unique or insightful perspective on research concerns of regional importance? d). Relevance to Current and Future Research – Would additional work at this site contribute to our knowledge of the past? Would preservation of the site protect valuable information for future studies? While this category is partly a summary of the above considerations, it also recognizes that a site may provide valuable information regardless of its integrity, preservation, or uniqueness. Informant Interviews Locating archaeological sites and gaining familiarity with the history of a project tract is often facilitated through interviewing local citizens that live or spend time within close proximity to the parcel. One individual was encountered during fieldwork who was tending canal locks within the project area. The gentleman had no knowledge of any artifacts being discovered within the property boundary. Procedures to Deal with Unexpected Results Archaeologists frequently encounter unanticipated features that require efforts that exceed the scope of project expectations. In such cases, it is sometimes necessary to reevaluate the research design and/or seek additional funding to address unexpected discoveries. It is our policy to amend a project research design as needed to ensure that proper treatment and evaluation are afforded to unexpected findings. Coordination with the client and the office of the SHPO is a necessary step in such an approach. Unexpected findings might include the discovery of human remains during project construction, which would require additional coordination with the state archaeologist in compliance with Chapter 872.05, Florida Statutes, or a medical examiner if the remains appear less than 75 years old. 3.A.1.c Packet Pg. 53 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 Responsive ■ Resourceful ■ Reliable 6-1 6. RESULTS In November 2020, Terracon conducted a CRAS of the Immokalee Solar Energy Center tract in Collier County, Florida. The goals of the survey were to locate, delineate, identify, and evaluate all cultural resources within the proposed project area, and to assess their significance and potential eligibility for listing in the NRHP. Field methods included a thorough pedestrian inspection coupled with shovel testing (n=168) (Figure 6.1). Pedestrian Inspection: The walkover survey included transects spaced at 25 and 50-meter intervals that were aligned north-south in line with citrus grove planting rows. During the pedestrian inspection, the project tract was noted as having severe soil disturbance through earth moving activities, which occurred mostly via land drainage, reclamation and irrigation practices. The fallow citrus groves are mostly overgrown with area grasses with limited visibility except for tree removal and artificial water management impacts. The citrus grove contains cut irrigation ditches that lead to drainage canals. There is also an underground irrigation system for crop irrigation. Historically the area was once wet prairie grassland. Area drainage was necessary to establish current agricultural land. Subsurface Testing: The subsurface testing consisted of 168 shovel tests dug throughout the project area at 25, 50, and 100-meter intervals. Most of the shovel tests revealed disturbed soils throughout the tract, primarily in the upper layers of the soil’s stratigraphic profile. The disturbance was mostly related to agricultural practices; irrigation ditches or canals that occurred within the property since the mid to late-20th century. The lower stratigraphic layers of 70+ cm below surface are believed to be the original natural surface soil horizon. All of the tests were dug to 100 cm below surface whenever possible or terminating prior to 100 cm below surface due to hydric soils. A typical shovel test profile included the following: Stratum I (0 to 30 cm below surface) light grey sand; and Stratum II (31 to 70 cm below surface) grey sand; Stratum III (70 to 80 cm below surface) white hydric sand; and 80+ hydric. Another sequence was Stratum I (0 to 19 cm below surface) mottled grey brown sand; and Stratum II (19 to 100 cm below surface) very pale brown sand that is hydric in the deeper level. As a result of the subsurface testing and pedestrian inspection, no archaeological sites, isolate artifacts, or historic structural remains were encountered. Historic Structure Review and Indirect APE In addition to the archaeological survey, this study also included a historic resource survey to locate potential historic standing structures within parcels immediately adjacent to the DEA. The VEA was established as 500-feet from the project boundary. A review of the Collier County Property Appraiser revealed no identified structures within the viewshed of the project area. The historic aerial and map review identified only utilities, agricultural-related structures and two modern residential structures within the project area. 3.A.1.c Packet Pg. 54 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 Responsive ■ Resourceful ■ Reliable 6-2 Figure 6.1: Testing Results Cultural Resource Assessment Survey Immokalee Solar Energy Center Collier County, Florida 3.A.1.c Packet Pg. 55 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 Responsive ■ Resourceful ■ Reliable 7-1 7. CONCLUSIONS AND RECOMMENDATIONS In November 2020, Terracon conducted a cultural resource assessment survey of the Immokalee Solar Energy Center tract in Collier County, Florida. The goals of the survey were to locate, delineate, identify and evaluate all cultural resources within the proposed project area, and to assess their significance and potential eligibility for listing in the National Register of Historic Places in accordance with National Register Criteria (36 CFR 60.4). The fieldwork strategy included a pedestrian inspection coupled with subsurface testing (n=168) throughout the project area. The pedestrian survey included visually inspecting areas of exposed ground surface to locate artifacts and/or historic structural remains. The subsurface testing included the excavation of 168 shovel tests throughout the project area at 25, 50, 100 and 200- meter intervals. As a result of the survey, no archaeological sites, archaeological occurrences or historic structures were encountered. Based on the results of the CRAS, it is Terracon’s recommendation that no historic properties will be affected by the proposed solar project. 3.A.1.c Packet Pg. 56 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar Energy Center ■ Collier County, Florida November 2020 ■ Terracon Project No. 207363 Responsive ■ Resourceful ■ Reliable 8-8 8. REFERENCES CITED Adams, William R. 1990 Cultural Resources Survey of St. Lucie County, Florida. MS on file, DHR, Tallahassee. Adovasio, J. M., J. Donahue, and R. Stuckenrath 1990 The Meadowcroft Rockshelter Radiocarbon Chronology 1975-1990. American Antiquity 55:348-355 Anderson, David G. 1990 The Paleo-Indian Colonization of Eastern America: A View from the Southeastern United States. In Early Paleo-Indian Economies of Eastern North America, edited by B. Isaac and K. Tankersley, pp 163-216. Journal of Economic Anthropology, Supplement 5. Anderson, D.G., and J.C. Gilliam 2000 Paleoindian Colonization of the Americas: Implications from an Examination of Physiology, Demography, and Artifact Distribution. American Antiquity 65(1):43-66 Bense, Judith A 1989 Pensacola Archaeological Survey and Summary of Archaeological Information in Pensacola to 1988. Vol. 1, 2. Pensacola Archaeological Society Publication 2. Pensacola, Florida. 1992 Santa Rosa Swift Creek in Northwest Florida. Paper presented at the 49th annual meeting of the Southeastern Archaeological Conference, Little Rock, Arkansas. 1994a Archaeology of the Southeastern United States: Paleoindian to World War I. Academic Press, New York. 1994b Configuration of the Bernath Ring Midden Site (8SR986) near Pensacola, Florida: and Introduction of a new Explanation for Ring Midden Sites. Paper presented at the 51st annual meeting of the Southeastern Archaeological Conference, Lexington, Kentucky. Santa Rosa-Swift Creek in Northwestern Florida. In A World Engraved: Archeology of the Swift Creek Culture, edited by Mark Williams and Daniel T. Elliot, pp. 247-273. University of Alabama Press, Tuscaloosa. Benton, Dale G. and Mildred Fryman 1978 An Archaeological and Historical Survey of the PGA Resort Community Development. Department of State, Division of Archives. Report on file, DHR Tallahassee. Bradley, B., and D. Stanford 2004 The North Atlantic Ice-edge Corridor: A Possible Paleolithic Route to the New World. World Archaeology 34:459-478 3.A.1.c Packet Pg. 57 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar References Cited Responsive ■ Resourceful ■ Reliable 8-9 Brooks, H. K. 1981 Physiographic Divisions: State of Florida. Map and Text. Florida Cooperative Extension, Institute of Food and Agricultural Sciences, University of Florida, Gainesville. Bullen, Ripley P. 1975 A Guide to the Identification of Florida Projectile Points. Kendall Books, Gainesville. Carbone, Victor A. 1983 Late Quaternary Environments in Florida and the Southeast. Florida Anthropologist 36 (1-2): 3-17. Clausen, Carl J., A. D. Cohen, Cesare Emiliani, J. A. Holman and J. J. Stipp 1979 Little Salt Spring, Florida: A Unique Underwater Site. Science 203: 609-614. Cockrell, W. A. and Larry Murphy 1978 Pleistocene Man in Florida. Archaeology of Eastern North America Vol. 6 Eastern States Archaeological Federation, Newark, Delaware. Coomes, Charles S. 1976 The Old Kings Road of British East Florida. El Escribiano April 1976. Crabtree, Donald 1972 An Introduction to Flintworking. Occasional Papers of the Idaho State University Museum No. 28. Pocatello, Idaho. Cumbaa, Stephen 1976 A Reconsideration of Freshwater Shellfish Exploitation in the Florida Archaic. Florida Anthropologist 29:45-59. Daniel, I. Randolph, Michael Wisenbaker, and George R. Ballo 1986 The Organization of A Suwanee Technology: The View from Harney Flats. Florida Anthropologist 39:24-56. Daniel, I. Randolph and Michael Wisenbaker 1987 Harney Flats: A Florida Paleoindian Site. Baywood Publishing Company, Inc., Farmingdale, New York. Dillehay T.D., C. Ramirez, M. Pino, M.B. Collins, J. Rossen, and J.D. Pino-Navarro 2008 Monte Verde: Seaweed, Food, Medicine, and the Peopling of South America. Science 320:784 3.A.1.c Packet Pg. 58 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar References Cited Responsive ■ Resourceful ■ Reliable 8-10 Dixon, E. James 1993 Quest for the Origins of the First Americans. University of New Mexico Press, Albuquerque Dunbar, James S. and Ben I. Waller 1983 A Distribution Analysis of the Clovis/Suwanee Paleoindian Sites of Florida: A Geographic Approach. Florida Anthropologist 36(1-2): 18-30. Faught, Michael K. 2008 Archaeological Roots of Human Diversity in the New World: A Compilation of Accurate and Precise Radiocarbon Ages from Earliest Site. American Antiquity 73(4):670-698 Fladmark, K. 1979 Routes: Alternate Migration Corridors for Early Man in North America. American Antiquity 44:55-69 FLGenWeb NA Brief History of Collier County. https://sites.google.com/a/flgenweb.net/collier/ Accessed November 2020 Florida Center for Instructional Technology (FCIT) 2002 Exploring Florida Maps: A Social Studies Resource for Students and Teachers. Florida Center for Instructional Technology, College of Education, University of South Florida. Florida Division of Historical Resources (FDHR) 2002 Cultural Resource Management Standards and Operational Manual. Department of State, Tallahassee. 2007 Resource Group Form: Version 4.0 1/07. Department of State, Tallahassee, Florida Master Site File. Florida Preservation Services 1987 The Pleasant Street Historic District: A Study for the City of Gainesville, Florida. On File with the FMSF, Survey # 1517. Gannon, Michael, ed. 1996 The New History of Florida. Gainesville: University Press of Florida. Goodyear, A.C. 1999 The Early Holocene Occupation of the Southeastern United States: A Geoarchaeological Summary. In Ice Age People of North America: Environment, Origins, and Adaptations, edited by R. Bonnichsen and K.L. Turnmire, pp. 432- 481. Oregon State University Press, Corvallis. Halligan, et al 3.A.1.c Packet Pg. 59 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar References Cited Responsive ■ Resourceful ■ Reliable 8-11 2016 Pre-Clovis occupation 14,550 years ago at the Page-Ladson site, Florida, and the peopling of the Americas. Science Advances, vol. 2, no. 5, e1600375; doi: 10.1126/sciadv.1600375 Hann, John H. 1991 Missions to the Calusa. University Press of Florida, Gainesville. Hemmings, C.A. 2004 The Organic Clovis: A Single Continent-wide Cultural Adaptation. Ph.D. dissertation, Department of Anthropology, University of Florida, Gainseville Hemmings, E. Thomas and Tim A. Kohler 1974 The Lake Kanapaha Site in North Central Florida. Florida Bureau of Historic Sites and Properties Bulletin 4:45-64. Johnson, Kenneth W. 1991 The Utina and the Potano Peoples of Northern Florida: Changing Settlement Systems in the Spanish Colonial Period. Ph.D. diss. University of Florida, Gainesville. Johnson, Kenneth W., and Bruce Nelson 1990 The Utina: Seriation and Chronology. Florida Anthropologist 43 (1): 48-62. Kohler, Timothy 1978 The Social and Chronological Dimensions of Village Occupations at a North Florida Weeden Island Period Site. Unpublished Ph.D. dissertation, Department of Anthropology, University of Florida. 1991 The Demise of Weeden Island, and Post-Weeden Island Cultural Stability in Non- Mississippianized Northern Florida. In Stability, Transformation, and Variation, pp. 91- 110, ed. By Michael S. Nassaney and Charles R. Cobb. Plenum Press, New York. Locascio, Williams A. Ph.D., 2019 Tree Island Communities of the late Archaic: An Archeological Case from the Everglades Agricultural Area. Loucks, Jill 1993 Spanish-Indian Interaction on the Florida Missions: the Archaeology of Baptizing Spring. In The Spanish Missions of La Florida, edited by Bonnie G. McEwan, pp. 193-216, University Press of Florida, Gainesville. Mattieson, Gene 2007 Personal Communication with Dr. Brian Marks 10/3/07. 3.A.1.c Packet Pg. 60 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar References Cited Responsive ■ Resourceful ■ Reliable 8-12 McGee, Harold 2007 Personal Communication with Dr. Brian Marks 10/4/07. Milanich, Jerald T. 1971 The Deptford Phase: An Archaeological Reconstruction. Unpublished Ph.D. Dissertation, Department of Anthropology, University of Florida, Gainesville. 1972 Tacatacuru and the San Pedro de Mocama Mission. Florida Historical Quarterly 41:283-291. 1973 Southeastern Deptford Culture: A Preliminary Definition. Bureau of Historic Sites and Properties, Division of Archives, History, and Records Management Bulletin 3:51-63. 1978 The Western Timucua: Pattern of Acculturation and Change. In Taccachale: Essays on the Indians of Florida and Southeastern Georgia During the Historic Period, pp. 59-88, ed. By J. T. Milanich and S. Proctor. University of Florida Press, Gainesville. 1994 The Archaeology of Pre-Columbian Florida. University Presses of Florida, Gainesville. Milanich, J.T., A.S. Cordell, V.J. Knight, Jr., T.A. Kohler, and B. Sigler-Lavelle 1984 McKeithen Weeden Island: The Culture of Northern Florida, AD 200-900. Academic Press, New York. Milanich, J. T. and C. H. Fairbanks 1980 Florida Archeology. Academic Press, New York. Milanich, Jerald T. and Charles Hudson 1993 Hernando deSoto and the Indians of Florida. University Press of Florida, Gainesville. Miller, George L. 1980 A Revised Set of CC Index Values for Classification and Economic Scaling of English Ceramics from 1787 to 1880. Historical Archaeology 25:1:1-26. Noel-Hume, Iver 1969 A Guide to Artifacts of Colonial America. Knopf, New York. Northen, William J. 1912 Men of Mark in Georgia. AB Caldwell, New York. Paradisecoast.com NA A Quick History of Naples and the Paradise Coast. https://www.paradisecoast.com/article/quick-history-naples-the-paradise-coast Accessed November 2020 3.A.1.c Packet Pg. 61 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar References Cited Responsive ■ Resourceful ■ Reliable 8-13 Price, Cynthia R. 1979 19th Century Ceramics in the Eastern Ozark Border Region. Monograph Series, Number 1, Center for Archaeological Research, Southwest Missouri State University, Springfield. Phillips, John 1992a Bernath Place (8SR986): A Santa Rosa-Swift Creek Site on Mulatto Bayou in Northwest Florida. Paper presented at the 49th annual Southeastern Archeological Conference. Little Rock, Arkansas. 1992b Archeological Resource Preservation Plan, Fort Walton Beach, Florida. Pickard, Ben ed. 1991 Historic Gainesville: A Tour to the Past. Historic Gainesville, Inc., Gainesville, Florida. Publication and Archival Library and Museum Materials (PALMM) 2020 Florida Aerial Photography Alachua County Accessed. April 2020. https://ufdc.ufl.edu/aerials Sears, William H. 1973 The Sacred and the Secular in Prehistoric Ceramics. In Variation in Anthropology: Essays in Honor of John McGregor, edited by D. Lathrap, pp. 31-42. Illinois Archeological Survey, Urbana. Scarry, John 1980 The Chronology of Fort Walton Developments in the Upper Apalachicola Valley Florida. Southern Archaeological Conference Bulletin 22:38-45. Smith, Bruce D. 1986 The Archaeology of the Eastern United States: From Dalton to de Soto, 10,500- 500 BP. Advances in World Archaeology 5:1-93. Smith, Greg C. 2012 Cultural Resources Survey: American Prime II LLC Property, The Estates at Port Labelle LLC Property. New South Associates. Submitted to LG2 Environmental Solutions, Inc. Report on file LG2 Environmental Solution, Inc., Jacksonville, Florida. South, Stanley A. 1977 Method and Theory in Historical Archeology. Academic Press, New York. Tebeau, Charles 1980 A History of Florida. Seventh printing. University of Miami Press, Miami. 1982 Methods of Provenance Determination of Florida Cherts. Manuscript on file, DHR, Tallahassee 3.A.1.c Packet Pg. 62 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar References Cited Responsive ■ Resourceful ■ Reliable 8-14 Tesar, Louis O. 1980 Leon County Bicentennial Survey Project: an Archaeological Survey of Selected Portions of Leon County, Florida. Florida Department of State, Division of Archives, History and Records Management, Bureau for Historic Sites and Properties, Miscellaneous Project Report Series 49. Thomas, Prentice M., Jr. and L. Janice Campbell 1985a The Deptford to Santa Rosa/Swift Creek Transition in the Florida Panhandle. The Florida Anthropologist 38 (2): 110-119. 1985b Cultural Resources Investigation at Tyndal Air Force Base, Bay County, Florida. New World Research, Inc. Report of Investigation No. 84-4; Fort Walton Beach 1993 Eglin Air Force Base Historic Preservation Plan: Technical Synthesis of Cultural Resource Investigations at Eglin; Santa Rosa; Okaloosa; and Walton Counties, Florida. 2 vols. New World Research, Inc., Report of Investigations 192. United States Department of Agriculture 1978 Soil Survey of Alachua County, Florida. Soil Conservation, Washington, D.C. United States Fish and Wildlife Department 2007 Loxahatchee National Wildlife Refuge Electronic File: http://www.fws.gov/loxahatchee/ United States Works Project Administration 1940 Spanish Land Grants in Florida. Volume III, Tallahassee. Watts, William A. and Barbara C. S. Hansen 1988 Environments in Florida in the Late Wisconsin and Holocene. In Wet Site Archaeology, edited by Barbara Purdy, pp, 307-323. Telford Press, Caldwell NJ. Weaver, Guy G., Jeffrey T. Holland, Patrick H. Garrow, and Martin B. Reinbold 1993 The Gowen Farmstead: Archaeological Data Recovery at Site 40 DV401 (Area D), Davidson County, Tennessee. Garrow and Associates, Inc., Memphis. Weaver, Paul L. 2009 The King’s and Pablo Roads Florida’s First Highways: A Narrative History of Their Construction and Routes in St. John’s County. St. Johns County Growth Management Services. Webb, S. D., J. T. Milanich, R. Alexon, and J. S. Dunbar 1984 A Bison Antiquus Kill Site, Wacissa River, Jefferson County, Florida. American Antiquity 49: 384-392. Weisman, Brent R. 1989 Like Beads on a String. University of Alabama Press, Tuscaloosa. 3.A.1.c Packet Pg. 63 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Immokalee Solar References Cited Responsive ■ Resourceful ■ Reliable 8-15 1991 Archaeology of the Fig Springs Mission, Ichetucknee Springs State Park. Florida Anthropologist 44 (2-4): 187-203). Wiley, Gordon R. 1949 Excavations in Southeast Florida. Yale University Publications in Anthropology No. 42, New Haven. Williams, John Lee 1962 The Territory of Florida, Sketches of Topography, Civil and Natural History of the Country, the Climate, and Indian Tribes. Facsimile Reproduction of the 1837 Edition, University Press of Florida, Gainesville. Works Project Administration (WPA) 1940 Spanish Land Grants in Florida, Volume II, Confirmed Claims: A-C. State Library Board, Tallahassee. Worth, John E. 1992 The Timucuan Missions of Spanish Florida and the Rebellion of 1656. Ph.D. diss., University of Florida. 1998 Timucuan Chiefdoms of Spanish Florida, Volume 2: Resistance and Destruction. University Press of Florida, Gainesville. 2012 An Overview of the Suwannee Valley Culture. In Late Prehistoric Florida: Archaeology at the edge of the Mississippi World. Edited by K. Ashley and N.M. White, pp. 149-171. University Press of Florida, Gainesville. Wright, Jr. J. Leitch 1975 Florida in the American Revolution. University Presses of Florida. 3.A.1.c Packet Pg. 64 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee APPENDIX A: Survey Log Sheet 3.A.1.c Packet Pg. 65 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Florida Master Site File / Div. of Historical Resources / R.A. Gray Bldg / 500 S Bronough St., Tallahassee, Florida 32399-0250 HR6E066R0319, effective 05/2016 Rule 1A-46.001, F.A.C. Phone 850.245.6440, Fax 850.245.6439, Email: SiteFile@dos.myflorida.com Page 1 Ent D (FMSF only) __________ Survey Log Sheet Survey # (FMSF only) ___________ Florida Master Site File Version 5.0 3/19 Consult Guide to the Survey Log Sheet for detailed instructions. Manuscript Information Survey Project (name and project phase) Report Title (exactly as on title page) Report Authors (as on title page) 1._______________________________ 3. _____________________________ 2._______________________________ 4. _____________________________ Publication Year __________ Number of Pages in Report (do not include site forms) ___________ Publication Information (Give series, number in series, publisher and city. For article or chapter, cite page numbers. Use the style of American Antiquity.) Supervisors of Fieldwork (even if same as author) Names _____________________________________________________ Affiliation of Fieldworkers: Organization _____________________________________ City ______________________ Key Words/Phrases (Don’t use county name, or common words like archaeology, structure, survey, architecture, etc.) 1.___________________ 3.___________________ 5. ___________________ 7.____________________ 2.___________________ 4.___________________ 6. ___________________ 8.____________________ Survey Sponsors (corporation, government unit, organization, or person funding fieldwork) Name. ____________________________________ Organization. ______________________________________ Address/Phone/E-mail. __________________________________________________________________________ Recorder of Log Sheet _________________________________________ Date Log Sheet Completed ___________ Is this survey or project a continuation of a previous project? q No q Yes: Previous survey #s (FMSF only) _______________ Project Area Mapping Counties (select every county in which field survey was done; attach additional sheet if necessary) 1.___________________________ 3. ____________________________ 5. ___________________________ 2.___________________________ 4. ____________________________ 6. ___________________________ USGS 1:24,000 Map Names/Year of Latest Revision (attach additional sheet if necessary) 1.Name ____________________________ Year_____4.Name _____________________________ Year_____ 2.Name ____________________________ Year_____5.Name _____________________________ Year_____ 3.Name ____________________________ Year_____6.Name _____________________________ Year_____ Field Dates and Project Area Description Fieldwork Dates: Start __________ End __________ Total Area Surveyed (fill in one) ________hectares ________acres Number of Distinct Tracts or Areas Surveyed _________ If Corridor (fill in one for each) Width: _______meters _______feet Length: _______kilometers _______miles 3.A.1.c Packet Pg. 66 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee Florida Master Site File / Div. of Historical Resources / R.A. Gray Bldg / 500 S Bronough St., Tallahassee, Florida 32399-0250 HR6E066R0718, effective 05/2016 Rule 1A-46.001, F.A.C. Phone 850.245.6440, Fax 850.245.6439, Email: SiteFile@dos.myflorida.com Page 2 Survey Log Sheet Survey #__________ Research and Field Methods Types of Survey (select all that apply): archaeological architectural historical/archival underwater damage assessment monitoring report other(describe):. _________________________ Scope/Intensity/Procedures Preliminary Methods (select as many as apply to the project as a whole) q Florida Archives (Gray Building)q library research- local public q local property or tax records q other historic maps q Florida Photo Archives (Gray Building) q library-special collection q newspaper files q soils maps or dataq Site File property search q Public Lands Survey (maps at DEP) q literature search q windshield surveyq Site File survey search q local informant(s)q Sanborn Insurance maps q aerial photography q other (describe):. ______________________________________________________________________________ Archaeological Methods (select as many as apply to the project as a whole) q Check here if NO archaeological methods were used.q surface collection, controlled q shovel test-other screen sizeq surface collection, uncontrolled q water screenq shovel test-1/4”screen q posthole testsq shovel test-1/8” screen q auger testsq shovel test 1/16”screen q coringq shovel test-unscreened q test excavation (at least 1x2 m) q block excavation (at least 2x2 m) q soil resistivityq magnetometerq side scan sonarq ground penetrating radar (GPR)q LIDAR q other (describe):. _______________________________________________________________________________ Historical/Architectural Methods (select as many as apply to the project as a whole) q Check here if NO historical/architectural methods were used.q building permits q demolition permits q neighbor interview q subdivision mapsq commercial permits q occupant interview q tax recordsq interior documentation q windshield surveyq local property records q occupation permits q unknown q other (describe):. _______________________________________________________________________________ Survey Results Resource Significance Evaluated? q Yes q No Count of Previously Recorded Resources____________ Count of Newly Recorded Resources____________ List Previously Recorded Site ID#s with Site File Forms Completed (attach additional pages if necessary) List Newly Recorded Site ID#s (attach additional pages if necessary) Site Forms Used: q Site File Paper Forms q Site File PDF Forms REQUIRED: Attach Map of Survey or Project Area Boundary SHPO USE ONLY SHPO USE ONLY SHPO USE ONLY Origin of Report: 872 Public Lands UW 1A32 # Academic Contract Avocational Grant Project # Compliance Review: CRAT # Type of Document: Archaeological Survey Historical/Architectural Survey Marine Survey Cell Tower CRAS Monitoring Report Overview Excavation Report Multi-Site Excavation Report Structure Detailed Report Library, Hist. or Archival Doc MPS MRA TG Other: Document Destination: ______________________________ Plotability: ___________________________________________ LIDAR other remote sensing pedestrian survey unknown metal detector other remote sensing Desktop Analysis 3.A.1.c Packet Pg. 67 Attachment: Attachment B - Cultural Resource Assessment Survey of the Immokalee Solar Energy Tract (15591 : PL20200001865 Immokalee From: Margaret Emblidge <margaret.emblidge@hendryfla.net> Sent: Tuesday, December 15, 2020 12:02 PM To: FinnTimothy; Myra Johnson Subject: RE: Courtesy Review - Immokalee Solar, Conditional Use (CU): PL20200001865 EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Mr. Finn, thank you for this information. We are very familiar with the FPL Solar facilities as we have a few in Hendry County. I have reviewed the application information and do not have any questions or comments. Margaret Emblidge, AICP Planning and Community Development Director Hendry County Ofc. 863.612.4752 Cell 863-204-4308 Physical Address: 640 So. Main St. LaBelle, FL 33935 Mailing Address: P.O. Box 2340 LaBelle, FL 33975 From: FinnTimothy Sent: Tuesday, December 15, 2020 11:34 AM To: Margaret Emblidge ; Myra Johnson Subject: Courtesy Review - Immokalee Solar, Conditional Use (CU): PL20200001865 Dear Ms. Emblidge: Collier County has received a petition seeking approval of a conditional use for a proposed solar power plant. Staff has attached documents to this email for a courtesy review. Let me know if there is anything else you may need to complete your review. Please feel free to provide any comments that you wish and have back to me by December 31. Thank you Timothy Finn, AICP Principal Planner Zoning Division 3.A.1.d Packet Pg. 68 Attachment: Attachment C - Hendry and Lee County Reviews (15591 : PL20200001865 Immokalee Solar CU) NOTE: New Email Address as of 12/09/2017: Timothy.Finn@colliercountyfl.gov 2800 North Horseshoe Drive, Naples Florida 34104 Phone: 239.252.4312 Tell us how we are doing by taking our Zoning Division Survey at http://bit.ly/CollierZoning. Under Florida Law, e-mail addresses are public records. If you do not want your e-mail address released in response to a public records request, do not send electronic mail to this entity. Instead, contact this office by telephone or in writing. CAUTION: This email originated from outside of Hendry County BOCC. If this email is unusual or unexpected, do not click any links or open any attachments until you contact the sender (not by email) and confirm the content is safe. 3.A.1.d Packet Pg. 69 Attachment: Attachment C - Hendry and Lee County Reviews (15591 : PL20200001865 Immokalee Solar CU) From: Dunn, Brandon <BDunn@leegov.com> Sent: Monday, April 5, 2021 10:29 AM To: FinnTimothy Cc: Jenkins-Owen, Sharon; Loveland, David Subject: RE: Review Reminder - FW: Courtesy Review - Immokalee Solar, Conditional Use (CU): PL20200001865 EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Mr. Finn, We have reviewed the proposed conditional use for a solar plant near the intersection of SR82 and SR 29. We have no comments concerning the proposed application. Please let me know if you have any questions. Brandon D. Dunn, Principal Planner Lee County Department of Community Development Planning Section bdunn@leegov.com 239.533.8585 From: FinnTimothy <Timothy.Finn@colliercountyfl.gov> Sent: Monday, April 5, 2021 8:53 AM To: Loveland, David <DLoveland@leegov.com> Cc: Dunn, Brandon <BDunn@leegov.com>; Jenkins-Owen, Sharon <SJenkins-Owen@leegov.com> Subject: [EXTERNAL] Review Reminder - FW: Courtesy Review - Immokalee Solar, Conditional Use (CU): PL20200001865 EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Hi all, Just a friendly reminder to have any comments back at your earliest. Thank you From: FinnTimothy Sent: Monday, March 29, 2021 9:21 AM To: 'DLoveland@leegov.com' <DLoveland@leegov.com> Cc: Dunn, Brandon <BDunn@leegov.com>; 'Jenkins-Owen, Sharon' <SJenkins-Owen@leegov.com> Subject: Courtesy Review - Immokalee Solar, Conditional Use (CU): PL20200001865 3.A.1.d Packet Pg. 70 Attachment: Attachment C - Hendry and Lee County Reviews (15591 : PL20200001865 Immokalee Solar CU) Dear Mr. Loveland: Collier County has received a petition seeking approval of a conditional use for a proposed solar power plant. Staff has attached documents to this email for a courtesy review. Let me know if there is anything else you may need to complete your review. Please feel free to provide any comments that you wish and have back to me by March 31. Thank you Timothy Finn, AICP Principal Planner Zoning Division NOTE: New Email Address as of 12/09/2017: Timothy.Finn@colliercountyfl.gov 2800 North Horseshoe Drive, Naples Florida 34104 Phone: 239.252.4312 Tell us how we are doing by taking our Zoning Division Survey at http://bit.ly/CollierZoning. Under Florida Law, e-mail addresses are public records. If you do not want your e-mail address released in response to a public records request, do not send electronic mail to this entity. Instead, contact this office by telephone or in writing. Receive updates from Lee County Government by subscribing to our newsletter Please note: Florida has a very broad public records law. Most written communications to or from County Employees and officials regarding County business are public records available to the public and media upon request. Your email communication may be subject to public disclosure. Under Florida law, email addresses are public records. If you do not want your email address released in response to a public records request, do not send electronic mail to this entity. Instead, contact this office by phone or in writing. 3.A.1.d Packet Pg. 71 Attachment: Attachment C - Hendry and Lee County Reviews (15591 : PL20200001865 Immokalee Solar CU) CCPC PACKAGE IMMOKALEE SOLAR CONDITIONAL USE CU-PL2020-1865 3.A.1.e Packet Pg. 72 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) APPLICATION FORM 3.A.1.e Packet Pg. 73 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 1 of 12 APPLICATION FOR PUBLIC HEARING FOR: CONDITIONAL USE LDC Section 10.08.00 & Code of Laws section 2-83 – 2-90 Chapter 3 C.1 of the Administrative Code PETITION NO (PL) PROJECT NAME DATE PROCESSED A CONDITIONAL USE TO BE HEARD BY THE PLANNING COMMISSION AND BOARD OF ZONING APPEALS A MINOR CONDITIONAL USE TO BE HEARD BY THE OFFICE OF THE HEARING EXAMINER APPLICANT CONTACT INFORMATION Name of Property Owner(s): ______________________________________________________ Name of Applicant if different than owner: __________________________________________ Address: ____________________________City: _____________ State: ________ ZIP: _______ Telephone: ____________________ Cell: ____________________ Fax: ___________________ E-Mail Address: ________________________________________________________________ Name of Agent(s): _____________________________________________________________ Firm: _________________________________________________________________________ Address: ____________________________City: _____________ State: ________ ZIP: _______ Telephone: ____________________ Cell: _____________________ Fax: __________________ E-Mail Address: ________________________________________________________________ BE AWARE THAT COLLIER COUNTY HAS LOBBYIST REGULATIONS. GUIDE YOURSELF ACCORDINGLY AND ENSURE THAT YOU ARE IN COMPLIANCE WITH THESE REGULATIONS. To be completed by staff 3.A.1.e Packet Pg. 74 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 2 of 12 ASSOCIATIONS Required: List all registered Home Owner Association(s) that could be affected by this petition. Provide additional sheets if necessary. Information can be found on the Board of County Commissioner’s website at http://www.colliergov.net/Index.aspx?page=774. Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ PROPERTY INFORMATION On separate page, provide a detailed legal description of the property covered by the application: • If the request involves changes to more than one zoning district, the applicant shall include separate legal description for property involved in each district; • The applicant shall submit 4 copies of a recent survey (completed within the last six months, maximum 1" to 400' scale), if required to do so at the pre-application meeting; and • The applicant is responsible for supplying the correct legal description. If questions arise concerning the legal description, an engineer's certification or sealed survey may be required. Property I.D. Number: ____________________________ Plat Book: _______ Page #: _______ Section/Township/Range: _______ /_______ /_______ Subdivision: __________________________________________Lot: ________ Block: ________ Metes & Bounds Description: _____________________________________________________ Size of Property: _____ft. X ______ ft. = _______ Total Sq. Ft. Acres: _____________ Address/ General Location of Subject Property: ______________________________________________________________________________ ______________________________________________________________________________ 3.A.1.e Packet Pg. 75 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 3 of 12 ADJACENT ZONING AND LAND USE Zoning Land Use N S E W If the owner of the subject property owns contiguous property please provide a detailed legal description of the entire contiguous property: (If space is inadequate, attach on a separate page) Section/Township/Range: / / Lot: Block: Subdivision: __________________________________________ Plat Book: Page #: Property I.D. Number: ____________________________ Metes & Bounds Description: ________________________________________________ CONDITIONAL USE REQUEST DETAIL Type of Conditional Use: This application is requesting a conditional use as allowed, pursuant to LDC section 2.03.00, of the _______________________ zoning district for _______________________ (type of use). Present Use of the Property: __________________________________________ 3.A.1.e Packet Pg. 76 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 4 of 12 EVALUATION CRITERIA Pursuant to LDC section 10.08.00 and Chapter 3 C.1 of the Administrative Code, staff’s recommendation to the reviewing body shall be based upon a finding that the granting of the conditional use will not adversely affect the public interest and that the specific requirements governing the individual conditional use, if any, have been met. Further, satisfactory provision and arrangement have been made concerning the following matters, where applicable. On a separate page, provide a narrative statement describing a request for a conditional use and a detailed response to the criteria listed below. Specify how and why the request is consistent with each of the criteria. a. Describe how the project is consistent with the Collier County Land Development Code and Growth Management Plan. Include information on how the request is consistent with the applicable section or portions of the Future Land Use Element. b. Describe the existing or planned means of ingress and egress to the property and proposed structure thereon with particular reference to automotive and pedestrian safety and convenience, traffic flow and control, and access in case of fire or catastrophe. c. Describe the effect the conditional use will have on neighboring properties in relation to noise, glare, economic impact, and odor. d. Describe the site’s and the proposed use’s compatibility with adjacent properties and o ther properties in the district. e. Please provide any additional information which you may feel is relevant to this request. Deed Restrictions: The County is legally precluded from enforcing deed restrictions; however, many communities have adopted such restrictions. You may wish to contact the civic or property owners association in the area for which this use is being requested in order to ascertain whether or not the request is affected by existing deed restrictions. Previous land use petitions on the subject property: To your knowledge, has a public hearing been held on this property within the last year? If so, what was the nature of that hearing? _____________________________________________________________________________________ _____________________________________________________________________________________ Official Interpretations or Zoning Verifications: To your knowledge, has there been an official interpretation or zoning verification rendered on this property within the last year? No Yes (If yes please provide copies.) 3.A.1.e Packet Pg. 77 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 5 of 12 STATEMENT OF UTILITY PROVISIONS FOR CONDITIONAL USE REQUEST APPLICANT INFORMATION Name of Applicant(s): ___________________________________________________________ Address: ______________________________City: ___________ State: ________ ZIP: _______ Telephone: ____________________ Cell: _____________________ Fax: __________________ E-Mail Address: ________________________________________________________________ Address of Subject Property (If available): ___________________________________________ City: ________________ State: __________ ZIP: ___________ LEGAL DESCRIPTION Section/Township/Range: / / Lot: Block: Subdivision: _______________________________________________ Plat Book: Page #: Property I.D. Number: _________________________________ Metes & Bounds Description: _____________________________________________________ TYPE OF SEWAGE DISPOSAL TO BE PROVIDED Check applicable system: a. County Utility System b. City Utility System c. Franchised Utility System Provide Name: ____________________ d. Package Treatment Plant (GPD Capacity): ___________________ e. Septic System TYPE OF WATER SERVICE TO BE PROVIDED a. County Utility System b. City Utility System c. Franchised Utility System PROVIDE NAME_______________ d. Private System (Well) Total Population to be served: ____________________________________________________ Peak and Average Daily Demands: A. Water-Peak: _______ Average Daily: ________ B. Sewer-Peak: _______ Average Daily: ________ 3.A.1.e Packet Pg. 78 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 6 of 12 If proposing to be connected to Collier County Regional Water System, please provide the date service is expected to be required: ____________________________________________ Narrative statement: Provide a brief and concise narrative statement and schematic drawing of sewage treatment process to be used as well as a specific statement regarding the method of affluent and sludge disposal. If percolation ponds are to be used, then percolation data and soil involved shall be provided from tests prepared and certified by a professional engineer. ______________________________________________________________________________ ______________________________________________________________________________ ______________________________________________________________________________ ______________________________________________________________________________ County Utility Dedication Statement: If the project is located within the service boundaries of Collier County’s utility service system, a notarized statement shall be provided agreeing to dedicate the water distribution and sewage collection facilities within the project area to the Collier County Utilities. This shall occur upon completion of the construction of these facilities in accordance with all applicable County ordinances in effect at that time. This statement shall also include an agreement that the applicable system development charges and connection fees will be paid to the County Utilities Division prior to the issuance of building permits by the County. If applicable, the statement shall contain an agreement to dedicate the appropriate utility easements for serving the water and sewer systems. ______________________________________________________________________________ ______________________________________________________________________________ ______________________________________________________________________________ ______________________________________________________________________________ Statement of Availability Capacity from other Providers: Unless waived or otherwise provided for at the pre-application meeting, if the project is to receive sewer or potable water services from any provider other than the County, a statement from that provider indicating adequate capacity to serve the project shall be provided. 3.A.1.e Packet Pg. 79 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 7 of 12 RECORDING OF DEVELOPER COMMITMENTS Within 30 days of adoption of the Ordinance, the owner or developer at their expense shall record in the Public Records of Collier County a Memorandum of Understanding of Developer Commitments or Notice of Developer Commitments that contains the legal description of the property that is the subject of the land use petition and contains each and every commitment of the owner or developer specified in the Ordinance. The Memorandum or Notice shall be in form acceptable to the County and shall comply with the recording requirements of F.S. §695. A recorded copy of the Memorandum or Notice shall be provided to the assigned Principal Planner, Zoning Services Department, within 15 days of recording of said Memorandum or Notice. Chapter 8 of the Administrative Code requires that the applicant must remove their public hearing advertising sign(s) after final action is taken by the Board of County Commissioners. Based on the Board's final action on this item, please remove all public hearing advertising sign(s) immediately. 3.A.1.e Packet Pg. 80 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 8 of 12 Pre-Application Meeting and Final Submittal Requirement Checklist for: A Conditional Use to be heard by the Planning Commission and Board of Zoning Appeals A Minor Conditional Use to be heard by the Office of the Hearing Examiner Chapter 3 C.1. of the Administrative Code The following Submittal Requirement Checklist is to be utilized during the Pre-Application Meeting, and at time of application submittal. At time of submittal, the checklist is to be completed and submitted with the application packet. Please provide the submittal items in the exact order listed below, with cover sheets attached to each section. Incomplete submittals will not be accepted. Requirements for Review # Of Copies Required Not Required Completed Application (download current form from County website) 1 Cover letter briefly explaining the project 1 Pre-Application Notes 1 Affidavit of Authorization, signed and notarized 1 Completed Addressing Checklist 1 Property Ownership Disclosure Form 1 Warranty Deed(s) 1 Boundary Survey 1 Conceptual Site Plan 24” X 36” plus (one 8 ½ X 11 copy) Plans showing proposed location for utilities, if required Plans for screening and buffering the use with reference as to type, dimensions, and character, if required Plans showing the proposed landscaping and provisions for trees protected by County regulations, if required Plans showing the proposed signs and lighting, including type, dimensions, and character, if required Architectural Rendering of Proposed Structure(s), if applicable 1 Current aerial photographs (available from Property Appraiser) with project boundary and, if vegetated, FLUCFCS Codes with legend included on aerial. 1 Statement of utility provisions (with all required attachments & sketches) 1 Environmental Data Requirements, pursuant to LDC section 3.08.00 1 Environmental Data Requirements collated into a single Environmental Impact Statement (EIS) at time of public hearings. Coordinate with project planner at time of public hearing. Listed Species Survey; less than 12 months old. Include copies of previous surveys. 1 Traffic Impact Study (TIS) or waiver 1 Historical and Archeological Survey, or waiver 1 Electronic copy of all documents and plans * Please advise: The Office of the Hearing Examiner requires all materials to be submitted electronically in PDF format. 1 * If located in the Bayshore/Gateway Triangle Redevelopment Area, include an additional set of each submittal requirement 3.A.1.e Packet Pg. 81 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 9 of 12 ADDITIONAL REQUIREMENTS FOR THE PUBLIC HEARING PROCESS: •Following the completion of the review process by County review staff, the applicant shall submit all materials electronically to the designated project manager. •Please contact the project manager to confirm the number of additional copies required. Planners: Indicate if the petition needs to be routed to the following additional reviewers: Bayshore/Gateway Triangle Redevelopment: Executive Director Emergency Management: Dan Summers; and/or EMS: Artie Bay Conservancy of SWFL: Nichole Johnson GMD Graphics City of Naples: Robin Singer, Planning Director Utilities Engineering: Eric Fey Parks and Recreation: Barry Williams Immokalee Water/Sewer District: Other: School District (Residential Components): Amy Lockheart Communication Towers: Mosquito Control Collier County Airport Authority Naples Airport Authority Commercial Mining: Impact Fees 3.A.1.e Packet Pg. 82 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 83 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 11 of 12 Public Participation Requirements LDC Section 10.03.06 B. or C. Chapter 8 of the Administrative Code Notice for Minor Conditional Use Petitions Neighborhood Information Meeting (NIM) Requirements: Applicant must conduct a NIM at least 15 days prior to the Hearing Examiner’s receipt of the staff report and application materials in accordance with the applicable sections of the Administrative Code. The NIM shall be advertised and a mailed written notice shall be given to the property owners in the notification area at least 15 days prior to the NIM meeting. Mailed Notice: Written notice shall be sent to property owners in the notification area at least 15 days before the advertised Hearing Examiner hearing. Newspaper Advertisements: The legal advertisement shall be published at least 15 days before the advertised Hearing Examiner hearing in a newspaper of general circulation. The advertisement shall include at a minimum: •Date, time, and location of the hearing; •Description of the proposed land uses; and •2 in. x 3 in. map of the project location. Sign: A sign shall be posted at least 15 days before the advertised Hearing Examiner hearing date. Public Hearing for Minor Conditional Use Petitions Hearing Examiner: The Hearing Examiner shall hold at least 1 advertised public hearing. See Chapter 9 of the Administrative Code for the Office of the Hearing Examiner procedures. Notice for Conditional Use Petitions Neighborhood Information Meeting (NIM) Requirements: Applicant must conduct a NIM at least 15 days prior to the advertised public hearing. The NIM shall be advertised and a mailed written notice shall be given to the property owners in the notification area at least 15 days prior to the NIM meeting. 3.A.1.e Packet Pg. 84 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 12 of 12 Mailed Notice: Written notice shall be sent to property owners in the notification area at least 15 days before the advertised public hearing. Newspaper Advertisements: The legal advertisement shall be published at least 15 days before the advertised public hearing in a newspaper of general circulation. The advertisement shall include at a minimum: • Date, time, and location of the hearing; • Description of the proposed land uses; and • 2 in. x 3 in. map of the project location. Sign: A sign shall be posted at least 15 days before the advertised public hearing date. Public Hearing for Conditional Use Petitions Environmental Advisory Committee (EAC): The EAC shall hold at least 1 advertised public hearing, if required. Collier County Planning Commission (CCPC): The CCPC shall hold at least 1 public hearing. Board of Zoning Appeals (BZA): The BZA shall hold at least 1 advertised public hearing. 3.A.1.e Packet Pg. 85 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) COVER LETTER/ REQUEST NARRATIVE 3.A.1.e Packet Pg. 86 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) IMMOKALEE SOLAR CONDITIONAL USE I.Request Florida Power and Light, Inc. (Applicant) is requesting approval of a Conditional Use to allow a solar power plant on 578+/- acres of land (Property) located directly to the east of the SR 29 and SR 82 intersection in unincorporated Collier County, Florida. The Property is zoned Agricultural-Mobile Home Overlay Rural Lands Stewardship Area Overlay (A-MHO RLSAO) and is designated as Agriculture/Rural Mixed Use District Rural Lands Stewardship Overlay Area (RLSA) on the Future Land Use Map. As determined by Staff at the pre-application meeting held on September 29, 2020, pursuant to LDC Section 2.01.03.G, Essential Services, the requested use is considered an “Electric or Gas Generating Plant”. This essential service is permitted in the RLSA, excluding Habitat Stewardship Areas (HSAs) and Flowway Stewardship Areas (FSAs) as a Conditional Use. The Property is not located within an HSA or FSA. II.Property Information The Property is 578+/- acres in size and the existing land use is agricultural/citrus crops. Historically, the property has been utilized for agricultural purposes. The unique project boundary ensures the existing Above Ground Impoundment (AGI) system surrounding the property remains intact and continues to manage stormwater on the site as it has done so previously for the agricultural uses. Historical aerials are included in this application and in the environmental report prepared for this project and demonstrate the AGI that has been in place to support the agricultural development over the years. As shown on the Conditional Use site plan, the project does not propose to impact these areas and will continue to maintain the existing wetland flowway functions through the project as required for wetlands within the RLSA Open lands. III.About FPL & Solar Power The solar power plant will provide Collier County with a unique project that benefits the public by providing solar power to the overall power grid, which in time reduces the cost of power for all customers without generating toxic emissions. There are numerous benefits associated with each FPL solar project that include creating employment opportunities during construction, procurement of local resources when possible, economic boost to local businesses during construction, zero-emissions electricity generation, increased awareness of sustainable energy sources, and increased tax revenues for the county. FPL’s new solar plants generate zero emissions energy, using only the sun for fuel. When the sun is shining, the panels absorb the sunlight and convert it into direct current energy. The energy then flows through an inverter where it is transformed into alternating current electricity, the kind that is used in a residential home. The energy travels through FPL’s energy grid, where it is delivered to homes and businesses. The Applicant currently operates 28 solar power plants, two (2) that feature innovative energy storage, and hundreds of smaller solar installations. FPL’s solar power plants are the fastest and 3.A.1.e Packet Pg. 87 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 2 of 6 Immokalee Solar CU – PL20200001865 most cost-effective way to bring solar energy to more Floridians. Already one of the cleanest energy companies in the nation, FPL recently announced a groundbreaking ’30-by-30’ plan to install 30 million solar panels by 2030, making Florida a world leader in solar energy. This year, solar will outpace coal and oil combined as a percentage of FPL’s energy mix. In other words, soon FPL will be generating more energy from the sun than from power plants fueled by coal and oil. As Florida’s largest generator of solar power, FPL currently has approximately 2,000 megawatts of universal solar capacity, with more than 8 million solar panels installed, including the following sites across Florida: • FPL Babcock Ranch Solar Energy and Battery Storage Center, Charlotte County • FPL Barefoot Bay Solar Energy Center, Brevard County • FPL Blue Cypress Solar Energy Center, Indian River County • FPL Citrus Solar Energy and Battery Storage Center, DeSoto County • FPL Coral Farms Solar Energy Center, Putnam County • FPL DeSoto Next Generation Solar Energy Center, DeSoto County • FPL Loggerhead Solar Energy Center, St. Lucie County • FPL Hammock Solar Energy Center, Hendry County • FPL Horizon Solar Energy Center, Alachua and Putnam counties • FPL Indian River Solar Energy Center, Indian River County • FPL Interstate Solar Energy Center, St. Lucie County • FPL Manatee Solar Energy Center, Manatee County • FPL Martin Next Generation Clean Energy Center (hybrid solar/natural gas), Martin County • FPL Miami-Dade Solar Energy Center, Miami-Dade County • FPL Pioneer Trail Solar Energy Center, Volusia County • FPL Space Coast Next Generation Solar Energy Center, Brevard County • FPL Sunshine Gateway Solar Energy Center, Columbia County • FPL Wildflower Solar Energy Center, DeSoto County • FPL Solar Circuit at Daytona International Speedway, Volusia County • Solar research installation at Florida International University, Miami-Dade County FPL’s 10 newest solar plants entered service in 2020 and are projected to generate millions in total system savings for customers during their operating lifetime. In terms of compatibility, solar energy centers are virtually silent, operate autonomously and require no water for operation or maintenance. The panels sit low to the ground, and the layout of the site is uniquely designed to avoid impacts to wetlands and preserve areas. A typical solar site is between 96 – 97 percent pervious, which allows most of the site to remain as open space, as the panels are raised approximately two (2) feet off the ground. A solar center does not require staff to operate, so it will not bring more traffic to the area after construction. The duration of construction activities for a site of this size is approximately six to eight months, and as previously mentioned, will create about 200 jobs. The enclosed Traffic Impact Letter outlines how at build- out the maximum of four (4) trips to the site per month will create a de minimis impact to the surrounding transportation and roadway network, as the only trips to the site are for routine maintenance activities. IV. Conditional Use Criteria The following is a detailed analysis of this request’s compliance with the variance review criteria set forth in LDC Section 10.08.00: 3.A.1.e Packet Pg. 88 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3 of 6 Immokalee Solar CU – PL20200001865 a. Describe how the project is consistent with the Collier County Land Development Code and Growth Management Plan. Include information on how the request is consistent with the applicable section or portions of the Future Land Use Element. The proposed electric or gas generating plant (essential service) is a permitted conditional use within the Agricultural-Mobile Home Overlay Rural Lands Stewardship Area Overlay (A-MHO RLSAO) zoning district. The use is allowable per LDC Section 2.01.03.G.1.a. The property is within the Rural Land Stewardship Area Overlay (RLSA), which states in its Goal as outlined in the Future Land Use Element (FLUE) of the Growth Management Plan (GMP) “To address the long-term needs of residents and property owners”. The proposed solar power plant addresses the need for power, which all residents in Immokalee and Collier County rely on. By providing a solar power plant to Collier County in this location, the project is addressing long-term needs of the residents both in Immokalee and in Collier County as a whole. RLSA Group 1 Policy 1.2 is intended for the Overlay to protect “natural resources and retains viable agriculture by promoting compact rural mixed-use development as an alternative to low- density single-use development…” The site design of the proposed solar power field carefully and purposefully avoids impacting surrounding wetlands and areas of preserve located within the unique project boundary. The proposed CU is also in direct compliance with Coastal Conservation Management Element (CCME) Policy 6.1.1, which requires the preservation of native vegetation. The overall development footprint of the site includes minimal impervious areas, which allows for birds, small animals, and other wildlife to traverse the site. The project will also be in compliance with CCME Policy 7.1.1, which requires incompatible land uses to be directed away from listed species and their habitats. As previously discussed, the CU site plan carefully takes into consideration the location of those preserve areas within the project boundary and those not within that surround the project. As shown on the conceptual site plan, the solar array development areas are surrounded by a maximum 8-foot tall wildlife protection fence, which, in direct compliance with LDC Section 4.08.05.J.3.a.ii., is designed to minimize development impacts and to encourage wildlife to use wildlife corridors. The field fencing is also “panther approved” and safe for panthers and other small animals to cross through and freely traverse the site. The project will also secure all required state and federal permits relating to environmental protection. In direct compliance with RLSA Policy 1.4 and Policy 1.5 of FLUE of the GMP, the proposed solar power plant will not increase density or intensity of the site. The project is an essential service and contains no buildings, office space or restrooms. The project will not require a connection to public utilities for potable water or sanitary sewer, and will create a de minimis impact on the surrounding transportation network. RLSA Group 4 Policy 4.1 of the FLUE requires Collier County to encourage and facilitate uses that enable economic prosperity and diversification of the economic base of the RLSA. The project will provide an economic boost to County and to the local Immokalee area for the duration of the construction period, which can last anywhere from six (6) to eight (8) months. After construction and once the solar field is in full operation, the project will continue to be an economic benefit to the County by ultimately lowering the utility bills of those FPL customers. RLSA Group 5 Policy 5.6 of the FLUE also requires any lands within the RLSA to retain an appropriate amount of native preservation. The project is in further direct compliance with sub 3.A.1.e Packet Pg. 89 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 4 of 6 Immokalee Solar CU – PL20200001865 Policy 5.6.1.ii. and LDC Section 4.08.05.M, which requires wetland flowway functions through the project to be maintained. The proposed solar site project contains a unique project boundary that was intentionally created to avoid impacting surrounding wetland and preserve areas. The existing surrounding wetlands, which are considered either isolated or seasonal wetlands based on their Open category within the RLSA, will continue to function as a means to drain water from the site. b. Describe the existing or planned means of ingress and egress to the property and proposed structure thereon with particular reference to automotive and pedestrian safety and convenience, traffic flow and control, and access in case of fire or catastrophe. As depicted on the Conceptual Site plan, the one (1) point of access to the site is located directly east of SR 29 on the southern boundary of the project, providing access to SR 29 a state- maintained arterial roadway. The entire western boundary of the project, comprising 11,675+/- linear feet (2.2+/- miles), is adjacent to the SR 29 roadway. Pursuant to meetings with Florida Department of Transportation (FDOT) Staff including the Project Manager of the SR 29 improvements on this segment of roadway, it was agreed the project does not impact the current design and is not required to provide sidewalks along this stretch of SR 29 based upon FDOT’s rural cross section. In addition to meeting with the FDOT SR 29 Project Manager, the Applicant has had numerous meetings regarding transportation, access, drainage, and the impact on surrounding roadways with both Collier County Transportation Operations Staff and other staff at FDOT. Collier County Staff determined the project could provide a Transportation Impact Letter that outlines the de minimis impacts associated with the proposed project. The Transportation Impact Letter enclosed, prepared by Jacobs Engineering, concludes that approximately four (4) trips per month will be made to the site, which results in a de minimis impact to the surrounding roadway network. On October 27, 2020, the Applicant also met with FDOT regarding drainage as it relates to the Site Development Plan (SDP) process. It was also determined by Collier County Transportation Operations Staff and FDOT that the location of the project, on a state roadway in a rural area of the county with no existing facilities, would not be required to provide sidewalks along the SR 29 frontage. In the rare case of fire or catastrophe, the site fencing can easily be driven directly through by a vehicle, or the internal accessway system that provides the vehicular mobility around the site, can be taken to the exit where SR 29 can be accessed. c. Describe the effect the conditional use will have on neighboring properties in relation to noise, glare, economic impact, and odor. As previously stated, the proposed solar power field is virtually silent in terms of noise and will therefore generate little to no impact from a noise standpoint on neighboring properties. In terms of glare, the Applicant will provide a Glint and Glare study at the time of Site Development Order approval, which outlines how the proposed solar panels create little glare due to the positioning of the panels and their significant setback from nearby roadways. The issue of glint and glare, as it pertains to photovoltaic systems, has been studied by the Federal Aviation Administration (FAA) and the US Air Force extensively. The Applicant takes precautionary design measures to ensure any glare from the placement of the solar panels does not cause travel hazards or impair the quality of life of the surrounding residences or buildings. The proposed 100- foot minimum setback of the solar panels from the SR 29 ROW will also assist in mitigating any visibility of glare by vehicles traveling north or south along SR 29. 3.A.1.e Packet Pg. 90 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 5 of 6 Immokalee Solar CU – PL20200001865 Beyond the environmental benefits the proposed solar field will generate, a new solar power plant can also be a facility of which construction will stimulate the local economy. The economic impact of the construction of the project will have a positive impact to the County and the local area. At the height of construction, the solar site is expected to employ approximately 200 construction workers for a period of six (6) to eight (8) months. Those workers in turn will provide a boost to the surrounding economy by dining and shopping at local conveniences while in the area. In the long-run, the project provides the County and all FPL customers the advantage of lower utility bills once the solar field is up and running and inputting power into the overall power grid. The proposed solar project will not produce any odor that would impact neighboring properties. A solar energy center supports a clean and green method of producing energy. Unlike ground-level ozone and other pollutants produced by cars, power plants, industrial boilers, refineries, and chemical plants, a solar energy plant eliminates the potential for harmful toxic emissions caused by fossil fuels. Solar provides healthy air for future generations. d. Describe the site’s and the proposed use’s compatibility with adjacent properties and other properties in the district. The site and proposed use are compatible with adjacent properties and other properties in the district. As outlined above, the proposed solar project will not create a compatibility issue in terms of noise, light, glare, or odor. Solar energy centers are virtually silent, operate autonomously and require no water for operation or maintenance. The panels sit low to the ground, and the layout of the site is uniquely designed to avoid impacts to wetlands and preserve areas. A solar center does not require staff to operate, so it will not bring more traffic to the area after construction. The surrounding area is comprised of mostly rural agricultural lands, with the nearest residential structure being approximately 440 feet from the closest solar panel development area. The proposed development standards comply with the underlying zoning district setbacks, and an enhanced 100-foot setback is proposed from the SR 29 frontage above and beyond what is required by the LDC. In addition to the proposed setbacks, the SR 29 frontage is comprised of an expansive area of existing vegetation, inclusive of preserve areas, ranging in width from 80+/- feet to more than 500 feet in some areas. This enhanced visual screening will assist in mitigating any visual impacts from the solar panels to the nearby roadway. In addition to the significant setback from SR 29, there is a noticeable elevation difference between the project boundary and the existing conditions on SR 29, where the site is much lower than the travel lanes of the roadway. Due to the difference in elevation, the solar panels are lower to the ground, and will be difficult to see from the roadway or from any surrounding properties. The project will not utilize fill dirt to raise the solar panels up as is typical on most residential or commercial projects. In terms of maintenance and cleaning of the solar panels, the project will rely on rainwater to wash off the panels from any naturally occurring dust, dirt, or debris. There will be no use of industrial- grade solvents, washes, or soaps of any kind. There are no solar sites in the state of Florida that utilize anything other than rainwater. Therefore, the development will not result in a negative impact to the surrounding properties from a drainage and runoff standpoint. 3.A.1.e Packet Pg. 91 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 6 of 6 Immokalee Solar CU – PL20200001865 e. Please provide any additional information which you may feel is relevant to this request. In addition to the data and analysis provided, the Applicant is requesting a waiver from the required Historical and Archaeological Survey and Assessment. As outlined in the pre-application meeting notes, the Applicant will seek this approval from the Historic and Archaeological Preservation Board (HAPB). The waiver form is enclosed. The Property has been historically impacted by agricultural uses including citrus crops. The project’s unique boundary maintains the surrounding wetland network and flow way, which also functions as stormwater management for the proposed solar field. The Applicant is filing a companion Variance petition seeking relief of the project’s required perimeter landscape buffers. The proposed site plan associated with the Conditional Use depicts No Buffer Required labels for this reason. Where applicable, the perimeter of the project will utilize existing native vegetation to serve as a buffer. It is understood that the request for no landscape buffers on the CU site plan is contingent upon approval of the companion Variance petition. V.Conclusion In conclusion, the Applicant’s request will allow a solar energy center, known in the LDC as an “electric or gas generating plant essential service”, as a Conditional Use on the 578+/- acre property. The request will not produce traffic or transportation related impacts, will not increase the density or intensity of the property, will be compatible with the surrounding properties and land uses, will provide an economic benefit to the county and surrounding area, and will comply with the underlying RLSA policies in both the GMP and the LDC. For these reasons, the Applicant respectfully requests approval of this Conditional Use. 3.A.1.e Packet Pg. 92 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) PRE-APPLICATION MEETING NOTES 3.A.1.e Packet Pg. 93 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 94 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 95 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 96 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 97 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 98 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 99 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 100 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 101 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 102 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 103 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 104 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 105 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 106 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 107 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 108 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 109 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 110 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 111 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 112 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 113 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 114 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 115 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) AFFIDAVITS 3.A.1.e Packet Pg. 116 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.ePacket Pg. 117Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.ePacket Pg. 118Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) ADDRESSING CHECKLIST 3.A.1.e Packet Pg. 119 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) COLLIER COUNTY GOVERNMENT GROWTH MANAGEMENT DEPARTMENT www.colliergov.net 2800 NORTH HORSESHOE DRIVE NAPLES, FLORIDA 34104 (239) 252-2400 FAX (239) 252-5724 ADDRESSING CHECKLIST Please complete the following and email to GMD_Addressing@colliergov.net or fax to the Operations Division at 239-252-5724 or submit in person to the Addressing Section at the above address. Form must be signed by Addressing personnel prior to pre-application meeting, please allow 3 days for processing. Not all items will apply to every project. Items in bold type are required. FOLIO NUMBERS MUST BE PROVIDED. Forms older than 6 months will require additional review and approval by the Addressing Section. PETITION TYPE (Indicate type below, complete a separate Addressing Checklist for each Petition type) BL (Blasting Permit) BD (Boat Dock Extension) Carnival/Circus Permit CU (Conditional Use) EXP (Excavation Permit) FP (Final Plat LLA (Lot Line Adjustment) PNC (Project Name Change) PPL (Plans & Plat Review) PSP (Preliminary Subdivision Plat) PUD Rezone RZ (Standard Rezone) SDP (Site Development Plan) SDPA (SDP Amendment) SDPI (Insubstantial Change to SDP) SIP (Site Im provement Plan) SIPI (Insubstantial Change to SIP) SNR (Street Name Change) SNC (Street Name Change – Unplatted) TDR (Transfer of Development Rights) VA (Variance) VRP (Vegetation Removal Permit) VRSFP (Vegetation Removal & Site Fill Permit) OTHER LEGAL DESCRIPT ION of subject property or properties (copy of lengthy description may be attached) FOLIO (Property ID) NUMBER(s) of above (attach to, or associate with, legal description if more than one) STREET ADDRESS or ADDRESSES (as applicable, if already assigned) PROPOSED STREET NAMES (if applicable) SITE DEVELOPMENT PLAN NUMBER (for existing projects/sites only) LOCATION MAP must be attached showing exact location of project/site in relation to nearest public road right- of-way PROPOSED PROJECT NAME (if applicable) SDP - or AR or PL # SURVEY (copy - needed only for unplatted properties) CURRENT PROJECT NAME (if applicable) Rev. 6/9/2017 Page 1 of 2 Immokalee Solar (Project Name not yet approved) (4,9,16-46-29) 3.A.1.e Packet Pg. 120 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) COLLIER COUNTY GOVERNMENT GROWTH MANAGEMENT DEPARTMENT www.colliergov.net 2800 NORTH HORSESHOE DRIVE NAPLES, FLORIDA 34104 (239) 252-2400 FAX (239) 252-5724 Please Return Approved Checklist By: Email Personally picked up Applicant Name: Signature on Addressing Checklist does not constitute Project and/or Street Name approval and is subject to further review by the Operations Division. FOR STAFF USE ONLY Folio Number Folio Number Folio Number Folio Number Folio Number Folio Number Approved by: Date: Updated by: Date: IF OLDER THAN 6 MONTHS, FORM MUST BE UPDATED OR NEW FORM SUBMITTED Fax Email/Fax:Phone: Project or development names proposed for, or already appearing in, condominium documents (if application; indicate whether proposed or existing) Rev. 6/9/2017 Page 2 of 2 00063280003 00064320001 00065000003 9/21/2020 3.A.1.e Packet Pg. 121 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) DISCLOSURE FORM 3.A.1.e Packet Pg. 122 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.ePacket Pg. 123Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.ePacket Pg. 124Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.ePacket Pg. 125Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.ePacket Pg. 126Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) WARRANTY DEED 3.A.1.e Packet Pg. 127 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 128 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) SURVEY 3.A.1.e Packet Pg. 129 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) T 45 S, R 30 ET 45 S, R 29 ET 45 S, R 28 ET 46 S, R 30 ET 46 S, R 29 ET 46 S, R 28 ET 47 S, R 30 ET 47 S, R 29 ET 47 S, R 28 E1314151617202021212223232323242526262728293233343434353535363613131314141516161718192021222222232324242424252627282930313233343536161718192021282930313232323312345589101112131415161720212223242526272829323334353612234567891011121314151617181920202122232425262728293031323333343536456789161718192021282930313233331223458910111212345678910111244456789131415161713141516171820212223249161718192021FELDAIMMOKALEESTATE ROAD 82 STATE ROAD 29 HENRY COUNTYCOLLIER COUNTYProject LocationLocation Map(Not to Scale)SURVEYOR'S NOTES:1). THIS ALTA/ACSM LAND TITLE (BOUNDARY) SURVEY IS NOT VALID WITHOUT THE SIGNATURE AND ORIGINAL RAISED SEAL OF THE FLORIDALICENSED SURVEYOR AND MAPPER LISTED BELOW.2). PROJECT HORIZONTAL DATUM IS RELATIVE TO THE NORTH AMERICAN DATUM OF 1983, 2011 ADJUSTMENT (NAD83 / 2011) WITH COORDINATESSHOWN HEREON EXPRESSED IN THE FLORIDA STATE PLANE COORDINATE SYSTEM, EAST ZONE (0901), US SURVEY FEET, BASED UPON REDUNDANTGLOBAL POSITIONING SYSTEM (GPS) MEASUREMENTS TO THE NATIONAL GEODETIC SURVEY (NGS) CONTROL STATIONS LISTED BELOW:PID: AJ7285 PID:AJ7337 DESIGNATION: E 520 Designation: D 520NORTHING: 782,331.04 NORTHING: 785,354.30EASTING: 513,919.04 EASTING: 513,899.38Stainless steel rod with sleeve and disk set in top of concrete monument stampedcover stamped “E 520 2001 CERP” “ D 520 2001 CERP”Go to http://www.ngs.noaa.gov for additional information regarding these control stations 3). BEARINGS SHOWN HEREON ARE RELATIVE TO THE FLORIDA STATE PLANE COORDINATE SYSTEM, EAST ZONE (0901), NAD83/2011, BASED ON THECENTERLINE OF SURVEY OF FLORIDA DEPARTMENT OF TRANSPORTATION STATE ROAD 29 RIGHT OF WAY MAP, STATE PROJECT NO. 03050-000,BETWEEN STATION 2251+00.00, AND STATION 2288+00.00 AS BEING S 00° 38'16 ” W.4). THE LOCATION AND CONFIGURATION OF THE LANDS SURVEYED WAS PROVIDED BY THE CLIENT5). LANDS SHOWN HEREON WERE NOT ABSTRACTED FOR OWNERSHIP, EASEMENTS, RIGHTS-OF-WAY OR OTHER TITLE MATTERS BY THIS FIRM. ANYTITLE MATTERS SHOWN OR NOTED HEREON ARE BASED UPON A REVIEW OF FIDELITY NATIONAL TITLE INSURANCE COMPANY COMMITMENT FORTITLE INSURANCE, ORDER No. 7826583, COMMITMENT DATE: JULY 31, 2019 at 08: 00AM.TITLE COMMITMENT SCHEDULE BII EXCEPTIONS THAT MAY AFFECT TITLE ARE LISTED BELOW AND SHOWN OR NOTED ON THE SURVEY.NOTE: NUMBERS LISTED BELOW MATCH EXCEPTION NUMBERS LISTED IN THE COMMITMENT. ALL REFERENCED DOCUMENTS ARE FILED IN THE PUBLICRECORDS OF COLLIER COUNTY, FLORIDA.6. Covenants, conditions reservations and restrictions contained in Warranty Deed recorded in OfficialRecords Book 1166, Page 1887. Those portions of the land surveyed lying in Sections 4 and 9, T46S, R29E are contained within the lands described in Exhibit “D” ofthis document. -Not plottable-7. Oil, gas and mineral rights contained in Deed recorded in Official Records Book 884, Page 1517 andOfficial Records Book 884, Page 1524; and as amended in Official Records Book 949, Page 364.(1) Those portions of the lands surveyed lying in Section 16, T46S,R29E are contained within the lands described in Schedule D of ORB 884, Page 1517. -Not plottable- (2) Those portions of the lands surveyed lying in Section 16,T46S, R29E are contained within the lands described in Schedule A of ORB 884, Page 1524- Not Plottable- (3) . Those portions of the land surveyed lying inSections 4 and 9, T46S, R29E are contained within the lands described in Schedule B of ORB 884, Page 1524- Not plottable- (3) The lands surveyed are notdescribed in ORB 949, Page 3648. Right-of-Way Easement recorded in Official Records Book 416, Page 699. -As depicted hereon-9. Oil, Gas & Mineral Lease to Sun Oil Company recorded in Official Records Book 151, Page 189; and assigned to Exxon Corporation by Assignment recorded inOfficial Records Book 1321, Page 1721; as affected by Release recorded in Official Records Book 1826, Page 1887 (1) Those portions of the land surveyed lying inSections 4 and 9, T46S, R29E are contained within the lands described in ORB 151, Page 189 as well as in Exhibit “A” of ORB 1321, Page 1721 -Not plottable-(2) Those portions of the land surveyed lying in Sections 4 and 9, T46S, R29E are contained within the lands described in ORB 1826. Page 1887- Not Plottable10. Terms and conditions contained in Oil, Gas & Mineral Deeds recorded in Official Records Book 1413, Page 929; Official Records Book 1413, Page 1063; OfficialRecords Book 1482, Page 781; and as corrected in Official Records Book 1498, Page 1124 (1) Those portions of the lands surveyed lying in Section 16, T46S, R29Eare contained within the lands described in Schedule A Tract 2 and those portions of the land surveyed lying in Sections 4 and 9, T46S, R29E are contained within thelands described in Schedule B Tract 1 of ORB 1413. Page 929 -Not plottable- (2) Those portions of the lands surveyed lying in Section 16, T46S, R29E are containedwithin the lands described in Schedule A Tract 2 and portions of the land surveyed lying in Sections 4 and 9, T46S, R29E are contained within the lands described inSchedule B Tract 1 of ORB 1413. Page 1063 -Not plottable- (3) Those portions of the lands surveyed lying in Section 16, T46S, R29E are contained within the landsdescribed in Schedule A Tract 2 and portions of the land surveyed lying in Sections 4 and 9, T46S, R29E are contained within the lands described in Schedule B Tract1 of ORB 1482. Page 781 -Not plottable- (4) The lands surveyed are affected by corrective deed recorded in ORB 1498, Page 1124- Not plottable-11. Memorandum of Notice recorded in Official Records Book 2394, Page 378. The lands surveyed lie within the lands described in Exhibit “A” of ORB 2394, Page 378. -Not plottable-12. Terms and conditions of Oil, Gas and Mineral Deed recorded in Official Records Book 4393, Page 2324. Those portions of the lands surveyed lying in Section 16,T46S, R29E are contained within the lands described in Schedule A Tract 2 and those portions of the land surveyed lying in Sections 4 and 9, T46S, R29E arecontained within the lands described in Schedule B Tract 1 of ORB 4393. Page 2324 -Not plottable-13. Notice of Interest In Land Pursuant To Florida Statutes Section 704.05 And Florida Statutes Chapter 712 recorded in Official Records Book 4592, Page 154. Thoseportions of the lands surveyed lying in Section 16, T46S, R29E are contained within the lands described in Exhibit A, Schedule A Tract 1 and those portions of the landsurveyed lying in Sections 4 and 9, T46S, R29E are contained within the lands described in Exhibit A, Schedule B Tract 1 of ORB 4592. Page 154 -Not plottable-14. Resolution No. 2013-183 and Resolution No. 2013-184 recorded in Official Records Book 4965, Page 1660. The lands surveyed lie within the lands described in Resolution No. 2013-184 in ORB 4965, Page 1660- Not Plottable-15. Resolution No. 2014-176 recorded in Official Records Book 5077, Page 1392. The lands surveyed lie within the lands described in Resolution No. 2014-176 in ORB5077, Page 1392- Not Plottable-16. Resolution No. 2015-175 recorded in Official Records Book 5194, Page 2200. The lands surveyed lie within the lands described in Resolution No. 2014-175 in ORB5194, Page 2200- Not Plottable-17. Resolution No. 2018-150 recorded in Official Records Book 5552, Page 3785. The lands surveyed lie within the lands described in Resolution No. 2014-150 in ORB5552, Page 3785- Not Plottable-18. State of Florida Department of Transportation Project Resolution For State Highway System Projects recorded in Official Records Book 5337, Page 307. Thoseportions of the land surveyed lying in Section 9, T46S, R29E are contained within the lands described in this document. -Not plottable-19. Temporary Easement granted to State of Florida Department of Transportation recorded in OfficialRecords Book 5476, Page 1468. - As depicted hereon-20. Subordination of Utility Interests For Temporary Easements recorded in Official Records Book 5482, Page2986. - As depicted hereon-21. Temporary Access Easement recorded in Official Records Book 5630, Page 2051. Runs adjacent to lands surveyed- As depicted hereon- Does not affect subjectproperty.22. Easements recorded in Deed Book 12, Page 483. …Right-of-way and easement to build, maintain, operate and use of roads of a width not to exceed onehundred (100) feet across certain lands in Collier, Lee, and Hendry Counties, Florida owned by Collier Corporation. Not certain if Collier Corporation owned landssurveyed in 1948.23. Terms, conditions, reservations and easements contained in Oil, Gas and Mineral Lease recorded in DeedBook 9, Page 560; and assigned to Humble Oil & Refining Company in Deed Book 10, Page 54. The lands surveyed lie within the lands described. In Exhibit A ofDeed Book 9, Page 560 - Not Plottable -24. Oil, Gas and Mineral Deed recorded in Deed Book 22, Page 37. Lands surveyed do not appear to lie within the lands described in this document. - Not Plottable-25. Oil, Gas and Mineral Lease to Humble Oil & Refining Company recorded in Deed Book 24, Page 379, andDeed Book 24, Page 385. The lands surveyed are not contained within the lands described in these documents. Not plottable -26. Right of Way Deed to the State of Florida Department of Transportation recorded in Deed Book 31, Page 49.As best as can be determined from a partially illegible document, the lands surveyed are not contained within the lands described in this document. - Not plottable-6). THERE MAY BE OTHER MATTERS AFFECTING TITLE NOT SHOWN ON THIS SURVEY.7). UNDERGROUND IMPROVEMENTS SUCH AS FOUNDATIONS AND UTILITIES WERE NOT LOCATED. MINOR JEEP TRAILS WERE NOT LOCATED.8). THIS SURVEY DOES NOT ADDRESS ANY ADVERSE OWNERSHIP CLAIM BY THE STATE OF FLORIDA BY RIGHT OF SOVEREIGNTY TO ANY PORTIONOF THE LANDS SURVEYED, INCLUDING SUBMERGED, FILLED AND ARTIFICIALLY EXPOSED LANDS, AND LANDS ACCRETED TO THOSE LANDS.9). THIS SURVEY DOES NOT ADDRESS THE LOCATION OF JURISDICTIONAL WETLANDS OR HAZARDOUS MATERIALS.10). THIS SURVEY HAS BEEN PERFORMED IN CONFORMANCE WITH APPLICABLE SECTIONS OF FLORIDA ADMINISTRATIVE CODE RULE CHAPTER 5J-17,PURSUANT TO CHAPTER 472, FLORIDA STATUTES.11). THE LANDS DESCRIBED AND DEPICTED HEREON ARE ONE AND THE SAME LANDS DESCRIBED IN THE ABOVE REFERENCED COMMITMENT FORTITLE INSURANCE.ROBERT M. JONESFLORIDA PROFESSIONAL SURVEYOR AND MAPPERLICENSE No. LS 4201Collier County, FloridaofALTA/NSPS Land Title SurveyBARRON COLLIER - NAPLES SOLAR ENERGY SITELocated inSection 4, 9, 16 Township 46 South, Range 29 EastSheet IndexSheet DescriptionParcel 00063280003 (Section 4) =33.41Parcel 00064320001 (Section 9)=221.82Parcel 00065000003 (Section 16) =322.70 ______________________________________________Surveyed Gross Acres ±=577.93Less-out Acreage ± (See Sheet 6)=29.59Net Acreage ±=548.34(See Sheet 6 for calculation of Gross and Net Areas) Surveyed Areas of RevisionProject Title: 6of Sheet No. Prepared for: Dwg. Date:County:Collier County, Florida Photo Date:Field Books: 1356 Drawn by:Office No.: 6374191196 Checked by:Dwg. Name: 6374191196.DWG 09/29/2019 BJG RMJ 2017 Collier County, Florida Located in ALTA/NSPS Land Title Survey DatePrepared by:Last Day in Field: 10/23/2019Revision DateGRAPHIC SCALE1 inch = 1000 ft.(IN FEET)NORTH050010002000 1 BARRON COLLIER - NAPLESAltamonte Springs, FL 32701 USAWood Environment & Infrastructure Solutions, Inc.www.woodplc.comPhone: (407) 522-7570Certificate of Authorization Number LB-0007932550 Northlake Boulevard, Suite 1000NORTH SURVEYOR'S CERTIFICATIONTo: Florida Power & Light Company, a Florida corporation, DPW Law Firm, and Fidelity National Title InsuranceCompany. This is to certify that this map or plat and the survey on which it is based were made in accordance withthe 2016 Minimum Standard Detail Requirements for ALTA/NSPS Land Title Surveys, jointly established andadopted by ALTA and NSPS and includes Items 1, 2, 3, 4, 6, 7, 8, 13, 14, 16, 17,and 19.The field work was completed on July 15, 2020Date of Plat or Map: July 29, 2020For the Firm,1Cover2-4Details5Line and Curve Tables6Gross & Net Acreage Map12). LANDS LIE IN ZONE "X SHADED" & “AH", PER NATIONAL FLOOD INSURANCE RATE MAP "COLLIER COUNTY, FLORIDA ANDINCORPORATED AREAS" PANEL 135 OF 1225, MAP NUMBER 12021C0135H, EFFECTIVE DATE: MAY 16, 2012. ZONE "X" = "Area ofmoderate flood hazard, between the limits of 100 - year and 500 year floods. Zone "AH" = Areas with a 1% annual chance of shallow flooding(ponding) with an average depth ranging from 1 to 3 feet.13). ADDITIONS OR DELETIONS TO THIS ALTA/NSPS LAND TITLE SURVEY ARE PROHIBITED WITHOUT WRITTENCONSENT OF THE SIGNING FLORIDA LICENSED SURVEYOR AND MAPPER.THE SIGNING PARTY IS NOT RESPONSIBLEFOR ADDITIONS, DELETIONS OR MANIPULATION OF THE DATA CONTAINED IN THE SURVEY MAPOR ASSOCIATED DIGITAL FILE.14.) SOURCE OF AERIAL PHOTOGRAPHY/IMAGE: THIS DIGITAL IMAGERY WAS ACQUIRED VIA FLORIDA DEPARTMENT OF TRANSPORTATION (FDOT) AERIAL PHOTO LOOK-UP SYSTEM (APLUS). https://fdotewp1.dot.state.fl.us/AerialPhotoLookUpSystemTHIS IMAGERY IS SHOWN FOR REFERENCE ONLY; THIS SURVEY DOES NOT WARRANT THE ACCURACY OF THIS IMAGERY.15). PROPERTY IS PRIMARILY CITRUS GROVE, NO STREET ADDRESS OF SUBJECT PROPERTY.16). THE ORIGINAL FIELD DATA ACQUISITION PHASE OF THIS SURVEY WAS COMPLETED IN DECEMBER 19, 2019, AS DOCUMENTED IN WOOD FIELD BOOKS 1356 AND 1402. FIELD DATA ACQUISITION TO SUPPORT REVISION OF BOUNDARY ANDINGRESS-EGRESS EASEMENT WAS COMPLETED JULY 15, 2020 IN WOOD FIELD BOOK 1407.FLORIDA POWER & LIGHT 700 UNIVERSE BOULEVARD JUNO BEACH, FL 33408SHEET 4SHEET 3SHEET 2NW 1/4NE 1/4SE 1/4SW 1/4NW 1/4NE 1/4SE 1/4SW 1/4NE 1/4NW 1/4SE 1/4SW 1/4STATE ROAD 82STATE ROAD 29 STATE ROAD 29 SECTION 4SECTION 4SECTION 4SECTION 4SECTION 9SECTION 9SECTION 9SECTION 9SECTION 16SECTION 16SECTION 16SECTION 16POINT OF BEGINNINGPOINT OF COMMENCEMENTSW CORNER OF SECTION 16SOLAR ENERGY SITE LEGAL DESCRIPTION OF LANDS SURVEYED:A parcel of land being a part of Sections 4, 9, and 16, Township 46 South, Range 29 East, Collier County, Florida,Being more particularly described as follows:Commencing at the Southwest corner of said Section 16; thence N89°05'11”E, along the south line of the southwest ¼ of said section 16, a distanceof 2650.16 feet to the east line of the southwest ¼ of said Section 16; thence N00°37'45”W, along said east line, a distance of 893.57 feet to the POINT OFBEGINNING; thence departing said east line, run S75°20'01”E, a distance of 663.02 feet; thence S75°55'51”E, a distance of 80.66 feet; thence S73°16'08”E, adistance of 59.89 feet; thence N24°20'38"E, a distance of 46.79 feet; thence N00°11'01"E, a distance of 166.98 feet; thence N65°09'07"W, a distance of354.49 feet; thence N57°16'10"W, a distance of 222.58 feet; thence N43°09'13"W, a distance of 160.98 feet; thence N27°43'02"W, a distance of 223.14 feet;thence N26°53'04"W, a distance of 181.96 feet; feet to aforesaid east line of the southwest ¼ of Section 16; thence departing said east line, continueN26°53'04"W, a distance of 196.53 feet; thence N29°23'47"W, a distance of 172.09 feet to a point on a non-tangent curve with a radius of 180.15 feet,concave to the east; thence northwesterly along said curve to the right through a central angle of 59°54'32", a distance of 188.36 feet where the chord bearsN03°11'40"W a distance of 179.90 feet to the point of intersection with a non-tangent line; thence N23°39'31"E, a distance of 84.45 feet; thence N26°18'30"W,a distance of 238.04 feet; thence N60°35'03"W, a distance of 32.45 feet; thence S60°53'17"W, a distance of 82.09 feet; thence S82°21'35"W, a distance of154.36 feet; thence N85°55'54"W, a distance of 100.73 feet; thence N76°01'53"W, a distance of 171.69 feet; thence N72°44'10"W, a distance of 162.49 feet toa point on a non-tangent curve with a radius of 334.58 feet, concave to the northeast; thence westerly along said curve to the right through a central angle of54°01'23", a distance of 315.47 feet to the south line of the northwest ¼ of aforesaid Section 16 (where the chord bears N42°10'17"W a distance of 303.91feet to the point of intersection with a non-tangent line); thence departing said south line, run N12°10'48"W, a distance of 34.67 feet; thence N01°44'38"W, adistance of 315.28 feet; thence N03°16'14"W, a distance of 234.59 feet; thence N54°58'48"W, a distance of 141.82 feet; thence S66°23'57"W, a distance of130.52 feet to a point on a non-tangent curve with a radius of 337.03 feet, concave to the north; thence southwesterly along said curve to the right through acentral angle of 59°55'46", a distance of 352.52 feet where the chord bears N85°02'20"W a distance of 336.67 feet to the point of intersection with anon-tangent line; thence N42°17'26"W, a distance of 81.24 feet; thence N39°29'03"W, a distance of 183.00 feet; thence N40°26'22"W, a distance of 157.67feet; thence N47°00'34"W, a distance of 139.93 feet to a point on a non-tangent curve with a radius of 287.61 feet, concave to the east; thence northwesterlyalong said curve to the right through a central angle of 71°48'29", a distance of 360.46 feet where the chord bears N04°19'28"W a distance of 337.33 feet tothe point of intersection with a non-tangent line; thence N46°28'03"E, a distance of 124.92 feet; thence N51°19'36"E, a distance of 124.92 feet to a point on anon-tangent curve with a radius of 346.99 feet, concave to the south; thence northeasterly along said curve to the right through a central angle of 57°02'26", adistance of 345.44 feet where the chord bears S87°47'38"E a distance of 331.35 feet to the point of intersection with a non-tangent line; thence S44°38'05"E,a distance of 384.44 feet; thence S32°07'41"E, a distance of 185.42 feet; thence S26°29'56"E, a distance of 106.41 feet; thence S16°41'39"E, a distance of97.52 feet; thence S11°15'06"W, a distance of 64.58 feet; thence S51°38'18"E, a distance of 174.02 feet; thence N58°59'56"E, a distance of 95.19 feet; thenceN66°50'39"E, a distance of 102.19 feet to a point on a non-tangent curve with a radius of 226.62 feet, concave to the south; thence easterly along said curveto the right through a central angle of 60°07'16", a distance of 237.80 feet where the chord bears S81°47'06"E a distance of 227.04 feet to the point ofintersection with a non-tangent line; thence S58°23'44"E, a distance of 118.23 feet; thence S49°00'58"E, a distance of 159.00 feet; thence S29°30'33"E, adistance of 210.80 feet; thence S26°48'25"E, a distance of 439.41 feet; thence S21°07'20"E, a distance of 42.79 feet; thence S01°54'46"W, a distance of 15.86feet to aforesaid south line of the northwest ¼ of Section 16; thence departing said south line, continue S01°54'46"W, a distance of 101.19 feet; thenceS28°03'10"E, a distance of 226.25 feet to aforesaid east line of the southwest ¼ of Section 16; thence departing said east line, run S28°00'26"E, a distance of99.95 feet; thence S89°48'40"E, a distance of 54.82 feet; thence S66°14'26"E, a distance of 196.18 feet; thence S57°52'50"E, a distance of 294.12 feet;thence S45°37'09"E, a distance of 423.70 feet; thence S31°19'19"E, a distance of 327.77 feet; thence S37°05'37"E, a distance of 60.56 feet; thenceN80°36'14"E, a distance of 95.15 feet; thence N88°08'24"E, a distance of 282.49 feet; thence S61°38'14"E, a distance of 207.86 feet; thence S09°59'57"E, adistance of 320.20 feet; thence S11°53'31"E, a distance of 279.08 feet; thence S62°47'07"E, a distance of 77.50 feet; thence S75°15'51"E, a distance of883.29 feet; thence N00°38'44"W, a distance of 1864.68 feet; thence S51°03'41"W, a distance of 115.91 feet to a point on a non-tangent curve with a radiusof 292.21 feet, concave to the northeast; thence southwesterly along said curve to the right through a central angle of 105°47'48", a distance of 539.57 feetwhere the chord bears N65°09'57"W a distance of 466.11 feet to the point of intersection with a non-tangent line; thence N16°45'04"W, a distance of 173.47feet; thence N00°37'25"W, a distance of 48.87 feet to the south line of the northeast ¼ of Section 16, thence departing said south line, continue N00°37'25"W,a distance of 29.69 feet to a point on a non-tangent curve with a radius of 135.93 feet, concave to the southwest; thence northerly along said curve to the leftthrough a central angle of 60°09'32", a distance of 142.73 feet where the chord bears N22°37'15"W a distance of 136.26 feet to the point of intersection with anon-tangent line; thence N58°07'50"W, a distance of 516.62 feet; thence N60°58'32"W, a distance of 54.63 feet to a point on a non-tangent curve with a radiusof 112.22 feet, concave to the south; thence northwesterly along said curve to the left through a central angle of 60°15'25", a distance of 118.01 feet wherethe chord bears N83°31'49"W a distance of 112.65 feet to the point of intersection with a non-tangent line; thence S74°42'31"W, a distance of 145.11 feet to apoint on a non-tangent curve with a radius of 380.90 feet, concave to the northeast; thence westerly along said curve to the right through a central angle of59°54'38", a distance of 398.28 feet where the chord bears N62°32'13"W a distance of 380.39 feet to the point of intersection with a non-tangent line; thenceN24°42'10"W, a distance of 277.56 feet; thence N30°15'20"W, a distance of 132.74 feet; thence N40°28'47"W, a distance of 112.93 feet; thence N41°30'42"W,a distance of 393.81 feet; thence N27°09'40"W, a distance of 812.57 feet; thence N47°41'01"W, a distance of 81.72 feet to the east line of the northwest ¼ ofsaid Section 16; thence departing said east line, run N47°45'02"W, a distance of 793.37 feet; thence S89°17'09"W, a distance of 787.79 feet; thenceN14°36'16"W, a distance of 35.37 feet to the south line of the southwest ¼ of said Section 9; thence departing said south line; thence N24°46'59"W, adistance of 187.13 feet; thence N00°59'49"W, a distance of 421.04 feet; thence N12°00'51"W, a distance of 176.45 feet; thence N19°15'03"W, a distance of175.51 feet; thence S78°29'00"W, a distance of 173.54 feet; thence S87°20'35"W, a distance of 106.34 feet; thence N67°17'58"W, a distance of 183.95 feet;thence N58°48'58"W, a distance of 208.56 feet to a point on a non-tangent curve with a radius of 310.99 feet, concave to the east; thence northwesterly alongsaid curve to the right through a central angle of 60°00'27", a distance of 325.71 feet where the chord bears N06°27'09"W a distance of 311.03 feet to thepoint of intersection with a non-tangent line; thence N44°25'54"E, a distance of 219.41 feet to a point on a non-tangent curve with a radius of 386.01 feet,concave to the south; thence northeasterly along said curve to the right through a central angle of 60°11'16", a distance of 405.50 feet where the chord bearsS89°30'14"E a distance of 387.11 feet to the point of intersection with a non-tangent line; thence S50°21'03"E, a distance of 142.88 feet; thence S31°09'57"E,a distance of 146.21 feet; thence S19°05'08"E, a distance of 233.59 feet; thence S16°02'13"E, a distance of 209.04 feet; thence S17°29'29"E, a distance of227.30 feet; thence S59°43'57"E, a distance of 161.60 feet; thence S44°57'50"E, a distance of 152.29 feet; thence S78°33'33"E, a distance of 63.17 feet;thence N84°04'34"E, a distance of 115.72 feet; thence S83°57'49"E, a distance of 121.00 feet to a point on a non-tangent curve with a radius of 72.07 feet,concave to the northwest; thence easterly along said curve to the left through a central angle of 59°32'26", a distance of 74.90 feet where the chord bearsN57°25'32"E a distance of 71.57 feet to the point of intersection with a non-tangent line; thence N07°00'55"E, a distance of 74.47 feet; thence N22°51'25"E, adistance of 124.02 feet; thence N36°27'33"E, a distance of 232.68 feet; thence N54°53'24"E, a distance of 274.99 feet; thence N64°07'04"E, a distance of153.09 feet; thence N00°52'43"W, a distance of 403.18 feet; thence N88°54'48"E, a distance of 115.19 feet to the east line of the southwest ¼ of Section 9;thence departing said east line, run N88°54'48"E, a distance of 183.21 feet; thence N00°48'36"W, a distance of 759.02 feet; thence N68°23'03"W, a distanceof 64.52 feet; thence N54°59'17"W, a distance of 149.10 feet to aforesaid east line of the southwest ¼ of Section 9; thence departing said east line,N54°59'17"W, a distance of 480.61 feet; thence S75°46'20"W, a distance of 374.76 feet; thence N88°35'50"W, a distance of 166.43 feet; thence N45°29'35"W,a distance of 222.14 feet to the south line of the northwest ¼ of said Section 9; thence departing said south line, run N45°32'03"W, a distance of 351.59 feet;thence N31°54'09"W, a distance of 209.90 feet; thence N22°17'55"W, a distance of 323.94 feet; thence N17°37'56"W, a distance of 138.86 feet to a point on anon-tangent curve with a radius of 298.99 feet, concave to the east; thence northerly along said curve to the right through a central angle of 60°00'00", adistance of 313.10 feet where the chord bears N12°37'33"E a distance of 298.99 feet to the point of intersection with a non-tangent line; thence N48°46'26"E,a distance of 377.70 feet; thence N54°12'46"E, a distance of 240.92 feet; thence N58°31'38"E, a distance of 134.18 feet; thence N85°48'47"E, a distance of59.56 feet; thence S83°16'43"E, a distance of 576.57 feet; thence N01°28'07"W, a distance of 734.95 feet; thence N41°08'30"W, a distance of 620.76 feet tothe south line of the southwest ¼ of said Section 4; thence departing said south line, run N02°52'53"W, a distance of 524.65 feet; thence N35°32'28"W, adistance of 248.76 feet; thence N44°57'52"W, a distance of 70.03 feet; thence N85°22'41"W, a distance of 129.08 feet; thence N81°24'25"W, a distance of85.32 feet; thence N70°36'56"W, a distance of 123.88 feet; thence N57°44'59"W, a distance of 249.10 feet; thence S86°31'53"W, a distance of 262.02 feet;thence S16°13'27"W, a distance of 244.98 feet to a point on a non-tangent curve with a radius of 159.87 feet, concave to the north; thence southwesterlyalong said curve to the right through a central angle of 128°28'53", a distance of 358.50 feet where the chord bears N86°03'03"W a distance of 287.97 feet tothe point of intersection with a non-tangent line; thence S89°11'36"W, a distance of 465.18 feet to the east right-of-way line of State Road 29; thence alongsaid east right-of-way line the following five (5) courses: thence S00°31'26"E, a distance of 761.64 feet to aforesaid south line of the southwest ¼ of saidSection 4; thence S00°38'16"E, a distance of 2734.95 feet to aforesaid south line of the northwest ¼ of said Section 9; thence continue S00°38'16"E, adistance of 2734.05 feet to aforesaid south line of the southwest ¼ of said Section 9; thence continue S00°38'16"E, a distance of 2738.75 feet to aforesaidsouth line of the northwest ¼ of Section 16, thence continue S00°38'16"E, a distance of 1008.74 feet; thence departing said east right-of-way line, runS79°08'44"E, a distance of 207.57 feet; thence S74°48'48"E, a distance of 113.82 feet; thence S07°03'21"W, a distance of 137.12 feet; thence S75°20'01”E, adistance of 2333.17 feet to the POINT OF BEGINNING.Containing 25174520 square feet or 577.93 acres, more or lessLEGAL DESCRIPTION: Ingress - Egress EasementA parcel of land being a part of Section 16, Township 46 South, Range 29 East, Collier County, Florida,Being more particularly described as follows:Commencing at the Southwest corner of said Section 16; thence N89°05'11”E, along the south line of the southwest ¼ of said section 16, a distanceof 105.28 feet to the east right-of-way line of State Road 29; thence N00°38'16"W, along said east right-of-way line, a distance of 1565.96 feet to the POINTOF BEGINNING; thence continue N00°38'16"W, a distance of 51.84 feet; thence departing said east right-of-way line, run S75°20'01"E, a distance of 307.48;thence S07°03'21"W, a distance of 15.13 feet; thence S75°20'01"E, a distance of 50.00 feet; thence S14°38'34"W, a distance of 35.00 feet; thence; thenceN75°20'01"W, a distance of 345.82 feet to the POINT OF BEGINNING.Containing 16868 square feet or 0.39 acres, more or less.Revised Boundary and added 10/23/2019POINT OF BEGINNINGINGRESS/EGRESSEASEMENTIngress - Egress Easement NGS CONTROL POINT"D 520"NGS CONTROL POINT"E 520"SECTION 4PARCEL I.D. 00063280003PARCEL I.D. 00064320001PARCEL I.D. 00065000003Revised call to east line of NW 1/4 of Section 16 1/6/20 Revised boundary, Ingress-egress easement 07/29/2020 Revised Surveyor's Note 5) 21, 23-26 08/07/2020 C:\Wood Jobs\FPL State Road 29\AutoCAD Civil 3D\Boundary v2.dwg, 8/7/2020 4:38:22 PM 3.A.1.ePacket Pg. 130Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) MBX TT OUOUOUOU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OUOUOUOUOUOUOUOUOUOUOUOU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU N 89°05'11" E 2650.16'N 89°05'44" E 2649.73' N 89°11'02" E 2648.79'N 89°11'14" E 2648.29'S 00°37'45" E 2734.18'XXXXOUOUOUOUOUOUOUOUOUOUOUOUNW 1/4 SW 1/4 SE 1/4 NE 1/4 SECTION 16 FOUND 5/8" IRON ROD & CAP (CIVILSURV LB 7805) FOUND 5/8" IRON ROD & CAP (CIVILSURV LB 7805) FOUND 4"X4" CONCRETE MONUMENT (NO I.D.) CCR # 103810 SE CORNER SECTION 16 (BROKEN TOP) CCR # 103528 SW CORNER SECTION 16 CCR # 103812 FOUND MAG NAIL (NO I.D.) 5.2' WEST OF SURVEY BASELINE OF STATE ROAD 29 FOUND NAIL & DISK (CIVILSURV LB 7805) 3.2' WEST OF SURVEY BASELINE S 89°16'49" W 2647.15' S 89°16'49" W 2647.14'S 00°38'54" E 2730.09'S 00°38'54" E 2730.09'FOUND MAG LB 7917 SURVEY BASELINE OF STATE ROAD 29 (NOT ON SECTION LINE) F.D.O.T. PROJECT 03050-000 STA. 2251+ 00.00 SECTION 16 SECTION 16 SECTION 16 SUBJECT PARCEL SUBJECT PARCEL SUBJECT PARCEL BARBED W I R E F E N C E Ingress/Egress Easement0.39± Acres BARBED WIRE FENCE EDGE OF ASPHALT PUMP BUILDING CONCRETE PUMP HOUSEON CONCRETE PAD CONCRETE SLAB STRUCTURE CONCRETE SLABSTRUCTURE CONCRETE SLABSTRUCTURE CONCRETE SLABSTRUCTURE 10' LEE COUNTY ELECTRIC CO-OPERATIVE, INC.RIGHT-OF-WAY EASEMENTO.R. 416 PG. 6998 10.00 10' LEE COUNTY ELECTRIC CO-OPERATIVE, INC.RIGHT-OF-WAY EASEMENT O.R. 416 PG. 699810.00 FPL EASEMENT (EXISTING ROAD)21 FPL EASEMENT (EXISTING ROAD)21S 00°35'25" E 2738.85'THE SOUTH LINE OF THE NORTHWEST 14 OF SECTION 16 THE SOUTH LINE OF THE SOUTHWEST 14 OF SECTION 16 THE EAST LINE OF THE SOUTHWEST 14 OF SECTION 16 THE EAST LINE OF THE NORTHWEST 14 OF SECTION 16 POINT OF COMMENCEMENT POINT OF BEGINNING THE SOUTH LINE OF THE SOUTHEAST 14 OF SECTION 16CANAL EXISTING OVERHEADFPL ELECTRIC TRANSMISSION LINE(NOTE: CORRIDOR IS UNDER CONSTRUCTION) THE SOUTH LINE OF THE NORTHEAST 14 OF SECTION 16WEST 1/4 SECTION 16 CCR # 103813 SE CORNER SECTION 16 CCR # 103810 EAST 1/4 CORNER SECTION 16 NOT FOUND (CALCULATED PER CCR # 103809) (INACCESSIBLE- HIGH WATER) SOUTH 1/4 SECTION 16 CCR # 103811 CENTER SECTION 16 CCR # 103814 (CORNER TO CORNER)SURVEY BASELINE (NOT ON SECTION LINE) EXTENDEDN 00°38'16" W 1776.71'N 00°35'25" W 1776.72'S 00°35'25" E 2738.85'(CORNER TO CORNER)N 14 CORNER SECTION 16 (INACCESSIBLE - HIGH WATER) CALCULATED PER CCR # 103528 NW CORNER SECTION 16 NOT FOUND (AREA UNDER CONSTRUCTION) SET NAIL & DISK (LB 7932) PER CCR # 111756 S 00°38'16" E 962.20'STATE ROAD 29VARIABLE WIDTH RIGHT-OF-WAYSECTIONS 03050-000 & 0308-5200100.00100.00 GRADED R O A D EXISTING EAST R/W LINE OF STATE ROAD 29S 00°38'16" E(SURVEY BASELINE)PUMP HOUSEON CONCRETE PAD 6' CHAIN LINK FENCE POINT OF BEGINNINGIngress/Egress Easement STATE ROAD 29Site Boundary (See Detail "C" At Right) IRON ROD & CAP SET 16' NORTH OF CORNER 3.5368 3.9650 S 00°36'45" E 2734.62'L1 L2 L3 L4L5L6 L7 L8 L 9 L 1 0 L 1 1 L 1 2L13L 1 4 L15L16 L17L18L19 L20L21L22L23L 2 4L25 L2 6 L2 7 L2 8 L2 9 L30L31 L3 2 L 3 3 L 3 4 L35L36L37L38 L39 L4 0 L41L 4 2 L 4 3 L44L45L46L 4 7 L 4 8 L49 L50 L5 1 L5 2 L 5 3 L 5 4L55 L56 L57 L58L59L60 L61 L62L63L64L65L66L6 7 L68L69 L 7 0 L 7 1 L7 2 L7 3 L 7 4 L 7 5 L 7 6 L77L78L 7 9 L137L138L139 L140 L141L142 C1C 2 C3C4C5 C6 C7C8C9C10 N 00°37'45" W 893.57'FOUND MAG NAIL LB 7917 SURVEY BASELINE OF STATE ROAD 29 (NOT ON SECTION LINE)F.D.O.T. PROJECT 03050-000STA. 2251+ 00.00 WEST LINE OF THE NW 14 SECTION 16STATE ROAD 29 SURVEY BASELINEN 00°38'16" W 1776.71'N 00°35'25" W 1776.72'S 89°24'35" W 1.54' WEST 14 CORNERSECTION 16 3.01 XXXXXXXXX XXXXXXXXXXXXXXN 00°38'16" W 51.84' S 75°20'01" E 50.00' N 75°20'01" W 345.82' POINT OF BEGINNING Ingress/EgressEasement Ingress /Egress Easement Site Boundary 3.5368 3.9650 S 75°20'01" E307.48'S 07°03'21" W15.13' S 14°38'34" W 35.00' L139 L140 L141N 00°38'16" W 1565.96'STATE ROAD 29EAST RIGHT-OF-WAY LINE OF STATE ROAD 29 N 89°05'11" E 105.28' SW CORNER SECTION 16 CCR # 103812 FOUND MAG NAIL (NO I.D.) 5.2' WEST OF SURVEY BASELINEOF STATE ROAD 29 POINT OF COMMENCEMENT ofRevisionProject Title:6ofSheet No.Prepared for:Dwg. Date:County:Collier County, FloridaPhoto Date:Field Books: 1356Drawn by:Office No.: 6374191196Checked by:Dwg. Name: 6374191196.DWG09/29/2019BJGRMJ2017Collier County, FloridaLocated inALTA/NSPS Land Title SurveyDatePrepared by:RevisionDateGRAPHIC SCALE 1 inch = 250 ft. (IN FEET)NORTH0 125 250 500 2Altamonte Springs, FL 32701 USA Wood Environment & Infrastructure Solutions, Inc. www.woodplc.com Phone: (407) 522-7570 Certificate of Authorization Number LB-0007932 550 Northlake Boulevard, Suite 1000 FLORIDA POWER & LIGHT700 UNIVERSE BOULEVARDJUNO BEACH, FL 33408SEE DETAIL "B" DETAIL "B"BARRON COLLIER - NAPLESSOLAR ENERGY SITELegend: R/W Right of way LB Licensed Business CCR Certified Corner Record L Line C Curve (C)Calculated FPL Florida Power and Light FDOT Florida Department ofTransporation Set Iron Rod with Capmarked " LB 7932" T XXSign Light Pole Telephone Pedestal Power Pole Guy Anchor Barbed Wire Fence Chain Link Fence Overhead WireOU DETAIL "C"DITCHDITCHDITCHSCALE: 1" = 100' SCALE: 1" = 10' SOUTH LINE OF SW 14OF SECTION 16 INGRESS - EGRESS EASEMENT Enhanced mapping of ingress08/07/2020-egress easementC:\Wood Jobs\FPL State Road 29\AutoCAD Civil 3D\Boundary v2.dwg, 8/7/2020 4:39:01 PM3.A.1.e Packet Pg. 131 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) OUOUOUOUOUOUOUOU OU OU OU OU OU OU OUOUOUSW 1/4 SE 1/4 NE 1/4 NW 1/4 SECTION 9 FOUND 5/8" IRON ROD & CAP (CIVILSURV LB 7805) CCR # 103529 CENTER SECTION 9 SE CORNER SECTION 9 FOUND 3"X3" CONCRETE MONUMENT (BROKEN TOP) CCR # 103528 (BROKEN TOP) CCR # 103526 WEST 1/4 CORNER SECTION 9 CCR # 103522 FOUND DISK (CIVILSURV LB 7805) SURVEY BASELINE IS EAST 0.2' FOUND MAG LB 7917 SURVEY BASELINE OF STATE ROAD 29 N. 3.4' , E. 0.4' OF SECTION CORNER (NOT ON SECTION LINE) PROJECT 03050-000 STA. 2288+ 00.00 END OF R/W ACQUISITIONPER F.D.O.T. R/W MAP SECTION 03050-000EAST 14 CORNER SECTION 9 (INACCESSIBLE - HIGH WATER) CALCULATED PER CCR # 103527 S 89°16'49" W 2647.15' S 89°16'49" W 2647.14'80.00 OF ADDITIONAL R/W PER F.D.O.T.R/W MAP SECTION 03050-000STATE R O A D 8 2 R/W V A R I E S P E R F . D . O . T . R/W M A P S E C T I O N 0 3 0 5 0 - 0 0 0 180.00 80.00 ORIGINAL R/W LINE PER F.D.O.T. R/W MAPSECTION 0308-5200EXISTING WEST R/W LINE PER F.D.O.T. R/W MAP SECTION 0308-5200 EXISTING EAST R/W LINE PER F.D.O.T. R/W MAP SECTION 0308-5200 NE CORNER SECTION 9 FND 3"X3" CONCRETE MONUMENT (BROKEN TOP) CCR # 103526 SW CORNER SECTION 4 FOUND RAIL ROAD SPIKE CCR # 081061 SURVEY BASELINE IS EAST 0.2' THE SOUTH LINE OF SECTION 4-46-26 SECTION 9 SECTION 9 SECTION 9 HOUSE SHEDCONCRETEPAD PUMP HOUSE ON CONCRETE PAD PUMP HOUSEON CONCRETE PAD TEMPORARY CONSTRUCTION EASEMENTO.R. 5482 PG. 2990O.R. 5476 PG. 14701920 10' LEE COUNTY ELECTRIC CO-OPERATIVE, INC.RIGHT-OF-WAY EASEMENTO.R. 416 PG. 6998 10.00 10' LEE COUNTY ELECTRIC CO-OPERATIVE, INC.RIGHT-OF-WAY EASEMENTO.R. 416 PG. 6998 THE SOUTH LINE OF THE NORTHWEST 14 OF SECTION 9 THE SOUTH LINE OF THE SOUTHWEST 14 OF SECTION 9 THE EAST LINE OF THE SOUTHWEST 14 OF SECTION 9 THE EAST LINE OF THE NORTHWEST 14 OF SECTION 9 NW CORNER SECTION 16 NOT FOUND (AREA UNDER N 14 CORNER SECTION 16(INACCESSIBLE - HIGH WATER) CALCULATED PER CCR # 103528 S 89°27'37" W 2646.98' N 14 CORNER SECTION 9(INACCESSIBLE - HIGH WATER) CALCULATED PER CCR # 111751 S 00°39'05" E 2747.36'N 00°37'51" W 2734.44'(CORNER TO CORNER)STATE ROAD 29VARIABLE WIDTH RIGHT-OF-WAYSECTIONS 03050-000 & 0308-5200N 89°10'51" E 2646.15' 190.3 DIRT ROAD DIRT DRIVE DIRT ROAD 10.00S00°38'16"E 3699.84'(SURVEY BASELINE)(MAG NAIL TO MAG NAIL)S00°38'16"E 1699.86'100.00SURVEY BASELINE(NOT ON SECTION LINE)100.24S00°38'16"E(SURVEY BASELINE EXTENDED)100.00 DIRT ROADDIRT ROADS 89°27'05" W 2646.33' (C)S 00°39'06" E 2718.22' (C)S 00°39'18" E 2759.85' (C)N 89°10'51" E 2646.15' (C) 123.4S 00°38'03" E 2726.12'L77L78L 7 9L80L81L82L83L84 L85 L8 6 L87 L88L 8 9 L90L91L92L9 3 L94L95L96 L97 L98L99L100L101 L102 L103L104 L105 L106L107 L 1 0 8 L 1 0 9 L110 L111 L1 1 2 L1 1 3 L 1 1 4L115L116L117 L118 L119L120 L121 L122L1 2 3 L135L136C11C12 C13C14BASELINESECTION LINE FOUND DISK(CIVIL SURVEY LB 7805) CCR # 103522WEST 1/4 CORNER SECTION 9 FOUND MAG LB 7917BASELINEOF STATE ROAD 29N. 3.4' , E. 0.4' OFSECTION CORNER (NOT ON SECTION LINE) PROJECT 03050-000 STA. 2288+ 00.00 0.40 N 00°37'51" WS 00°38'16" EofRevisionProject Title:6ofSheet No.Prepared for:Dwg. Date:County:Collier County, FloridaPhoto Date:Field Books: 1356Drawn by:Office No.: 6374191196Checked by:Dwg. Name: 6374191196.DWG09/29/2019BJGRMJ2017Collier County, FloridaLocated inALTA/NSPS Land Title SurveyDatePrepared by:RevisionDateGRAPHIC SCALE 1 inch = 250 ft. (IN FEET)NORTH0 125 250 500 3Altamonte Springs, FL 32701 USA Wood Environment & Infrastructure Solutions, Inc. www.woodplc.com Phone: (407) 522-7570 Certificate of Authorization Number LB-0007932 550 Northlake Boulevard, Suite 1000 FLORIDA POWER & LIGHT700 UNIVERSE BOULEVARDJUNO BEACH, FL 33408SEE DETAIL "A" DETAIL "A"BARRON COLLIER - NAPLESSOLAR ENERGY SITEDITCHDITCHLegend: R/W Right of way LB Licensed Business CCR Certified Corner Record L Line C Curve (C)Calculated FPL Florida Power and Light FDOT Florida Department ofTransporation Set Iron Rod with Capmarked " LB 7932" T XXSign Light Pole Telephone Pedestal Power Pole Guy Anchor Barbed Wire Fence Chain Link Fence Overhead WireOU SCALE: 1" = 10'C:\Wood Jobs\FPL State Road 29\AutoCAD Civil 3D\Boundary v2.dwg, 8/7/2020 3:57:47 PM3.A.1.e Packet Pg. 132 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) OUOUOUSW 1/4 SE 1/4 SECTION 4 NE CORNER SECTION 9 FND 3"X3" CONCRETE MONUMENT (BROKEN TOP) CCR # 103526 SW CORNER SECTION 4 FOUND RAIL ROAD SPIKE CCR # 081061 SURVEY BASELINE IS EAST 0.2' WEST 14 CORNER SECTION 4 FOUND RAIL ROAD SPIKE CCR # 111738 NW CORNER SECTION 4 FOUND MAG NAIL (F.D.O.T. LB 8011) CCR # 81060 NW 1/4 NE 1/4 S 00°30'03" E 2731.66'N 00°32'28" W 2738.43'SECTION 4 SECTION 4SECTION 4 EAST RIGHT-OF-WAY LINE OF STATE ROAD 29 PER F.D.O.T. RIGHT-OF-WAY MAP SECTION 0308-5200 WEST RIGHT-OF-WAY LINE OF STATE ROAD 29 PER F.D.O.T. RIGHT-OF-WAY MAP SECTION 0308-5200 200.00 DIRT ROADWEST LINE OF SECTION 4 THE SOUTH LINE OF THE SOUTHWEST 14 OF SECTION 4STATE ROAD 29VARIABLE WIDTH RIGHT-OF-WAYSECTIONS 03050-000 & 0308-5200N 89°10'51" E 2646.15'STATE ROAD 29VARIABLE WIDTH RIGHT-OF-WAYSECTIONS 03050-000 & 0308-5200(CORNER TO CORNER)(CORNER TO CORNER)N 89°10'51" E 2646.15' (C)L124L 1 2 5L126L127L128 L129 L1 3 0 L131 L132L133 L134C15 ofRevisionProject Title:6ofSheet No.Prepared for:Dwg. Date:County:Collier County, FloridaPhoto Date:Field Books: 1356 Drawn by:Office No.: 6374191196Checked by:Dwg. Name: 6374191196.DWG09/29/2019BJGRMJ2017Collier County, FloridaLocated inALTA/NSPS Land Title SurveyDatePrepared by:RevisionDateGRAPHIC SCALE 1 inch = 250 ft. (IN FEET)NORTH0 125 250 500 4Altamonte Springs, FL 32701 USA Wood Environment & Infrastructure Solutions, Inc. www.woodplc.com Phone: (407) 522-7570 Certificate of Authorization Number LB-0007932 550 Northlake Boulevard, Suite 1000 FLORIDA POWER & LIGHT700 UNIVERSE BOULEVARDJUNO BEACH, FL 33408BARRON COLLIER - NAPLESSOLAR ENERGY SITELegend: R/W Right of way LB Licensed Business CCR Certified Corner Record L Line C Curve (C)Calculated FPL Florida Power and Light FDOT Florida Department ofTransporation Set Iron Rod with Capmarked " LB 7932" T XXSign Light Pole Telephone Pedestal Power Pole Guy Anchor Barbed Wire Fence Chain Link Fence Overhead WireOU C:\Wood Jobs\FPL State Road 29\AutoCAD Civil 3D\Boundary v2.dwg, 8/7/2020 3:57:54 PM3.A.1.e Packet Pg. 133 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Line TableLine #L1L2L3L4L5L6L7L8L9L10L11L12L13L14L15L16L17L18L19L20DirectionS75°20'01"ES75°55'51"ES73°16'08"EN24°20'38"EN00°11'01"EN65°09'07"WN57°16'10"WN43°09'13"WN27°43'02"WN26°53'04"WN26°53'04"WN29°23'47"WN23°39'31"EN26°18'30"WN60°35'03"WS60°53'17"WS82°21'35"WN85°55'54"WN76°01'53"WN72°44'10"WLength663.02'80.66'59.89'46.79'166.98'354.49'222.58'160.98'223.14'181.96'196.53'172.09'84.45'238.04'32.45'82.09'154.36'100.73'171.69'162.49'Line TableLine #L21L22L23L24L25L26L27L28L29L30L31L32L33L34L35L36L37L38L39L40DirectionN12°10'48"WN01°44'38"WN03°16'14"WN54°58'48"WS66°23'57"WN42°17'26"WN39°29'03"WN40°26'22"WN47°00'34"WN46°28'03"EN51°19'36"ES44°38'05"ES32°07'41"ES26°29'56"ES16°41'39"ES11°15'06"WS51°38'18"EN58°59'56"EN66°50'39"ES58°23'44"ELength34.67'315.28'234.59'141.82'130.52'81.24'183.00'157.67'139.93'124.92'124.92'384.44'185.42'106.41'97.52'64.58'174.02'95.19'102.19'118.23'Line TableLine #L41L42L43L44L45L46L47L48L49L50L51L52L53L54L55L56L57L58L59L60DirectionS49°00'58"ES29°30'33"ES26°48'25"ES21°07'20"ES01°54'46"WS01°54'46"WS28°03'10"ES28°00'26"ES89°48'40"ES66°14'26"ES57°52'50"ES45°37'09"ES31°19'19"ES37°05'37"EN80°36'14"EN88°08'24"ES61°38'14"ES09°59'57"ES11°53'31"ES62°47'07"ELength159.00'210.80'439.41'42.79'15.86'101.19'226.25'99.95'54.82'196.18'294.12'423.70'327.77'60.56'95.15'282.49'207.86'320.20'279.08'77.50'Line TableLine #L61L62L63L64L65L66L67L68L69L70L71L72L73L74L75L76L77L78L79L80DirectionS75°15'51"EN00°38'44"WS51°03'41"WN16°45'04"WN00°37'25"WN00°37'25"WN58°07'50"WN60°58'32"WS74°42'31"WN24°42'10"WN30°15'20"WN40°28'47"WN41°30'42"WN27°09'40"WN47°41'01"WN47°45'02"WS89°17'09"WN14°36'16"WN24°46'59"WN00°59'49"WLength883.29'1864.68'115.91'173.47'48.87'29.69'516.62'54.63'145.11'277.56'132.74'112.93'393.81'812.57'81.72'793.37'787.79'35.37'187.13'421.04'Line TableLine #L81L82L83L84L85L86L87L88L89L90L91L92L93L94L95L96L97L98L99L100DirectionN12°00'51"WN19°15'03"WS78°29'00"WS87°20'35"WN67°17'58"WN58°48'58"WN44°25'54"ES50°21'03"ES31°09'57"ES19°05'08"ES16°02'13"ES17°29'29"ES59°43'57"ES44°57'50"ES78°33'33"EN84°04'34"ES83°57'49"EN07°00'55"EN22°51'25"EN36°27'33"ELength176.45'175.51'173.54'106.34'183.95'208.56'219.41'142.88'146.21'233.59'209.04'227.30'161.60'152.29'63.17'115.72'121.00'74.47'124.02'232.68'Line TableLine #L101L102L103L104L105L106L107L108L109L110L111L112L113L114L115L116L117L118L119L120DirectionN54°53'24"EN64°07'04"EN00°52'43"WN88°54'48"EN88°54'48"EN00°48'36"WN68°23'03"WN54°59'17"WN54°59'17"WS75°46'20"WN88°35'50"WN45°29'35"WN45°32'03"WN31°54'09"WN22°17'55"WN17°37'56"WN48°46'26"EN54°12'46"EN58°31'38"EN85°48'47"ELength274.99'153.09'403.18'115.19'183.21'759.02'64.52'149.10'480.61'374.76'166.43'222.14'351.59'209.90'323.94'138.86'377.70'240.92'134.18'59.56'Line TableLine #L121L122L123L124L125L126L127L128L129L130L131L132L133L134L135L136L137L138L139L140DirectionS83°16'43"EN01°28'07"WN41°08'30"WN02°52'53"WN35°32'28"WN44°57'52"WN85°22'41"WN81°24'25"WN70°36'56"WN57°44'59"WS86°31'53"WS16°13'27"WS89°11'36"WS00°31'26"ES00°38'16"ES00°38'16"ES00°38'16"ES00°38'16"ES79°08'44"ES74°48'48"ELength576.57'734.95'620.76'524.65'248.76'70.03'129.08'85.32'123.88'249.10'262.02'244.98'465.18'761.64'2734.95'2734.05'2738.75'1008.74'207.57'113.82'Line TableLine #L141L142DirectionS07°03'21"WS75°20'01"ELength137.12'2333.17'Curve TableCurve #C1C2C3C4C5C6C7C8C9C10C11C12C13C14C15Length188.36315.47352.52360.46345.44237.80539.57142.73118.01398.28325.71405.5074.90313.10358.50Radius180.15334.58337.03287.61346.99226.62292.21135.93112.22380.90310.99386.0172.07298.99159.87Delta059° 54' 32"054° 01' 23"059° 55' 46"071° 48' 29"057° 02' 26"060° 07' 16"105° 47' 48"060° 09' 32"060° 15' 25"059° 54' 38"060° 00' 27"060° 11' 16"059° 32' 26"060° 00' 00"128° 28' 53"Chord DirectionN03° 11' 40"WN42° 10' 17"WN85° 02' 20"WN04° 19' 28"WS87° 47' 38"ES81° 47' 06"EN65° 09' 57"WN22° 37' 15"WN83° 31' 49"WN62° 32' 13"WN06° 27' 09"WS89° 30' 14"EN57° 25' 32"EN12° 37' 33"EN86° 03' 03"WChord Length179.90303.91336.67337.33331.35227.04466.11136.26112.65380.39311.03387.1171.57298.99287.97of RevisionProject Title: 6of Sheet No. Prepared for: Dwg. Date:County:Collier County, Florida Photo Date:Field Books: 1356 Drawn by:Office No.: 6374191196 Checked by:Dwg. Name: 6374191196.DWG 09/29/2019 BJG RMJ 2017 Collier County, Florida Located in ALTA/NSPS Land Title Survey DatePrepared by:Revision Date 5 Altamonte Springs, FL 32701 USAWood Environment & Infrastructure Solutions, Inc.www.woodplc.comPhone: (407) 522-7570Certificate of Authorization Number LB-0007932550 Northlake Boulevard, Suite 1000FLORIDA POWER & LIGHT 700 UNIVERSE BOULEVARD JUNO BEACH, FL 33408 BARRON COLLIER - NAPLESSOLAR ENERGY SITE C:\Wood Jobs\FPL State Road 29\AutoCAD Civil 3D\Boundary v2.dwg, 8/7/2020 3:58:25 PM 3.A.1.ePacket Pg. 134Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) ofRevisionProject Title:6ofSheet No.Prepared for:Dwg. Date:County:Collier County, FloridaPhoto Date:Field Books: 1356 Drawn by:Office No.: 6374191196Checked by:Dwg. Name: 6374191196.DWG09/29/2019BJGRMJ2017Collier County, FloridaLocated inALTA/NSPS Land Title SurveyDatePrepared by:RevisionDate6Altamonte Springs, FL 32701 USA Wood Environment & Infrastructure Solutions, Inc. www.woodplc.com Phone: (407) 522-7570 Certificate of Authorization Number LB-0007932 550 Northlake Boulevard, Suite 1000 FLORIDA POWER & LIGHT700 UNIVERSE BOULEVARDJUNO BEACH, FL 33408BARRON COLLIER - NAPLESSOLAR ENERGY SITEGRAPHIC SCALE1 inch = 400 ft.(IN FEET)NORTH0200400800Legend:ACRES GROSS ACREAGE =613.98± ACRES GROSS ACREAGE (PER THIS SURVEY)=577.93± ACRES LESS OUT ACREAGE =29.59± ACRES NET ACREAGE =548.34± ACRES = LESS OUT ACREAGE SECTION 4 SECTION 9 SECTION 16 LIMITS OF BOUNDARY SURVEY STATE ROAD 29 STATE ROAD 82SURVEYED BOUNDARY GROSS AREA BOUNDARY (APPROXIMATE TOP OF BANK AS SCALED FROM AERIAL IMAGERY) EAST R/W LINE (SURVEYED BOUNDARY)C:\Wood Jobs\FPL State Road 29\AutoCAD Civil 3D\Boundary v2.dwg, 8/7/2020 3:58:38 PM3.A.1.e Packet Pg. 135 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) CONCEPTUAL SITE PLAN 3.A.1.e Packet Pg. 136 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) X XX X XXX XX XXXXX XXX X XX XXXX X XXXXXXXXXXX XXX X XXXX X XXXXXX X XX X XX X X XX X XX X X XXXX XXX X X X X X XXXX X X X X XXX XX X X X XX X XXXXXXX XXXX X XXXX X X XXX X XX XX XXX XXXXX XXX SOLAR ARRAY DEVELOPMENT AREA EXISTING VEGETATION RIGHT-OF-WAY (ROW) PROJECT BOUNDARY LEGEND NON-DEVELOPED AREAS PRESERVE PROPOSED COLLECTOR YARD PROPOSED FENCE LINE PROPOSED INGRESS/EGRESS PROPOSED GATE LOCATION PROPOSED ACCESS PATH NATIVE VEGETATION IMMOKALEE SOLAR CONDITIONAL USE CONCEPTUAL SITE PLAN REV DATE: 11/13/2020, 12/29/20, 2/9/2021, 3/2/2021, 3/9/2021 STATE ROAD 29STATE R O A D 8 2 HENDRY COUNTY COLLIER COUNTY CR846 CITY OF IMMOKALEE PROJECT LOCATION LOCATION MAP N.T.S. 3300 PGA BLVD, SUITE 780 PALM BEACH GARDENS, FL 33410 PHONE: 561.799.3855 FLORIDA C.O.A. #2822 FLORIDA POWER & LIGHT COMPANY (FPL) 700 UNIVERSE BOULEVARD JUNO BEACH, FL 33408 (561) 691-7001 PROPOSED ELECTRICAL COLLECTOR YARDSR 29SITE INGRESS/ EGRESS STATE ROAD 29 (SR 29)SR 82 NATIVE VEGETATION PROJECT BOUNDARY PROJECT BOUNDARY NO BUFFER REQUIRED *SEE BUFFER NOTE PROPOSED PERIMETER FENCE PROPOSED ACCESS PATH PROPOSED GATE ZONING: A-MHO RLSAO EXISTING LAND USE: AGRICULTURAL/WETLANDS FLU: Agriculture/Rural Mixed Use District and the Rural Lands Stewardship Overlay Area (RLSA) PROPOSED GATE PROPOSED GATE PROPOSED GATE PROPOSED ACCESS PATH PROPOSED ACCESS PATH NO BUFFER REQUIRED *SEE BUFFER NOTE NO BUFFER REQUIRED *SEE BUFFER NOTE NO BUFFER REQUIRED *SEE BUFFER NOTE NO BUFFER REQUIRED *SEE BUFFER NOTE NO BUFFER REQUIRED *SEE BUFFER NOTE ZONING: A-MHO RLSAO EXISTING LAND USE: AGRICULTURAL/WETLANDS FLU: Agriculture/Rural Mixed Use District and the Rural Lands Stewardship Overlay Area (RLSA) ZONING: A-MHO RLSAO EXISTING LAND USE: AGRICULTURAL/WETLANDS FLU: Agriculture/Rural Mixed Use District and the Rural Lands Stewardship Overlay Area (RLSA) ZONING: A-MHO RLSAO EXISTING LAND USE: AGRICULTURAL/WETLANDS FLU: Agriculture/Rural Mixed Use District and the Rural Lands Stewardship Overlay Area (RLSA) NO BUFFER REQUIRED *SEE BUFFER NOTE PROJECT BOUNDARY PROJECT BOUNDARY 200' WIDE FDOT SR 29 ROW ±88' WIDE EXISTING VEGETATION PRESERVE (5.74 ACRES) 25' PRESERVE SETBACK NATIVE VEGETATION NATIVE VEGETATION BUFFER NOTE: 1. NO BUFFER REQUIRED ALONG ALL PROPERTY LINES PER VARIANCE (VA-PL202000002161). 2. SUPPLEMENTAL NATIVE PLANTING CLUSTERS REQUIRED PER SUPPLEMENTARY PLANTING EXHIBIT ATTACHED TO VARIANCE (VA-PL202000002161) ON SR 29. 3.A.1.e Packet Pg. 137 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) RENDERINGS 3.A.1.e Packet Pg. 138 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 139 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 2 3.A.1.e Packet Pg. 140 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) AERIAL LOCATION MAP 3.A.1.e Packet Pg. 141 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) AERIAL MAP PROJECT BOUNDARY 3300 PGA BLVD, SUITE 780 PALM BEACH GARDENS, FL 33410 PHONE: 561.799.3855 FLORIDA C.O.A. #2822 FLORIDA POWER & LIGHT COMPANY (FPL) 700 UNIVERSE BOULEVARD JUNO BEACH, FL 33408 (561) 691-7001 COLLIER COUNTY HENDRY COUNTYSR-29SR-29SR-8 2 846 S R - 2 9 IMMOKALEE REGIONAL AIRPOR T Immokalee Felda S R - 2 9 PARCEL BOUNDARY IMMOKALEE SOLAR CONDITIONAL USE REV DATE: OCT 30, 2020 3.A.1.e Packet Pg. 142 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) ENVIRONMENTAL REPORT 3.A.1.e Packet Pg. 143 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) December 31, 2020 Revised February 9, 2021 Environmental Data Report FPL IMMOKALEE SOLAR ENERGY CENTER IMMOKALEE, COLLIER COUNTY, FLORIDA Section 4, 9, 16, Township 46 South, Range 26 East Prepared for: Florida Power & Light Company 700 Universe Boulevard Juno Beach, FL 33408 Prepared by: Kimley-Horn and Associates, Inc. 655 North Franklin Street, Suite 150 Tampa, Florida 33602 Phone: 813-620-1460 www.kimley-horn.com © Kimley-Horn and Associates, Inc. 2020 Project No. 144196050 3.A.1.e Packet Pg. 144 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) TABLE OF CONTENTS Introduction ............................................................................................................................................. 1 Collier County Land Development Code (LDC) Section 3.08.00 ............................................................... 1 3.08.00.A.2 Applicant Information ........................................................................................................ 1 3.08.00.A.4.A Wetlands ....................................................................................................................... 2 3.08.00.A.4.B Listed Species ............................................................................................................... 2 3.08.00.A.4.C Native Vegetation Preservation ...................................................................................... 3 Collier County LDC Section 4.06.04 ......................................................................................................... 4 4.06.04 – Trees and Vegetation Protection .......................................................................................... 4 Conservation and Coastal Management Element Consistency ................................................................. 5 Policy 6.1.1 .......................................................................................................................................... 5 Policy 7.1 ............................................................................................................................................. 5 TABLES Table 1: Habitat/FLUCFCS Types and Acreage………………………………………………………………….3 ATTACHMENTS Attachment A – Supporting Maps and Graphics Attachment B – Resumes Attachment C – Protected Species Survey Memo 3.A.1.e Packet Pg. 145 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Environmental Data Report Technical Memorandum FPL Immokalee Solar Energy Center Immokalee, Collier County, Florida Introduction Kimley-Horn and Associates, Inc. (Kimley-Horn) was retained on behalf of Florida Power & Light Company to conduct environmental surveys and complete this environmental data report for the approximately 578- acre project site located east of the intersection of State Road 82 and State Road 29 North in Immokalee, Collier County, Florida (referred to herein as the “project site”). The project site is located in Section 4, 9, and 16, Township 46 South and Range 26 East (see Figure 1 – Project Location Map). The proposed development will consist of constructing an approximately 74.5 MW AC solar facility, substation, and associated access/utility roads within the proposed project site. The current land use of the project site consists of an agricultural area with planted orange trees. Access to the project site is located along State Road (SR) 29 North. Supporting maps and graphics including the following are provided in Attachment A. 1) Project Location Map 2) Topographic Map 3) Soils Map 4) FLUCFCS Map 5) National Wetlands Inventory Map 6) Wetlands and Surface Waters Map 7) Site Plan Collier County Land Development Code (LDC) Section 3.08.00 3.08.00.A.2 Applicant Information i. Preparation of Environmental Data. Environmental Data Submittal Requirements shall be prepared by an individual with academic credentials and experience in the area of environmental sciences or natural resource management. Academic credentials and experience shall be a bachelor's or higher degree in one of the biological sciences with at least two years of ecological or biological professional experience in the State of Florida. 3.A.1.e Packet Pg. 146 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Environmental Data has been prepared by Brady Walker, Sarah Johnson, and Stephen Myers, Kimley-Horn and Associates, Inc. environmental scientists. Copies of their resumes are provided in Attachment B. ii.Owner(s)/agent(s) name, address, phone number, and e-mail. Owner:Barron Collier Partnership 2600 Golden Gate Parkway, Suite 200 Naples, FL 34105 Applicant:Florida Power & Light Company 700 Universe Boulevard Juno Beach, FL 33408 3.08.00.A.4.a Wetlands i. Identify on a current aerial, the location and acreage of all Collier County/SFWMD jurisdictional wetlands according to the Florida Land Use Cover and Forms Classification System (FLUCFCS). Ditches are identified in Figure 6. 3.08.00.A.4.b Listed Species i. Provide a wildlife survey for the nests of bald eagle and for listed species known to inhabit biological communities similar to those existing on site. The survey shall be conducted in accordance with the guidelines or recommendations of the Florida Fish and Wildlife Conservation Commission (FFWCC) and the U.S. Fish and Wildlife Service (USFWS). Survey times may be reduced or waived where an initial habitat assessment by the environmental consultant indicates that the likelihood of listed species occurrence is low, as determined by the FFWCC and USFWS. Where an initial habitat assessment by the environmental consultant indicates that the likelihood of listed species occurrence is low, the survey time may be reduced or waived by the County Manager or designee, when the project is not reviewed, or technical assistance not provided by the FFWCC and USFWS. Additional survey time may be required if listed species are discovered. The FPL Immokalee Solar Energy Center Protected Species Survey (PSS) (Attachment C) provides detailed information regarding potential and observed protected species. ii. Provide a survey for listed plants identified in LDC section 3.04.03. A survey for plants listed in Section 3.04.03 is included in the PSS. 3.A.1.e Packet Pg. 147 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.08.00.A.4.c Native Vegetation Preservation i. For sites or portions of sites cleared of native vegetation or in agricultural operation, provide documentation that the parcel(s)were issued a permit to be cleared and are in compliance with the 25-year rezone limitation pursuant to LDC section 10.02.06. For sites permitted to be cleared prior to July 2003, provide documentation that the parcel(s)are in compliance with the 10-year rezone limitation previously identified in the GMP. Criteria defining native vegetation and determining the legality, process and criteria for clearing are found in LDC Chapter 3 and LDC section 10.02.06. The native preservation requirement for the project site was determined to be 40% of existing native vegetation based on the proposed land use of the project. See the Site Plan,Attachment B, for reference to the preservation area location. ii. Identify on a current aerial the acreage, location and community types of all upland and wetland habitats on the project site, according to the Florida Land Use Cover and Forms Classification System (FLUCFCS) and provide a legend for each of the FLUCFCS Codes identified. Aerials and overlay information must be legible at the scale provided. Provide calculations for the acreage of native vegetation required to be retained on-site. A Florida Land Use Cover and Forms Classification System (FLUCFCS) map has been included at a scale of one-inch equals one hundred feet (1" = 100') for the property and overlain on a 2018 digital aerial photograph. The Aerial Photograph and FLUCFCS Map are included in Attachment B.Table 1 provides a summary of the habitat types found within the project site. Table 1: Habitat/FLUCFCS Types and Acreage FLUCFCS Description Acreage 221 Citrus Grove 546.7 310 Herbaceous 6.9 428* Cabbage Palm 4.0 511 Agricultural Ditches 12.0 618* Willow and Elderberry 0.6 641* Freshwater Marshes 7.8 The following is a description of the seven (7) FLUCFCS types identified within the project site. The below descriptions of the upland land cover types characterize dominant vegetation observed along representative pedestrian transects and does not represent an all-inclusive vegetative inventory. * Denotes Native Vegetation Habitats 3.A.1.e Packet Pg. 148 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) FLUCFCS 221 – Citrus Groves (546.7± ac.) Within the project site, this classification consists of active orange grove operations. The majority of the project site consists of this land use category. The orange trees appear to be in mostly good health and have minimal understory growth. FLUCFCS 310 – Herbaceous (6.9± ac.) This classification includes a small area on the western edge of the site consisting of upland prairie grasses such as wire grass (Aristida stricta) and other sedges and rushes. FLUCFCS 428 – Cabbage Palm (4.0± ac.) This classification includes a large stand of cabbage palm (Sabal palmetto) in the north east section of the project site. Understory vegetation includes Brazilian pepper (Schinus terebinthifolia) and guava (Psidium guajava). Groundcover consists of hammock fern (Blechnum occidentale), sword fern (Nephrolepis exaltata), caesarweed, greenbriar (Smilax sp.), muscadine (Vitus rotundifolia), and Spanish needles. FLUCFCS 511 – Agricultural Ditches (12.0± ac.) This classification includes the excavated agricultural ditches found throughout the property and utilized for the orange grove operations. Vegetation within the ditches consists of Peruvian primrose-willow (Ludwigia peruviana), water lettuce (Pistia stratiotes), maidencane (Panicum hemitomon), caesarweed, and cattail (Typha latifolia). FLUCFCS 618 – Willow and Elderberry (0.6± ac.) Within the western edge of the project site, this designation classifies a small area of wetland that is dominated by Carolina willow (Salix caroliniana.). FLUCFCS 641 – Freshwater Marshes (7.8± ac.) Two areas on the western edge of the site fall under this designation. They consist of typical marsh vegetation such as maidencane (Panicum hemitomon), spike rush (Eleocharis interstincta) and cordgrass (Spartina bakeri). Collier County LDC Section 4.06.04 4.06.04 – Trees and Vegetation Protection All vegetation clearing activities will be in accordance with the approved Site Development Permit (SDP) only after a Vegetation Removal Permit has been obtained through Collier County. 3.A.1.e Packet Pg. 149 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Conservation and Coastal Management Element Consistency Policy 6.1.1 The project site includes approximately 12.4 acres of native vegetation that includes greater than 25% canopy cover. Section 3.05.07 of the LDC requires the retention of 40% of native vegetation communities resulting in the preservation of 5.74 acres, which equates to 46%. See the Site Plan, Sheet 5 of Attachment B, for reference to the preservation area location. Policy 7.1 A PSS has been completed for the project site and is attached as Attachment C. Based on the PSS, no impacts to protected species are anticipated to occur as a result of the proposed project. 3.A.1.e Packet Pg. 150 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) ATTACHMENT A SUPPORTING MAPS AND GRAPHICS 3.A.1.e Packet Pg. 151 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) FIGURE 1 Legend Project Site Project Location Map 1 inch = 2,000 feet ¹K:\WPB_DevServices\144196050 - Barron Collier Solar\ENV\GIS\MXD\Fig 1 - Location Map.mxd0 2,0001,000 Feet Collier County JANUARY 2021 Project Site © 2020 Kimley-Horn and Associates, Inc.1920 Wekiva Way, STE 200, West Palm Beach, FL 33411Phone (561) 845-0665 www.kimley-horn.com PROJECT NUMBER:144196050 FPL Immokalee Solar Energy CenterCollier County, FL 3.A.1.e Packet Pg. 152 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) © 2020 Kimley-Horn and Associates, Inc.1920 Wekiva Way, STE 200, West Palm Beach, FL 33411Phone (561) 845-0665 www.kimley-horn.com FPL Immokalee Solar Energy CenterCollier County, FL PROJECT NUMBER:144196050 JANUARY 2021 FIGURE 2 Legend Project Site USGS 7.5 Minute Quadrangle Map 1 inch = 1,341 feetK:\WPB_DevServices\144196050 - Barron Collier Solar\ENV\GIS\MXD\Fig 2 - USGS Map.mxdSource: ESRI 0 1,500 Feet ¹3.A.1.e Packet Pg. 153 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) © 2020 Kimley-Horn and Associates, Inc.1920 Wekiva Way, STE 200, West Palm Beach, FL 33411Phone (561) 845-0665 www.kimley-horn.com FPL Immokalee Solar Energy CenterCollier County, FL PROJECT NUMBER:144196050 JANUARY 2021 FIGURE 3 27 16 16 27 22 16 16 22 22 31 27 22 22 22 22 31 31 22 22 22 22 22 22 22 22 22 22 22 22 22 Legend Project SiteNRCS Soil Descriptions & Hydric Rating: 16: OLDSMAR FINE SAND, 0 TO 2 PERCENT SLOPES: NO 22: CHOBEE, WINDER, AND GATOR SOILS, DEPRESSIONAL: YES 27: HOLOPAW FINE SAND, 0 TO 2 PERCENT SLOPES: YES 31: HILOLO, JUPITER, AND MARGATE FINE SANDS: YES NRCS Soils Map 1 inch = 1,500 feetK:\WPB_DevServices\144196050 - Barron Collier Solar\ENV\GIS\MXD\Fig 3 - Soils Map.mxdSource: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN and the GIS User Community 0 1,500 Feet ¹3.A.1.e Packet Pg. 154 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) © 2020 Kimley-Horn and Associates, Inc.1920 Wekiva Way, STE 200, West Palm Beach, FL 33411Phone (561) 845-0665 www.kimley-horn.com FPL Immokalee Solar Energy CenterCollier County, FL PROJECT NUMBER:144196050 JANUARY 2021 FIGURE 4 221 511 310 641 428 641 511 511 511 511 511 618 511 Legend Project SiteFLUCFCS Descriptions: 221: CITRUS GROVES (546.70 ac) 310: HERBACEOUS (6.90 ac) 428: CABBAGE PALM (4.00 ac)* 511: AGRICULTURAL DITCHES (12.00 ac) 618: WILLOW AND ELDERBERRY (0.60 ac)* 641: FRESHWATER MARSHES (7.80 ac)* Florida Land Use, Cover, and Forms Classification System Map 1 inch = 1,667 feetK:\WPB_DevServices\144196050 - Barron Collier Solar\ENV\GIS\MXD\Fig 4 - FLUCFCS Map.mxdSource: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN and the GIS User Community 0 2,000 Feet ¹ * Represents Native Vegetation. 3.A.1.e Packet Pg. 155 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) © 2020 Kimley-Horn and Associates, Inc.1920 Wekiva Way, STE 200, West Palm Beach, FL 33411Phone (561) 845-0665 www.kimley-horn.com FPL Immokalee Solar Energy CenterCollier County, FL PROJECT NUMBER:144196050 JANUARY 2021 FIGURE 5 Legend Project SiteWetland Type: FRESHWATER EMERGENT WETLAND FRESHWATER FORESTED/SHRUB WETLAND FRESHWATER POND RIVERINE National Wetlands Inventory (NWI) Map 1 inch = 1,667 feetK:\WPB_DevServices\144196050 - Barron Collier Solar\ENV\GIS\MXD\Fig 5 - NWI Map.mxdSource: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN and the GIS User Community 0 1,500 Feet ¹3.A.1.e Packet Pg. 156 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) © 2020 Kimley-Horn and Associates, Inc.1920 Wekiva Way, STE 200, West Palm Beach, FL 33411Phone (561) 845-0665 www.kimley-horn.com FPL Immokalee Solar Energy CenterCollier County, FL PROJECT NUMBER:144196050 JANUARY 2021 FIGURE 6 Ditch G Ditch E Ditch C Ditch A Ditch F Ditch B Ditch D Legend Project Site Ditch Features (12.06 ac.) Wetlands (8.40 ac.) Wetland and Surface Waters Map 1 inch = 1,250 feetK:\WPB_DevServices\144196050 - Barron Collier Solar\ENV\GIS\MXD\Fig 6 - Wetland Map.mxdSource: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN and the GIS User Community 0 1,500 Feet ¹3.A.1.e Packet Pg. 157 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) © 2020 Kimley-Horn and Associates, Inc.1920 Wekiva Way, STE 200, West Palm Beach, FL 33411Phone (561) 845-0665 www.kimley-horn.com FPL Immokalee Solar Energy CenterCollier County, FL PROJECT NUMBER:144196050 OCTOBER 2020 FIGURE 7 Legend Project Site Fence Roads Plan Areas & Panels Site Plan Overlay 1 in = 0 milesK:\WPB_DevServices\144196050 - Barron Collier Solar\ENV\GIS\MXD\Fig 13 - Plans.mxdSource: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN and the GIS User Community 0 1,500 Feet ¹3.A.1.e Packet Pg. 158 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) ATTACHMENT B RESUMES 3.A.1.e Packet Pg. 159 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) SPECIAL QUALIFICATIONS »Has 15 years of extensive experience managing and conducting public and private sector projects, biological assessments, GIS, photointerpretation, and related studies »Experienced in environmental assessment, mitigation plans, project management, wetland and protected species surveys, and state and federal permitting »Authorized Gopher Tortoise Agent »Knowledgeable of the NEPA process and PD&E guidelines used for development of transportation projects by FDOT P ROFESSIONAL CREDENTIALS »Master of Science, Zoology, University of Oklahoma, 2004 »Bachelor of Science, Zoology, Ohio Wesleyan University, 2000 »Gopher Tortoise Authorized Agent, FWC, #GTA-18-00041A »FWC Approved Florida Manatee Observer »USFWS Approved Crested Caracara Observer »FDEP Stormwater Management Inspector, #23835 Stormwater Management Inspector »&HUWL¿HG(FRORJLVW(6$ RE LEVANT EXPERIENCE SR 659 (Combee Road) PD&E Study from US 98 to Skyview Drive, FDOT District One — Environmental scientist providing evaluation of roadway alternatives with respect to wetland and protected species involvement and documentation of findings in NEPA Natural Resources Evaluation report. Kimley-Horn is performing a PD&E study to prepare design alternatives for the corridor that accommodate pedestrians and bicycles, improve transit faculties, and optimize vehicle access. The study team will analyze and assess the project’s impact on the social, economic, cultural, natural, and physical environment to develop the location and design concept acceptance (LDCA) of the project in accordance with FDOT policy, procedures, and requirements. Environmental tasks included habitat assessment, wetland quality assessment, potential protected species involvement, Natural Resource Evaluation report, Pond Siting Report, and alternatives analysis evaluation for wetland and protected species. Apollo Beach Boulevard Extension/I-75 Flyover, Hillsborough County, FL Environmental scientist for the Kimley-Horn team designing the extension of Apollo Beach Boulevard from US 41 to Paseo al Mar Boulevard that will result in a 4-lane facility including the bridge over I-75 to the eastern limits of the conservation easement or approach tie-down. Environmental tasks include SWFWMD and USACE permitting, ZHWODQGGHOLQHDWLRQSUHSDULQJPLWLJDWLRQSODQVFRQVHUYDWLRQHDVHPHQWPRGL¿FDWLRQ and coordination with multiple agencies. Extending Apollo Beach from US 41 to US 301 ZLOOVHUYHDVDQDOWHUQDWLYHHDVWZHVWFRQQHFWLRQXOWLPDWHO\UHGXFLQJWUDI¿FGHPDQGV RQ%LJ%HQG5RDG7KLVZRUNHIIRUWLQFOXGHVDOLJQPHQWDQGWUDI¿FVWXGLHV VXUYH\LQJ JHRWHFKQLFDOH[SORUDWLRQWHVWLQJDQGDQDO\VLV SUHSDULQJHQJLQHHULQJUHSRUWV with right-of-way maps and environmental documentation incorporating roadway, VWRUPZDWHUGHWHQWLRQDQGZHWODQGPLWLJDWLRQUHTXLUHPHQWV SHUPLWWLQJUHTXLUHPHQWV and determination of right-of-way requirements. Central Florida Expressway Authority (CFX) Concept, Feasibility and Mobility Studies for Osceola County Expressway Authority (OCX) Master Plan Projects Environmental scientist providing protected species surveys and NEPA documentation RI¿QGLQJVLQWKH1DWXUDO5HVRXUFHV(YDOXDWLRQUHSRUW.LPOH\+RUQFRQGXFWHGD Concept, Feasibility and Mobility Study for this planned expressway which widens the existing Poinciana Parkway and extends it to I-4. Existing environmental and SK\VLFDOFRQVWUDLQWVZHUHLGHQWL¿HGZKLFKLQFOXGHGPLWLJDWLRQEDQNVFHPHWHULHVDQG extensive utilities. Alternative alignments were developed to minimize impacts and these alternatives are currently being evaluated. Due to development, a cemetery and utility constraints, a critical factor for determining feasibility of the expressway is LWVLQWHUFKDQJHFRQQHFWLRQWR, WKHUHIRUHLQWHUFKDQJHFRQFHSWVZHUHGHYHORSHG to determine the feasibility of tying into I-4 at two different locations. Extensive stakeholder meetings and coordination occurred with property owners, utilities, developers, local governments, FDOT and Florida’s Turnpike. Protected species surveys were required including crested caracara nest surveys. SR 93/I-75 at US 301 Interchange, FDOT District One — The project consists of the widening of this segment of I-75 from four to six lanes, including the design of two bridges over the Manatee River, and the development of a stormwater management system to address water quality concerns. As the lead environmental scientist for Sarah Johnson Environmental Scientist 3.A.1.e Packet Pg. 160 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Sarah Johnson Relevant Experience Continued this project, was responsible for the assessment of the project area for the presence of federal and/or state listed protected species, determination of wetland jurisdictional boundaries using federal and state guidelines, a quantitative assessment of the wetlands using the Unified Mitigation Assessment Method (UMAM), preparing documentation for a US Coast Guard permit, SWFWMD Environmental Resource Permit. General Environmental Services, Environmental Management Office, FDOT District One — As assistant project manager on WKLVSURMHFWWDVNVLQFOXGHGHYDOXDWLRQRIERWKQRQPDMRUVWDWHDQGIHGHUDOO\IXQGHGSURMHFWV LQFOXGLQJ/$3IXQGV SURYLGLQJ(OHFWURQLF Review Comments for minor projects in design phase for environmental involvement including wetlands, protected species, Section I FRQWDPLQDWLRQDQGFXOWXUDOUHVRXUFHV FRPSOHWLQJWKHHQYLURQPHQWDOFHUWLILFDWLRQVIRUPLQRUSURMHFWV ERWK7\SH&(DQG NMSAs) including the status of environmental certification, environmental checklist, environmental memo, applicable permits, cultural UHVRXUFHFRRUGLQDWLRQ6HFWLRQ I GHWHUPLQDWLRQRIDIIHFWDQGFRQWDPLQDWLRQDVVHVVPHQW XSORDGLQJWKHHQYLURQPHQWDOFHUWLILFDWLRQ GRFXPHQWDWLRQZLWKLQWKH6:(37GDWDEDVH DQGFRPSOHWLQJVSHFLHVVSHFLILFVXUYH\VIRUWKHFUHVWHGFDUDFDUDEDOGHDJOHJRSKHU tortoise, burrowing owls, sand skinks, and osprey. Other tasks included assisting with project re- evaluations, coordinating with construction project managers, providing staging area clearances, and developing protected species determination keys for minor project involvement. SR 70 from Jefferson Avenue to CR 29 PD&E, FDOT District One — Environmental scientist. This project involved development of the NEPA document and support documents for the widening of an approximately 7.5-mile section of SR 70 in Highlands County. Project alternatives included the widening of the existing roadway from two to four lanes, as well as operational improvements to the two-lane section. Specific tasks included the oversight of data collection, development and review of environmental documents, and coordination with federal and state regulatory and review agencies. Key issues included impacts to multiple federal and state protected species, public lands (4(f) properties), private research facilities, and extensive utilities. Environmental documents developed for the project included wetlands, protected species, hazardous materials, drainage, noise and archaeological/historical reports, as well as the NEPA document developed for FHWA and FDOT. Central Polk Parkway PD&E Study, FDOT District One — Deputy project manager who verified land use within the alternatives, surveyed for protected species and their habitat, provided coordination and oversight of the entire field work effort, coordinated with agencies, and assisted with report writing and graphics. This project involved an impact analysis for a new roadway alignment from I-4 to SR 60 and from Polk Parkway to SR 60. The total project involved approximately 50 miles of new roadway alignments within Polk County. Central Polk Parkway from SR 35 to Pollard Road Design, Polk County, FL — Assistant project manager responsible for the permitting of the construction of an approximately 10-mile section of the Central Polk Parkway in Polk County. The project consists of the construction of a new four lane roadway, including the design of eleven bridges over multiple channels, and the development of a stormwater management system to address water quality concerns. Specific tasks included the assessment of the project area for the presence of federal and/or state listed protected species, determination of wetland jurisdictional boundaries using federal and state guidelines, a quantitative assessment of existing wetland values and wetland values lost using the Unified Mitigation Assessment Method (UMAM). Wetland impacts exceeded 90 acres and the project required species specific surveys and the assessment of impacts for six federal and state listed species. Additional tasks include obtaining US Army Corps of Engineers 404 dredge and fill permit, Florida Department of Environmental Protection National Pollutant Discharge Elimination System permit, and Southwest Florida Water Management District Environmental Resource Permit. US 27 PD&E Study (from I-4 to US 192), FDOT District One — Environmental scientist who participated in extensive wildlife surveys that specifically included scrub jays, sand skinks, and gopher tortoises as well as assisting with the report writing and creating graphics for the reports. This project involved an impact analysis and study of design alternatives for the widening of 8 miles of a rapidly developing segment of US 27 from four to six lanes. Environmental concerns included protected scrub species such as the sand skink and gopher tortoise. SR 60 PD&E from CR 630 to Kissimmee River Bridge Widening, FDOT District One — Assistant project manager/environmental scientist. Tasks included assessment of wetland involvement for alignment alternatives, reviewed area for protected species potential and involvement, compilation of PD&E documents, and coordination with various agencies. 3.A.1.e Packet Pg. 161 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 2VFHROD%UHYDUG&RQQHFWRU)HDVLELOLW\6WXG\2VFHRODDQG%UHYDUG&RXQWLHV)/² (QYLURQPHQWDO6FLHQWLVWUHVSRQVLEOHIRUGHYHORSLQJHQYLURQPHQWDOVXSSRUWGRFXPHQWV IRUWKH2%&&)HDVLELOLW\6WXG\ 3ULYDWH 6HFWRU 'XH 'LOLJHQFH 5HSRUWV +LOOVERURXJK DQG %UHYDUG &RXQWLHV )/² (QYLURQPHQWDOVFLHQWLVWUHVSRQVLEOHIRUWKHSUHOLPLQDU\HQYLURQPHQWDOGXHGLOLJHQFH DVVHVVPHQWRIWKUHHFRPPHUFLDOLQGXVWULDOVLWHV 0XWLIDPLO\5HVLGHQWLDO'RFN3HUPLWWLQJ3DVFR&RXQW\)/²(QYLURQPHQWDOVFLHQWLVW UHVSRQVLEOHIRUWKHSHUPLWWLQJRIWKHLQVWDOODWLRQRIDQDSSUR[LPDWHO\VTIWGRFN RQDSULYDWHIUHVKZDWHUSRQGLQ3DVFR&RXQW\ 3ULYDWH 6HFWRU 1DWXUDO 5HVRXUFH $VVHVVPHQW +LOOVERURXJK &RXQW\ )/² (QYLURQPHQWDOVFLHQWLVWUHVSRQVLEOHIRUWKHSUHOLPLQDU\QDWXUDOUHVRXUFHDVVHVVPHQW RIDFRPPHUFLDOGHYHORSPHQWVLWHV Silicon Ranch Craig Farms Solar Project, Adams County, CO — Project manager responsible for the pre-development environmental assessment of the 1,100 acre Craig Farms Solar Project including wetland delineations, protected species surveys, a Phase I ESA, and a comprehensive permitting matrix. Pacificorp Sagebrush Habitat Enhancement and Restoration Project, Carbon County, WY — Project manager responsible for the establishment and creation of an Implementation Plan for sagebrush habitat enhancement at the 1,800-acre Hanna Mine Arch Coal Reclamation Area in Hanna, WY, in support of PacifiCorp’s desire to provide compensatory mitigation of sage grouse impacts due to the construction of the Gateway West transmission line. Well Pad NEPA Permitting, Crook County, WY — Project manager responsible for the establishment and creation of environmental documents such as the NEPA environmental assessment, SUPO, stormwater pollution prevention plan, and environmental resource permits for an oil well on split estate property (BLM mineral/ private surface). SH 119 Reconstruction, Boulder County, CO — Project manager responsible for managing the survey and mapping of protected species and their habitats for the reconstruction of SH 119 through Boulder Canyon. Parkside Village Residential Mixed-Use Complex, Denver, CO — Project manager responsible for the establishment and creation of environmental documents such as stormwater management plans, environmental site assessments, and environmental permits. Responsible for holding stakeholder meetings with clients, subcontractors, and regulatory officials. 65 IURP -HIIHUVRQ $YHQXH WR &5 3' ( +LJKODQGV &RXQW\ )/ ² (QYLURQPHQWDOVFLHQWLVWUHVSRQVLEOHIRUWKHVXUYH\DQGPDSSLQJRIH[LVWLQJODQGXVH SURWHFWHGVSHFLHVDQGWKHLUKDELWDWVRIDQDSSUR[LPDWHO\PLOHVHJPHQWLQFOXGLQJ HYDOXDWLQJLPSURYHPHQWVWRWKH65LQWHUVHFWLRQDW86 SPECIAL QUALIFICATIONS »+DVPRUHWKDQILYH\HDUVRIH[SHULHQFH conducting environmental investigations for public and private sector projects »Experienced in environmental assessments, mitigation planning, project management, wetland and protected species surveys, and state and federal permitting P ROFESSIONAL CREDENTIALS »Master of Science Ecological Restoration, University of Florida, In Progress »Bachelor of Science, Natural Resource Conservation, University of Florida, 2015 »Pace University, Desktop GIS &HUWLILFDWLRQ »OPEC, Safeland Training, 2018 »Plan-it Geo, GIS Mapping for Urban Forests, 2018 »OSHA, 10 Hour Construction Industry Safety Training, 2017 »FWC, Gopher Tortoise Agent - Survey and Excavation, 2017 »CAGC, Erosion and Sediment Control Inspector Training, 2017 »FDEP, Erosion and Sediment Control Inspector Training, 2016 »FSCC, Hydric Soils Workshop, 2016 Stephen Myers Environmental Scientist RELEVANT EXPERIENCE 3.A.1.e Packet Pg. 162 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Stephen Myers Relevant Experience Continued SR 50 Bypass from Buck Hope Road to Jefferson Street (Design), Hernando County, FL — Environmental scientist responsible for the survey and mapping of protected species and their habitats of an approximately 2-mile bypass of SR 50 in Hernando County. SR 40 from East of CR 314 to CR 314A (Design), Marion County, FL — Environmental scientist responsible for the permitting of the widening of an approximately six-mile segment of SR 40 through the Ocala National Forest in Marion County. The project consists of widening this segment of roadway from two to four lanes. Specific tasks included the assessment of the project area for the presence of federal and/or state listed protected species including MBTA listed species, determination of wetland jurisdictional boundaries using federal and state guidelines, and the development of construction guidelines for protection of existing on-site protected species, including a sand skink survey. SR 56 Extension from Meadow Pointe Boulevard to US 301 (Design/Build), Pasco County, FL — Environmental scientist responsible for the establishment and mapping of wetland jurisdictional boundaries of an approximately 8-mile extension of SR 56 in Pasco County. US 92 from County Line Road to Wabash Road (PD&E). Polk County, FL — Environmental scientist responsible for developing environmental documents such as the protected species biological assessment and wetlands evaluation report. This project involved an impact analysis and study of design alternatives for the widening of 4 miles of US 92 from two lanes to four lanes. Key issues include impacts to multiple federal and state protected species and wetlands. 3.A.1.e Packet Pg. 163 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) !! ! "# $ % ! # $# ! " # "#"$%& "#’ #!""’# ! # $( ) #* $+"#( ) # ! # *$ ( ) ###$ " & ’ (! !)’# * +% !# #( )’# ,,#-./0,". # * & 1 # "$’,#-./-2/" 3"## ,,4$5"!####66 ’6" # " " " " 76 76# # "7$ ,-.)!" !&!% / %!# %# #""+85! $ " " ! 9$ / %& 0 11, ’! 2# /# ###/: ! #;<:=;<//.$5#!#" >"*! #"*** #*!**# # "!" *"! "$ " $ /!!! & * /3 $ ! (! !# /!!!# $5># "’#)# ?$ ! +<"4+?$ 456 )/@# ’ ’#"! + #" ’ " " > + 66 / 0#* * *? )’ =/ ,# ,? -=. 9% 5+< ;$%5 // .? 3.A.1.e Packet Pg. 164 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) ’!(" !&! ! &’"7!##$# ##**$"+ + <# +< + ? # +? "*"*"#$ $/ ’7"’7!#*7#0"?4"&)+ #""#0"?<2=#</1 </1=$5’"# "*# *"*!*$5>#" !"’$#> " * # +<0? 44 -$ 5 > # * $ $"87&" !% ! !%& 8*!! !%! !# 7	 #"#/1. .#"""#$ ##"+?-$ 3&#"" !%! " !7"’7!:&!% ! !%#!#!!’ !7!’ &# "" !%!#3 ( ) 7#>#2 #$"-# $ 3.A.1.e Packet Pg. 165 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) ATTACHMENT C PROTECTED SPECIES SURVEY 3.A.1.e Packet Pg. 166 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) December 31, 2020 Protected Species Survey Memorandum FPL IMMOKALEE SOLAR ENERGY CENTER IMMOKALEE, COLLIER COUNTY, FLORIDA Section 4, 9, 16, Township 46 South, Range 26 East Prepared for: Florida Power & Light Company 700 Universe Boulevard Juno Beach, FL 33408 Prepared by: Kimley-Horn and Associates, Inc. 655 North Franklin Street, Suite 150 Tampa, Florida 33602 Phone: 813-620-1460 www.kimley-horn.com © Kimley-Horn and Associates, Inc. 2020 Project No. 144196050 3.A.1.e Packet Pg. 167 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) i Table of Contents 1.0 Introduction .................................................................................................................................. 1 2.0 Historic Conditions ....................................................................................................................... 4 3.0 Existing Conditions....................................................................................................................... 8 4.0 Survey Methodology .................................................................................................................. 12 5.0 Results/Discussion ..................................................................................................................... 16 6.0 Summary ................................................................................................................................... 23 7.0 References ................................................................................................................................ 24 Figures Figure 1 Project Location Map………………………………………………………….….……………………….2 Figure 2 Transect Map………………………………………………………….….………………………………..3 Figure 3 Historic Aerials………………………………………………………………………...…….…………..5-7 Figure 4 NRCS Soils Map…………………………………………………………….…………………………….9 Figure 5 Florida Land Use, Cover, and Forms Classification System (FLUCFCS) Map…………………...10 Figure 6 Protected Species Map………………………………………………………………………………….14 Figure 7 Protected Species Survey Observation Map……………………………………….……..……….…16 Tables Table 3-1 FLUCFCS Descriptions and Acreages……………………………………………….……………….8 Table 4-1 Protected Species with the Potential to Occur Within the Project Site……………………………13 Table 4-2 Dates, Times, Conditions, and Purpose of Field Surveys………………………………………….16 Table 5-1 Protected Species Survey Results……………………………………………………………………16 Table 5-2 Non-Listed Wildlife Observed within the Project Site……………………………………….………16 Table 5-3 Conversion from FLUCFCS Codes to USFWS Land Cover Types…………………….…………18 Table 5-4 PHU Impact Calculations………………………………………………………………………………18 Appendices Appendix A – FNAI and IPAC Report Appendix B – Standard Protection Measures for the Eastern Indigo Snake Appendix C – Pre-Application Meeting Environmental Notes Appendix D – Resumes 3.A.1.e Packet Pg. 168 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Page 1 1.0 INTRODUCTION Kimley-Horn and Associates, Inc. (Kimley-Horn) was retained on behalf of Florida Power & Light Company to conduct a Protected Species Survey (PSS) for the approximately 578-acre project site located east of the intersection of State Road 82 and State Road 29 North in Immokalee, Collier County, Florida (referred to herein as the “project site”). The project site is located in Section 4, 9, and 16, Township 46 South and Range 26 East (see Figure 1 – Project Location Map). The proposed development will consist of constructing an approximately 74.5 MW AC solar facility, substation, and associated access/utility roads within the proposed project site. The current land use of the project site consists of an agricultural area with planted orange trees. Access to the project site is located along State Road (SR) 29 North. Kimley-Horn biologists conducted a PSS of the project site on August 4, 2020. Pedestrian and vehicular transects were established to cover suitable habitat within the project site (Figure 2). The purpose of the survey was to identify and document the presence of plant or wildlife species listed by the U.S. Fish and Wildlife Service (USFWS) and Florida Fish and Wildlife Conservation Commission (FWC) as endangered, threatened, species of special concern, or commercially exploited (referred to herein as the “protected species”). This report represents the results of the PSS prepared in accordance with Collier County and FWC approved methods for conducting protected species surveys. 3.A.1.e Packet Pg. 169 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) FIGURE 1 Legend Project Site Project Location Map 1 inch = 2,000 feet ¹K:\WPB_DevServices\144196050 - Barron Collier Solar\ENV\GIS\MXD\Fig 1 - Location Map.mxd0 2,0001,000 Feet Collier County JANUARY 2021 Project Site © 2020 Kimley-Horn and Associates, Inc.1920 Wekiva Way, STE 200, West Palm Beach, FL 33411Phone (561) 845-0665 www.kimley-horn.com PROJECT NUMBER:144196050 FPL Immokalee Solar Energy CenterCollier County, FL 3.A.1.e Packet Pg. 170 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) © 2020 Kimley-Horn and Associates, Inc.1920 Wekiva Way, STE 200, West Palm Beach, FL 33411Phone (561) 845-0665 www.kimley-horn.com FPL Immokalee Solar Energy CenterCollier County, FL PROJECT NUMBER:144196050 JANUARY 2021 FIGURE 2 Legend Project Site Transect Hatch Protected Species Survey Transect Map 1 inch = 1,667 feetK:\WPB_DevServices\144196050 - Barron Collier Solar\ENV\GIS\MXD\Fig 12 - Transect Map.mxdSource: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN and the GIS User Community 0 1,500 Feet ¹3.A.1.e Packet Pg. 171 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Page 4 2.0 HISTORIC CONDITIONS Based on the data gathered from historic aerials (1953, 1963, and 1980), vegetative habitats historically occurring onsite consisted of herbaceous, wet prairie, cabbage palm, and freshwater marsh. Agricultural use of the project site occurred as early as 1953, with intense modification and ditching occurring between 1963 and 1980. Historic aerials of the project site are provided in Figure 3A, 3B, and 3C. 3.A.1.e Packet Pg. 172 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) © 2020 Kimley-Horn and Associates, Inc.1920 Wekiva Way, STE 200, West Palm Beach, FL 33411Phone (561) 845-0665 www.kimley-horn.com FPL Immokalee Solar Energy CenterCollier County, FL PROJECT NUMBER:144196050 OCTOBER 2020 FIGURE 3A Legend Project Site Historic Aerial Map (1953) 1 inch = 1,500 feetK:\WPB_DevServices\144196050 - Barron Collier Solar\ENV\GIS\MXD\Fig X - Hist Aerial.mxdSource: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN and the GIS User Community 0 1,500 Feet ¹3.A.1.e Packet Pg. 173 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) © 2020 Kimley-Horn and Associates, Inc.1920 Wekiva Way, STE 200, West Palm Beach, FL 33411Phone (561) 845-0665 www.kimley-horn.com FPL Immokalee Solar Energy CenterCollier County, FL PROJECT NUMBER:144196050 OCTOBER 2020 FIGURE 3B Legend Project Site Historic Aerial Map (1963) 1 inch = 1,500 feetK:\WPB_DevServices\144196050 - Barron Collier Solar\ENV\GIS\MXD\Fig X - Hist Aerial.mxdSource: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN and the GIS User Community 0 1,500 Feet ¹3.A.1.e Packet Pg. 174 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) © 2020 Kimley-Horn and Associates, Inc.1920 Wekiva Way, STE 200, West Palm Beach, FL 33411Phone (561) 845-0665 www.kimley-horn.com FPL Immokalee Solar Energy CenterCollier County, FL PROJECT NUMBER:144196050 OCTOBER 2020 FIGURE 3C Legend Project Site Historic Aerial Map (1980) 1 inch = 1,500 feetK:\WPB_DevServices\144196050 - Barron Collier Solar\ENV\GIS\MXD\Fig X - Hist Aerial.mxdSource: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN and the GIS User Community 0 1,500 Feet ¹3.A.1.e Packet Pg. 175 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Page 8 3.0 EXISTING CONDITIONS Based on the data gathered during the site visit, vegetative habitats occurring onsite were classified into their respective land use and land cover type. Based on the observed habitats, anticipated species determinations were made with regard to potential protected species occurrence in each habitat type. The land use and land cover types within the approximately 578-acre project site were delineated using Collier County 2018 digital aerial photographs, Natural Resources Conservation Service (NRCS) Soil Survey Maps for Collier County (Figure 4), and field observations. The habitat types were classified according to Level III of the Florida Land Use, Cover and Forms Classification System (FLUCFCS) (Florida Department of Transportation (FDOT), 1999). The resulting FLUCFCS map is provided in Figure 5. The approximate acreages for the various land use within the project site can be found in Table 3-1 and a brief description of each is included below. Table 3-1 FLUCFCS Descriptions and Acreages FLUCFCS Description Acreage Federal Status FLUCFCS 221 – Citrus Groves (546.7 ac.) Within the project site, this classification consists of active orange grove operations. The majority of the project site consists of this land use category. The orange trees appear to be in mostly good health and have minimal understory growth. FLUCFCS 310 – Herbaceous (6.9 ac.) This classification includes a small area on the western edge of the site consisting of upland prairie grasses such as wire grass (Aristida stricta) and other sedges and rushes. FLUCFCS 428 – Cabbage Palm (4.0 ac.) This classification includes a large stand of cabbage palm (Sabal palmetto) in the north east section of the project site. Understory vegetation includes Brazilian pepper (Schinus terebinthifolia) and guava (Psidium guajava). Groundcover consists of hammock fern (Blechnum occidentale), sword fern (Nephrolepis exaltata), caesarweed, greenbriar (Smilax sp.), muscadine (Vitus rotundifolia), and Spanish needles. State Status 221 Citrus Groves 546.7 Upland Upland 310 Herbaceous 6.9 Upland Upland 428* Cabbage Palm 4.0 Upland Upland 510x Streams and Waterways (Excavated) 12.0 Wetland Wetland 617* Mixed Wetland Hardwoods 0.6 Wetland Wetland 641* Freshwater Marshes 7.8 Wetland Wetland Total 578 * Denotes Native Vegetation Habitat 3.A.1.e Packet Pg. 176 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Page 9 FLUCFCS 511 – Agricultural Ditches (12.0 ac.) This classification includes the excavated agricultural ditches found throughout the property and utilized for the orange grove operations. Vegetation within the ditches consists of Peruvian primrose-willow (Ludwigia peruviana), water lettuce (Pistia stratiotes), maidencane (Panicum hemitomon), caesarweed, and cattail (Typha latifolia). FLUCFCS 618 – Willow and Elderberry (0.6 ac.) Within the western edge of the project site, this designation classifies a small area of wetland that is dominated by Carolina willow (Salix caroliniana). FLUCFCS 641 – Freshwater Marshes (7.8 ac.) Two areas on the western edge of the site fall under this designation. They consist of typical marsh vegetation such as maidencane (Panicum hemitomon), spike rush (Eleocharis interstincta) and cordgrass (Spartina bakeri). 3.A.1.e Packet Pg. 177 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) © 2020 Kimley-Horn and Associates, Inc.1920 Wekiva Way, STE 200, West Palm Beach, FL 33411Phone (561) 845-0665 www.kimley-horn.com FPL Immokalee Solar Energy CenterCollier County, FL PROJECT NUMBER:144196050 JANUARY 2021 FIGURE 4 27 16 16 27 22 16 16 22 22 31 27 22 22 22 22 31 31 22 22 22 22 22 22 22 22 22 22 22 22 22 Legend Project SiteNRCS Soil Descriptions & Hydric Rating: 16: OLDSMAR FINE SAND, 0 TO 2 PERCENT SLOPES: NO 22: CHOBEE, WINDER, AND GATOR SOILS, DEPRESSIONAL: YES 27: HOLOPAW FINE SAND, 0 TO 2 PERCENT SLOPES: YES 31: HILOLO, JUPITER, AND MARGATE FINE SANDS: YES NRCS Soils Map 1 inch = 1,500 feetK:\WPB_DevServices\144196050 - Barron Collier Solar\ENV\GIS\MXD\Fig 3 - Soils Map.mxdSource: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN and the GIS User Community 0 1,500 Feet ¹3.A.1.e Packet Pg. 178 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) © 2020 Kimley-Horn and Associates, Inc.1920 Wekiva Way, STE 200, West Palm Beach, FL 33411Phone (561) 845-0665 www.kimley-horn.com FPL Immokalee Solar Energy CenterCollier County, FL PROJECT NUMBER:144196050 JANUARY 2021 FIGURE 5 221 511 310 641 428 641 511 511 511 511 511 618 511 Legend Project SiteFLUCFCS Descriptions: 221: CITRUS GROVES (546.70 ac) 310: HERBACEOUS (6.90 ac) 428: CABBAGE PALM (4.00 ac)* 511: AGRICULTURAL DITCHES (12.00 ac) 618: WILLOW AND ELDERBERRY (0.60 ac)* 641: FRESHWATER MARSHES (7.80 ac)* Florida Land Use, Cover, and Forms Classification System Map 1 inch = 1,667 feetK:\WPB_DevServices\144196050 - Barron Collier Solar\ENV\GIS\MXD\Fig 4 - FLUCFCS Map.mxdSource: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN and the GIS User Community 0 2,000 Feet ¹ * Represents Native Vegetation. 3.A.1.e Packet Pg. 179 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Page 12 4.0 SURVEY METHODOLOGY The PSS included field surveys and a literature review. Literature review sources included Florida’s Endangered Species, Threatened Species and Species of Special Concern (FWC, 2017), Florida Natural Areas Inventory (FNAI) Biodiversity Matrix (Appendix A), USFWS Environmental Conservation Online System (ECOS) Information, Planning and Consultation (IPAC) system (Appendix A), as well as the Collier County Land Development Code. Based on the literature review and available suitable habitat, a compilation of federal and state protected species with the potential to occur within the project site was developed. The project site is located within the USFWS consultation areas for the Florida panther (Puma concolor coryi), Florida bonneted bat (Eumops floridanus), Florida grasshopper sparrow (Ammodramus savannarum floridanus), Florida scrub-jay (Aphelocoma coerulescens), Audubon’s crested caracara (Caracara cheriway), and Everglade snail kite (Rostrhamus sociabilis plumbeus); however, there is no suitable habitat within the project site for the Florida grasshopper sparrow or the Florida scrub-jay. The project site is also located within the USFWS secondary zone for the Florida panther (Figure 6). The project site is located within the core foraging areas (CFA) for the wood stork (Mycteria americana) colonies listed below; however, no wood stork nests were observed within the project site or vicinity during the PSS. · Okaloacoochee Slough · Sadie Cypress · Collier – Hendry · Barron Collier · Corkscrew Table 4-1 lists federal and state protected species with the potential to occur within the project site. This table provides a review of protected species with the potential to occur within the project site, based on documented occurrences of protected species available from the previously mentioned agencies. The potential for occurrence for each species was designated as Low, Moderate, or High based on the type of habitat present within the project site, its relative condition, and if the species has been previously documented or was observed in the project site. A Low rating indicates that minimal/suboptimal habitat for that species was found within the project site, but the species has not been documented within the project site. A Moderate rating indicates that suitable habitat exists, and the species has been documented within one mile of the project site. A High rating indicates that suitable habitat exists, and the species was observed during field reviews. Species with no suitable habitat within the project site are not included in the table below. 3.A.1.e Packet Pg. 180 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Page 13 Table 4-1 Protected Species with the Potential to Occur Within the Project Site Common Name Scientific Name Status Preferred Habitat Potential for Occurrence Mammals Florida bonneted bat Eumops floridanus FE Roosts in palms and hollow trees and in buildings. Forages high in air over natural as well as human-altered landscapes. Low Florida panther Puma concolor coryi FE Requires extensive blocks of mostly forested communities. Large wetlands that are generally inaccessible to humans are important for diurnal refuge. Moderate Big Cypress fox squirrel Sciurus niger avicennia ST Forested habitats with open to moderately dense understory and shrub cover. Low Florida black bear Ursus americanus floridanus NL*Wide variety of forested communities. Low Birds Audubon’s crested caracara Caracara cheriway FT Open country such as dry prairie and pasture lands with scattered cabbage palm, cabbage palm/live oak hammocks, and shallow ponds and sloughs. Cabbage palms or live oaks with low-growing surrounding vegetation are required for nesting. Moderate Wood stork Mycteria americana FT Shallow water in freshwater marshes, swamps, lagoons, ponds, tidal creeks, flooded pastures and ditches. Low Everglade snail kite Rostrhamus sociabilis plumbeus FE Large open freshwater marshes and lakes with shallow water, and a low density of emergent vegetation are preferred foraging habitat. Nests usually over water in a low tree or shrub. Moderate Florida sandhill crane Antigone canadensis pratensis ST Prairies, freshwater marshes, and pasture lands. Low Florida burrowing owl Athene cunicularia floridana ST Areas of short, herbaceous groundcover; including prairies, sandhills, and farmland. Low Little blue heron Egretta caerulea ST Freshwater marshes, coastal beaches, mangrove swamps, cypress swamps, hardwood swamps, wet prairies and bay swamps. Low Tricolored heron Egretta tricolor ST Freshwater marshes, coastal beaches, mangrove swamps, cypress swamps, hardwood High 3.A.1.e Packet Pg. 181 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Page 14 swamps, wet prairies and bay swamps. Southeastern American kestrel Falco sparverius paulus ST Found in open pine habitats, woodland edges, prairies, and pastures throughout much of Florida. Low Roseate spoonbill Platalea ajaja ST Freshwater marshes, coastal beaches, mangrove swamps, cypress swamps, hardwood swamps, wet prairies and bay swamps. Low Bald Eagle Haliaeetus leucocephalus NL**Large open water bodies, saltwater marshes, dry prairies, mixed pine, hardwood forests, wet prairies, marshes, pine flatwoods, and sandhills. Low Reptiles American alligator Alligator mississippiensis S/A - T Freshwater lakes, slow moving rivers, and brackish water habitats High Eastern indigo snake Drymarchon couperi FT Mesic flatwoods, upland pine forests, swamps, wet prairies, xeric pinelands, and scrub habitats. Low Gopher tortoise Gopherus polyphemus ST Typically found in dry upland habitats including sandhills, scrub, xeric oak hammock, and dry pine flatwoods; also commonly uses disturbed habitats such as pastures, old fields, and road shoulders Low Legend: S – State of Florida; F – Federal; T – Threatened; E – Endangered; S/A – Similarity in Appearance; NL – Not Listed; * - Protected under the Florida Black Bear Conservation Rule (F.A.C. 68A-4.009) ** - Protected under the Bald and Golden Eagle Protection Act 3.A.1.e Packet Pg. 182 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) © 2020 Kimley-Horn and Associates, Inc.1920 Wekiva Way, STE 200, West Palm Beach, FL 33411Phone (561) 845-0665 www.kimley-horn.com FPL Immokalee Solar Energy CenterCollier County, FL PROJECT NUMBER:144196050 JANUARY 2021 FIGURE 6 # # # # # # ## # # # # # # # # # # # ## # # # # # # # # # # # # ### # # # ### # ## # # # # # # ## # # # # # # # # # # # # # # # # # # # # # # # # # # # # ## # # ## ## # # # # # # ## # # ## # # # # # # # # # # # # # # # # # # # # # ## # # # # ## # ## # # # # # # # ## # # # Legend Project SiteUSFWS Panther Data Primary Habitat Zone Secondary Habitat Zone #Panther Telemetry USFWS Protected Species Map 1 in = 1 milesK:\WPB_DevServices\144196050 - Barron Collier Solar\ENV\GIS\MXD\Fig 10 - Protected Species Map (panther).mxdSource: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN and the GIS User Community 0 1 Miles ¹3.A.1.e Packet Pg. 183 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Page 16 Protected species field surveys were conducted utilizing pedestrian and vehicular transects. Transects were performed in all habitat types (FLUCFCS) and the distances between transects were established to cover each habitat type within the project site.Table 4-2 lists the times and weather conditions during the field survey. Table 4-2 Dates, Times, Conditions, and Purpose of Field Surveys Date Time Weather Conditions Purpose Staff 8/4/20 10:00 a.m. - 1:00 p.m. Sunny. Temperature mid 90s F. Winds NNW 5-10 mph Site Recon/ PSS Survey BW & SM BW – Brady Walker; SM – Stephen Myers 5.0 RESULTS/DISCUSSION Table 5-1 summarizes the findings of the PSS performed for the project site. Non-listed species were also observed during the PSS and are outlined in Table 5-2. The Protected Species Survey Map is provided as Figure 7. Table 5-1 Protected Species Survey Results Common Name Scientific Name Present During Survey Absent During Survey Mammals Florida bonneted bat Eumops floridanus X Florida panther Puma concolor coryi X Big Cypress fox squirrel Sciurus niger avicennia X Florida black bear Ursus americanus floridanus X Birds Audubon’s crested caracara Caracara cheriway X Wood stork Mycteria americana X Everglade snail kite Rostrhamus sociabilis plumbeus X Florida sandhill crane Antigone canadensis pratensis X Florida burrowing owl Athene cunicularia floridana X Little blue heron Egretta caerulea X Tricolored heron Egretta tricolor X Southeastern American kestrel Falco sparverius paulus X Roseate spoonbill Platalea ajaja X Bald Eagle Haliaeetus leucocephalus X Reptiles American alligator Alligator mississippiensis X Eastern indigo snake Drymarchon couperi X Gopher tortoise Gopherus polyphemus X Table 5-2 Non-Listed Wildlife Observed within the Project Site Common Name Scientific Name Observation Red-tailed hawk Buteo jamaicensis Perched Black vulture Coragyps atratus Soaring Swallow-tailed kite Elanoides forficatus Foraging Mourning dove Zenaida macroura Perched 3.A.1.e Packet Pg. 184 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) © 2020 Kimley-Horn and Associates, Inc.1920 Wekiva Way, STE 200, West Palm Beach, FL 33411Phone (561) 845-0665 www.kimley-horn.com FPL Immokalee Solar Energy CenterCollier County, FL PROJECT NUMBER:144196050 JANUARY 2021 FIGURE 7 [® [] LegendProtected Species Observed within/nearby the Project Site []American Alligator (Alligator mississippiensis) [®Tricolored Heron (Egretta tricolor) Project Site Protected Species Survey Observation Map 1 inch = 1,500 feetK:\WPB_DevServices\144196050 - Barron Collier Solar\ENV\GIS\MXD\Fig 11 - Species observation Map.mxdSource: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN and the GIS User Community 0 1,500 Feet ¹3.A.1.e Packet Pg. 185 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Page 18 Florida bonneted bat (Eumops floridanus) The Florida bonneted bat (FBB) is listed as Endangered by USFWS and FWC. FBB is the largest species of bat in Florida. Although little is known about the habitat preferences of the FBB, evidence indicates that open freshwater and wetland habitats provide prime foraging areas. Roost sites have been observed in artificial bat boxes, roof tiles, and within woodpecker cavities in pines with an open midstory. The project site is within the USFWS Consultation Area for the FBB. Suitable foraging and roosting habitat for the species is present within the project site; however, no individuals were observed during the PSS and coordination with USFWS is ongoing. It is anticipated that the project will have no adverse effect on the Florida bonneted bat. Florida panther (Puma concolor coryi) The Florida panther is listed as endangered by USFWS and FWC. The Florida panther is a large brown cat with a long tail. The panther inhabits large forested communities and large wetlands away from development for diurnal refuge (FNAI 2001). Suitable foraging habitat for the species is present within the project site; however, no individuals were observed during the PSS. While the project site is located within the USFWS consultation area and secondary zone for the Florida panther, converting orange grove and disturbed land into solar development increases the Panther Habitat Unit (PHU) land use score from 4.7 to 4.9, respectively. With this data, it is anticipated that the project will have no adverse effect on the Florida panther. Table 5-3 Conversion from FLUCFCS Codes to USFWS Land Cover Types FLUCFCS Code Description Acreage USFWS Land Cover Type PHU Habitat Value 221 Citrus Groves 546.7 Orchard/Grove 4.7 310 Herbaceous 6.9 Dry Prairie 6.3 Table 5-4 PHU Impact Calculations FLUCFCS Code USFWS Land Cover Type Panther Habitat Zone Acreage PHU Habitat Value Pre- Development PHUs Post- Development USFWS Land Cover Type PHU Habitat Value Post- Development PHUs PHU Change Secondary 6.9 6.3 43.5 Solar 4.9 33.8 -9.7 221 Orchard/Grove Secondary 546.7 4.7 2,569.5 Solar 4.9 2,678.8 +109.3 310 Herbaceous Total +99.6 3.A.1.e Packet Pg. 186 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Page 19 Big Cypress fox squirrel (Sciurus niger avicennia) The Big Cypress fox squirrel (BCFS) is listed by FWC as threatened; it is not listed by USFWS. Preferred BCFS habitat consists of pine flatwoods, mixed hardwood-pine forest, and cypress swamp, with low growing ground cover. BCFS are known to use several habitat types for foraging, including golf courses, pastures with scattered trees and rural residential areas with wooded lots (Florida Committee on Rare and Endangered Plants and Animals – FCREPA 1992). BCFS build platform nests in slash pines and hardwoods (i.e. oak), and moss and stick nests in cypress and tops of cabbage palms. Suitable foraging and nesting habitat for the species is present within the project site; however, no individuals were observed during the PSS. It is anticipated that the project will have no adverse effect on the Big Cypress fox squirrel. Florida black bear (Ursus americanus floridanus) Although the black bear is no longer federal or state-listed, it is afforded protection under the Florida Black Bear Conservation Rule (F.A.C. 68A-4.009). The Florida black bear utilizes a wide variety of forested communities needed to support its varied seasonal diet of black bears. Forested wetlands and baygalls (bayheads) are particularly important for diurnal cover and denning for the bear. Suitable foraging habitat for the species is present within the project site; however, no individuals were observed during the PSS. It is unlikely the black bear would utilize the project site for denning purposes. It is anticipated that the project will have no adverse effect on the Florida black bear. Audubon’s crested caracara (Caracara cheriway) The Audubon’s crested caracara is listed as threatened by USFWS and FWC. Preferred caracara habitat consists of open country, including dry prairie and pasture lands with cabbage palm, cabbage palm/live oak hammocks, and shallow ponds and sloughs. Caracaras prefer to nest in cabbage palms, followed by live oaks. The project site is within the USFWS designated Consultation Area for the caracara. Suitable foraging and nesting habitat for the species is present within the project site and the species was documented within the project site during a separate due diligence event in the fall of 2019; however, no individuals were observed during the PSS and there are no documented nests within 1500-meters of the project site. Pre- construction avian surveys are planned for spring 2021 to confirm presence/absence of listed species and nests within the project site and immediate vicinity. It is anticipated that the project will have no adverse effect on the crested caracara. Wood stork (Mycteria americana) The wood stork is listed as threatened by USFWS and FWC. Wood storks forage in shallow water in freshwater marshes, swamps, lagoons, ponds, tidal creeks, flooded pastures and ditches, where they are attracted to falling water levels that concentrate food sources. Colonial nesting occurs in a variety of inundated forested wetland types including cypress strands, cypress domes, mixed hardwood swamps, 3.A.1.e Packet Pg. 187 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Page 20 sloughs, and mangroves. Suitable foraging habitat for the species is present within the project site; however, no individuals were observed during the PSS. No impacts to on-site wetlands are anticipated as a result of project construction. Therefore, it is anticipated that the project will have no adverse effect on the wood stork. Everglade snail kite (Rostrhamus sociabilis plumbeus) The Everglade snail kite is listed as Endangered by USFWS and FWC. Preferred snail kite habitat consists of large, open freshwater marshes and lakes with shallow water, < 4 ft. deep, and a low density of emergent vegetation. Snail kites are dependent upon apple snails (Pomacea paludosa) caught near the water’s surface. The snail kite usually nests over water in a low trees or shrubs such as willow, wax myrtle, pond apple, or buttonbush, but also in non-woody vegetation like cattail or sawgrass. The project site is within the USFWS Consultation Area for the snail kite. Marginal suitable foraging habitat for the species is present within the project site and the species was documented within the project site during a separate due diligence event in the fall of 2019; however, no suitable nesting habitat occurs within the project site and no individuals were observed during the PSS. No impacts to on-site wetlands are anticipated as a result of project construction. Pre-construction avian surveys are planned for spring 2021 to confirm presence/absence of nests within the project site and immediate vicinity. Therefore, it is anticipated that the project will have no adverse effect on the snail kite. Florida sandhill crane (Antigone canadensis pratensis) The Florida sandhill crane is listed by FWC as threatened; it is not listed by USFWS. The Florida sandhill crane prefers shallow freshwater marshes, pastures and open woods habitats for foraging. Nests can be found on the ground in marshy areas. Suitable foraging habitat for the species is present within the project site; however, no individuals were observed during the PSS. No impacts to on-site wetlands are anticipated as a result of project construction. Pre-construction avian surveys are planned for spring 2021 to confirm presence/absence of nests within the project site and immediate vicinity. Therefore, it is anticipated that the project will have no adverse effect on the Florida sandhill crane. Florida burrowing owl (Athene cunicularia floridana) The Florida burrowing owl is listed by FWC as threatened; it is not listed by USFWS. The Florida burrowing owl crane prefers high, sparsely vegetated, sandy ground. Natural habitats include dry prairie and sandhill. This owl makes use of ruderal areas such as pastures, airports, ball fields, parks, school grounds, university campuses, road rights-of-way, and vacant spaces in residential areas. Marginal suitable foraging habitat for the species is present within the project site; however, no individuals were observed during the PSS. It is anticipated that the project will have no adverse effect on the Florida burrowing owl. 3.A.1.e Packet Pg. 188 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Page 21 Little blue heron (Egretta caerulea) The little blue heron is listed by FWC as threatened; it is not listed by USFWS. The little blue heron forages in shallow marine, brackish, or freshwater areas, including tidal ponds, sloughs, marshes, and human- created impoundments. It nests in colonies in woody shrubs that are separated from land by open water. Suitable foraging habitat for the species is present within the project site; however, no individuals were observed during the PSS. No impacts to on-site wetlands are anticipated as a result of project construction. Therefore, it is anticipated that the project will have no adverse effect on the little blue heron. Tricolored heron (Egretta tricolor) The tricolored heron is listed by FWC as threatened; it is not listed by USFWS. The tricolored heron prefers both fresh- and saltwater habitats such as fresh- and saltwater marshes and mudflats, brackish marshes, coastal beaches, mangrove swamps, hardwood and cypress swamps, and wet prairies. Suitable foraging habitat for the species is present within the project site and one individual was observed during the PSS. No impacts to on-site wetlands are anticipated as a result of project construction. Therefore, it is anticipated that the project will have no adverse effect on the tricolored heron. Southeastern American kestrel (Falco sparverius paulus) The southeastern American kestrel is listed by FWC as threatened; it is not listed by USFWS. Preferred kestrel habitat consists of open pine habitats, woodland edges, prairies, and pastures throughout much of Florida. Nest sites are typically found in tall dead trees or utility poles generally with an unobstructed view of surroundings. Suitable foraging habitat for the species is present within the project site; however, no individuals were observed during the PSS. It is anticipated that the project will have no adverse effect on the Southeast American kestrel. Roseate spoonbill (Platalea ajaja) The roseate spoonbill is listed by FWC as Threatened; it is not listed by USFWS. The spoonbill prefers freshwater mudflats and marshes, saltwater marshes, coastal flats, mangrove swamps, lagoons, wet prairies, and ditches for feeding. Suitable foraging habitat for the species is present within the project site; however, no individuals were observed during the PSS. No impacts to on-site wetlands are anticipated as a result of project construction. Therefore, it is anticipated that the project will have no adverse effect on the roseate spoonbill. Bald eagle (Haliaeetus leucocephalus) Although the bald eagle is no longer a listed species, it is afforded protection in accordance with the Bald and Golden Eagle Protection Act and the Migratory Bird Treaty Act. USFWS has established a standard 660-foot secondary and 330-foot primary protection zone around active bald eagle nests (USFWS 2007). 3.A.1.e Packet Pg. 189 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Page 22 Based on the FWC bald eagle nest locator (https://www.arcgis.com/apps/webappviewer/index.html?id=253604118279431984e8bc3ebf1cc8e9, site accessed October 5, 2020). No active bald eagle nests were documented on or within 660 feet of the project site. The closest documented active nest is CO034, located approximately 4.5 miles southeast of the project site. This distance exceeds any protection zones for bald eagle nests. Suitable foraging habitat for the species is present within the project site; however, no suitable nesting habitat is present within the project site and no individuals were observed during the PSS. Pre-construction avian surveys are planned for spring 2021 to confirm presence/absence of nests within the project site and immediate vicinity. Therefore, it is anticipated that the project will have no adverse effect on the bald eagle. American alligator (Alligator mississippiensis) The American alligator is listed as threatened by USFWS and FWC due to similarity of appearance to the American crocodile (Crocodylus acutus). Alligators thrive in a wide variety of wetland habitats including streams, ponds, lakes, freshwater marshes, and even ditches. Suitable habitat for the species is present within the project site and one individual was observed during the PSS. No impacts to on-site wetlands are anticipated as a result of project construction. Therefore, it is anticipated that the project will have no adverse effect on the American alligator. Eastern indigo snake (Drymarchon corais couperi) The eastern indigo snake is listed as threatened by USFWS and FWC. Eastern indigo snakes utilize a variety of habitat types including: pine flatwoods, scrub areas, hydric pine flatwoods, wet and dry prairies, agricultural fields, coastal hardwood hammocks, mangrove areas and even human altered areas (USFWS 1999). This species will use gopher tortoise and armadillo burrows as underground refugia as well as natural ground holes, hollows at the base of trees, ground litter, and debris piles. Steiner et al. (1983) suggest that eastern indigo snakes in south Florida prefer hammock type environments and pine forests. Suitable habitat for the species is present within the project site; however, no individuals were observed during the PSS. Standard Protection Measures for the Eastern Indigo Snake (USFWS, 2017 –Appendix B) will be utilized during site preparation and construction of the project. As a result, it is anticipated that the project will have no adverse effect on the eastern indigo snake. Gopher tortoise (Gopherus polyphemus) Gopher tortoises are listed as Threatened by FWC and as a candidate species for federal listing under the Endangered Species Act (ESA) by USFWS. Gopher tortoises are most often found on well-drained sandy soils in upland habitats with low-growing herbs. Suitable habitat for the species was documented within the project site during a 15% burrow survey; however, no gopher tortoises or burrows were observed during the burrow survey or PSS. Therefore, it is anticipated that the project will have no adverse effect on the gopher tortoise. 3.A.1.e Packet Pg. 190 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Page 23 Protected Plant Species There were no protected plant species documented or observed within the project site. 6.0 SUMMARY Kimley-Horn has reviewed available data regarding known occurrences of state or federally listed wildlife and plant species on and near the project site, conducted protected species surveys onsite to record observations or signs of protected species, and assessed presence of potential suitable habitat for protected species. Coordination with USFWS is ongoing regarding federal listed species. While federal and state protected species have been documented and/or observed on site and within one (1) mile of the project site, construction of the project is likely to have little, if any, disturbance on species utilization of the habitats within the project site. No impacts to on-site wetlands are anticipated as a result of project construction and wildlife friendly fencing will be utilized where feasible following construction. Pervious area will remain throughout the site, and existing vegetation will be preserved where feasible. Post-construction planting efforts will aid in recruiting new vegetation to disturbed areas. Based on the PSS, no impacts to protected species are anticipated to occur as a result of the proposed project. 3.A.1.e Packet Pg. 191 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Page 24 7.0 REFERENCES Florida Committee on Rare and Endangered Plants and Animals. 1992. Rare and Endangered Biota of Florida. Volume I. Mammals. Gainesville, Florida. 392 pp. Florida Department of Transportation. 1999. Florida Land Use, Cover and Forms Classification System. Procedure No. 550-010-001-a. Third Edition. Tallahassee, Florida. Florida Fish and Wildlife Conservation Commission. 2011. Supplemental Information for the Big Cypress Fox Squirrel Biological Status Review Report. Tallahassee, Florida. Florida Fish and Wildlife Conservation Commission. 2020. Bald Eagle Nest Locator. https://public.myfwc.com/FWRI/EagleNests/nestlocator.aspx (Site accessed Oct 2, 2020) Florida Fish and Wildlife Conservation Commission. 2020. Imperiled Species Management Plan. https://myfwc.com/wildlifehabitats/wildlife/plan/ (Site accessed Oct 6, 2020) Florida Fish and Wildlife Conservation Commission. 2017. Gopher Tortoise Permitting Guidelines. Tallahassee, Florida. Florida Natural Areas Inventory. Biodiversity Matrix Query Results. https://www.fnai.org/BiodiversityMatrix/index.html (Site accessed Oct 2, 2020) Natural Resources Conservation Service. Soil Survey of Collier County, Florida. U.S. Department of Agriculture, Washington, D.C. Steiner, T.M., O.L. Bass, Jr., and J.A. Kushlan. 1983. Status of the eastern indigo snake in southern Florida National Parks and vicinity. South Florida Research Center Report SFRC-83/01, Everglades National Park; Homestead, Florida. University of Florida Digital Collections. Aerial Photography: Florida.https://ufdc.ufl.edu/aerials (Site accessed Oct 12, 2020) U.S. Fish and Wildlife Service Information for Planning and Conservation, Environmental Conservation Online System. 2020. http://ecos.fws.gov/ipac/gettingStarted/index (Site accessed Oct 2, 2020) U.S. Fish and Wildlife Service. 2007. National Bald Eagle Management Guidelines. 23 pp. U. S. Fish and Wildlife Service. 1999. South Florida Multi-Species Recovery Plan. Atlanta, Georgia. 2172 pp. 3.A.1.e Packet Pg. 192 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 193 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 194 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 195 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 196 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 197 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 198 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 199 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 200 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 201 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 202 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 203 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 204 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 205 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 206 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 207 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 208 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 209 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 210 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 211 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 212 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 213 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) STANDARD PROTECTION MEASURES FOR THE EASTERN INDIGO SNAKE U.S. Fish and Wildlife Service August 12, 2013 The eastern indigo snake protection/education plan (Plan) below has been developed by the U.S. Fish and Wildlife Service (USFWS) in Florida for use by applicants and their construction personnel. At least 30 days prior to any clearing/land alteration activities, the applicant shall notify the appropriate USFWS Field Office via e-mail that the Plan will be implemented as described below (North Florida Field Office:jaxregs@fws.gov; South Florida Field Office: verobeach@fws.gov; Panama City Field Office:panamacity@fws.gov). As long as the signatory of the e-mail certifies compliance with the below Plan (including use of the attached poster and brochure), no further written confirmation or “approval” from the USFWS is needed and the applicant may move forward with the project. If the applicant decides to use an eastern indigo snake protection/education plan other than the approved Plan below, written confirmation or “approval” from the USFWS that the plan is adequate must be obtained. At least 30 days prior to any clearing/land alteration activities, the applicant shall submit their unique plan for review and approval. The USFWS will respond via e- mail, typically within 30 days of receiving the plan, either concurring that the plan is adequate or requesting additional information. A concurrence e-mail from the appropriate USFWS Field Office will fulfill approval requirements. The Plan materials should consist of: 1) a combination of posters and pamphlets (see Poster Information section below); and 2) verbal educational instructions to construction personnel by supervisory or management personnel before any clearing/land alteration activities are initiated (see Pre-Construction Activities and During Construction Activities sections below). POSTER INFORMATION Posters with the following information shall be placed at strategic locations on the construction site and along any proposed access roads (a final poster for Plan compliance, to be printed on 11” x 17” or larger paper and laminated, is attached): DESCRIPTION: The eastern indigo snake is one of the largest non-venomous snakes in North America, with individuals often reaching up to 8 feet in length. They derive their name from the glossy, blue-black color of their scales above and uniformly slate blue below. Frequently, they have orange to coral reddish coloration in the throat area, yet some specimens have been reported to only have cream coloration on the throat. These snakes are not typically aggressive and will attempt to crawl away when disturbed. Though indigo snakes rarely bite, they should NOT be handled. SIMILAR SNAKES:The black racer is the only other solid black snake resembling the eastern indigo snake. However, black racers have a white or cream chin, thinner bodies, and WILL BITE if handled. LIFE HISTORY:The eastern indigo snake occurs in a wide variety of terrestrial habitat types throughout Florida. Although they have a preference for uplands, they also utilize some wetlands 1 3.A.1.e Packet Pg. 214 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) and agricultural areas. Eastern indigo snakes will often seek shelter inside gopher tortoise burrows and other below- and above-ground refugia, such as other animal burrows, stumps, roots, and debris piles. Females may lay from 4 - 12 white eggs as early as April through June, with young hatching in late July through October. PROTECTION UNDER FEDERAL AND STATE LAW:The eastern indigo snake is classified as a Threatened species by both the USFWS and the Florida Fish and Wildlife Conservation Commission. “Taking” of eastern indigo snakes is prohibited by the Endangered Species Act without a permit. “Take” is defined by the USFWS as an attempt to kill, harm, harass, pursue, hunt, shoot, wound, trap, capture, collect, or engage in any such conduct. Penalties include a maximum fine of $25,000 for civil violations and up to $50,000 and/or imprisonment for criminal offenses, if convicted. Only individuals currently authorized through an issued Incidental Take Statement in association with a USFWS Biological Opinion, or by a Section 10(a)(1)(A) permit issued by the USFWS, to handle an eastern indigo snake are allowed to do so. IF YOU SEE A LIVE EASTERN INDIGO SNAKE ON THE SITE: Cease clearing activities and allow the live eastern indigo snake sufficient time to move away from the site without interference; Personnel must NOT attempt to touch or handle snake due to protected status. Take photographs of the snake, if possible, for identification and documentation purposes. Immediately notify supervisor or the applicant’s designated agent,and the appropriate USFWS office, with the location information and condition of the snake. If the snake is located in a vicinity where continuation of the clearing or construction activities will cause harm to the snake, the activities must halt until such time that a representative of the USFWS returns the call (within one day) with further guidance as to when activities may resume. IF YOU SEE A DEAD EASTERN INDIGO SNAKE ON THE SITE: Cease clearing activities and immediately notify supervisor or the applicant’s designated agent,and the appropriate USFWS office, with the location information and condition of the snake. Take photographs of the snake, if possible, for identification and documentation purposes. Thoroughly soak the dead snake in water and then freeze the specimen. The appropriate wildlife agency will retrieve the dead snake. Telephone numbers of USFWS Florida Field Offices to be contacted if a live or dead eastern indigo snake is encountered: North Florida Field Office – (904) 731-3336 Panama City Field Office – (850) 769-0552 South Florida Field Office – (772) 562-3909 2 3.A.1.e Packet Pg. 215 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) PRE-CONSTRUCTION ACTIVITIES 1. The applicant or designated agent will post educational posters in the construction office and throughout the construction site, including any access roads. The posters must be clearly visible to all construction staff. A sample poster is attached. 2. Prior to the onset of construction activities, the applicant/designated agent will conduct a meeting with all construction staff (annually for multi-year projects) to discuss identification of the snake, its protected status, what to do if a snake is observed within the project area, and applicable penalties that may be imposed if state and/or federal regulations are violated. An educational brochure including color photographs of the snake will be given to each staff member in attendance and additional copies will be provided to the construction superintendent to make available in the onsite construction office (a final brochure for Plan compliance, to be printed double-sided on 8.5” x 11” paper and then properly folded, is attached). Photos of eastern indigo snakes may be accessed on USFWS and/or FWC websites. 3. Construction staff will be informed that in the event that an eastern indigo snake (live or dead) is observed on the project site during construction activities, all such activities are to cease until the established procedures are implemented according to the Plan, which includes notification of the appropriate USFWS Field Office. The contact information for the USFWS is provided on the referenced posters and brochures. DURING CONSTRUCTION ACTIVITIES 1. During initial site clearing activities, an onsite observer may be utilized to determine whether habitat conditions suggest a reasonable probability of an eastern indigo snake sighting (example: discovery of snake sheds, tracks, lots of refugia and cavities present in the area of clearing activities, and presence of gopher tortoises and burrows). 2. If an eastern indigo snake is discovered during gopher tortoise relocation activities (i.e. burrow excavation), the USFWS shall be contacted within one business day to obtain further guidance which may result in further project consultation. 3. Periodically during construction activities, the applicant’s designated agent should visit the project area to observe the condition of the posters and Plan materials, and replace them as needed. Construction personnel should be reminded of the instructions (above) as to what is expected if any eastern indigo snakes are seen. POST CONSTRUCTION ACTIVITIES Whether or not eastern indigo snakes are observed during construction activities, a monitoring report should be submitted to the appropriate USFWS Field Office within 60 days of project completion. The report can be sent electronically to the appropriate USFWS e-mail address listed on page one of this Plan. 3 3.A.1.e Packet Pg. 216 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) IF YOU SEE A LIVE EASTERNINDIGO SNAKE ON THE SITE:•Cease clearing activities and allowthe eastern indigo snake sufficienttime to move away from the sitewithout interference.•Personnel must NOT attempt totouch or handle snake due toprotected status.•Take photographs of the snake, ifpossible, for identification anddocumentation purposes.•Immediately notify supervisor or theapplicant’s designated agent,andtheappropriate U.S. Fish and WildlifeService (USFWS) office, with thelocation information and condition ofthe snake.•If the snake is located in a vicinitywhere continuation of the clearing orconstruction activities will causeharm to the snake, the activities musthalt until such time that arepresentative of the USFWS returnsthe call (within one day) with furtherguidance as to when activities mayresume.IF YOU SEE A DEAD EASTERNINDIGO SNAKE ON THE SITE:•Cease clearing activities andimmediately notify supervisor or theapplicant’s designated agent,andtheappropriate USFWS office, with thelocation information and condition ofthe snake.•Take photographs of the snake, ifpossible, for identification anddocumentation purposes.•Thoroughly soak the dead snake inwater and then freeze the specimen.The appropriate wildlife agency willretrieve the dead snake.USFWS Florida Field Offices to becontacted if a live or dead eastern indigosnake is encountered:North Florida ES Office – (904) 731-3336Panama City ES Office – (850) 769-0552South Florida ES Office – (772) 562-3909DESCRIPTION: The eastern indigo snake isone of the largest non-venomous snakes in NorthAmerica, with individuals often reaching up to 8feet in length. They derive their name from theglossy, blue-black color of their scales aboveand uniformly slate blue below. Frequently, theyhave orange to coral reddish coloration in thethroat area, yet some specimens have beenreported to only have cream coloration on thethroat. These snakes are not typically aggressiveand will attempt to crawl away when disturbed.Though indigo snakes rarely bite, they shouldNOT be handled.SIMILAR SNAKES: The black racer is theonly other solid black snake resembling theeastern indigo snake. However, black racershave a white or cream chin, thinner bodies, andWILL BITE if handled.LIFE HISTORY: The eastern indigo snakeoccurs in a wide variety of terrestrial habitattypes throughout Florida. Although they have apreference for uplands, they also utilize somewetlands and agricultural areas. Eastern indigosnakes will often seek shelter inside gophertortoise burrows and other below- and above-ground refugia, such as other animal burrows,stumps, roots, and debris piles. Females may layfrom 4 - 12 white eggs as early as April throughJune, with young hatching in late July throughOctober.3.A.1.ePacket Pg. 217Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Killing, harming, or harassing indigosnakes is strictly prohibited andpunishable under State and Federal Law.Only individuals currently authorizedthrough an issued Incidental Take Statementin association with a USFWS BiologicalOpinion, or by a Section 10(a)(1)(A) permitissued by the USFWS, to handle an easternindigo snake are allowed to do so.LEGAL STATUS: The eastern indigosnake is classified as a Threatened speciesby both the USFWS and the Florida Fishand Wildlife Conservation Commission.“Taking” of eastern indigo snakes isprohibited by the Endangered Species Actwithout a permit. “Take” is defined by theUSFWS as an attempt to kill, harm, harass,pursue, hunt, shoot, wound, trap, capture,collect, or engage in any such conduct.Penalties include a maximum fine of$25,000 for civil violations and up to$50,000 and/or imprisonment for criminaloffenses, if convicted.ATTENTION:August 12, 20133.A.1.ePacket Pg. 218Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) ATTENTION: IF YOU SEE A LIVE EASTERN INDIGO SNAKE ON THE SITE: • • • • • IF YOU SEE A DEAD EASTERN INDIGO SNAKE ON THE SITE: • • • Killing, harming, or harassing indigo snakes is strictly prohibited and punishable under State and Federal Law. August 12, 2013 3.A.1.e Packet Pg. 219 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 220 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 221 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 222 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 223 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 224 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 225 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 226 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 227 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) S PECIAL QUALIFICATIONS »Has 15 years of extensive experience managing and conducting public and private sector projects, biological assessments, GIS, photointerpretation, and related studies »Experienced in environmental assessment, mitigation plans, project management, wetland and protected species surveys, and state and federal permitting »Authorized Gopher Tortoise Agent »Knowledgeable of the NEPA process and PD&E guidelines used for development of transportation projects by FDOT PROFESSIONAL CREDENTIALS »Master of Science, Zoology, University of Oklahoma, 2004 »Bachelor of Science, Zoology, Ohio Wesleyan University, 2000 »Gopher Tortoise Authorized Agent, FWC, #GTA-18-00041A »FWC Approved Florida Manatee Observer »USFWS Approved Crested Caracara Observer »FDEP Stormwater Management Inspector, #23835 Stormwater Management Inspector »&HUWL¿HG(FRORJLVW(6$ RELEVANT EXPERIENCE SR 659 (Combee Road) PD&E Study from US 98 to Skyview Drive, FDOT District One — Environmental scientist providing evaluation of roadway alternatives with respect to wetland and protected species involvement and documentation of findings in NEPA Natural Resources Evaluation report. Kimley-Horn is performing a PD&E study to prepare design alternatives for the corridor that accommodate pedestrians and bicycles, improve transit faculties, and optimize vehicle access. The study team will analyze and assess the project’s impact on the social, economic, cultural, natural, and physical environment to develop the location and design concept acceptance (LDCA) of the project in accordance with FDOT policy, procedures, and requirements. Environmental tasks included habitat assessment, wetland quality assessment, potential protected species involvement, Natural Resource Evaluation report, Pond Siting Report, and alternatives analysis evaluation for wetland and protected species. Apollo Beach Boulevard Extension/I-75 Flyover, Hillsborough County, FL Environmental scientist for the Kimley-Horn team designing the extension of Apollo Beach Boulevard from US 41 to Paseo al Mar Boulevard that will result in a 4-lane facility including the bridge over I-75 to the eastern limits of the conservation easement or approach tie-down. Environmental tasks include SWFWMD and USACE permitting, ZHWODQGGHOLQHDWLRQSUHSDULQJPLWLJDWLRQSODQVFRQVHUYDWLRQHDVHPHQWPRGL¿FDWLRQ and coordination with multiple agencies. Extending Apollo Beach from US 41 to US 301 ZLOOVHUYHDVDQDOWHUQDWLYHHDVWZHVWFRQQHFWLRQXOWLPDWHO\UHGXFLQJWUDI¿FGHPDQGV RQ%LJ%HQG5RDG7KLVZRUNHIIRUWLQFOXGHVDOLJQPHQWDQGWUDI¿FVWXGLHV VXUYH\LQJ JHRWHFKQLFDOH[SORUDWLRQWHVWLQJDQGDQDO\VLV SUHSDULQJHQJLQHHULQJUHSRUWV with right-of-way maps and environmental documentation incorporating roadway, VWRUPZDWHUGHWHQWLRQDQGZHWODQGPLWLJDWLRQUHTXLUHPHQWV SHUPLWWLQJUHTXLUHPHQWV and determination of right-of-way requirements. Central Florida Expressway Authority (CFX) Concept, Feasibility and Mobility Studies for Osceola County Expressway Authority (OCX) Master Plan Projects Environmental scientist providing protected species surveys and NEPA documentation RI¿QGLQJVLQWKH1DWXUDO5HVRXUFHV(YDOXDWLRQUHSRUW.LPOH\+RUQFRQGXFWHGD Concept, Feasibility and Mobility Study for this planned expressway which widens the existing Poinciana Parkway and extends it to I-4. Existing environmental and SK\VLFDOFRQVWUDLQWVZHUHLGHQWL¿HGZKLFKLQFOXGHGPLWLJDWLRQEDQNVFHPHWHULHVDQG extensive utilities. Alternative alignments were developed to minimize impacts and these alternatives are currently being evaluated. Due to development, a cemetery and utility constraints, a critical factor for determining feasibility of the expressway is LWVLQWHUFKDQJHFRQQHFWLRQWR, WKHUHIRUHLQWHUFKDQJHFRQFHSWVZHUHGHYHORSHG to determine the feasibility of tying into I-4 at two different locations. Extensive stakeholder meetings and coordination occurred with property owners, utilities, developers, local governments, FDOT and Florida’s Turnpike. Protected species surveys were required including crested caracara nest surveys. SR 93/I-75 at US 301 Interchange, FDOT District One — The project consists of the widening of this segment of I-75 from four to six lanes, including the design of two bridges over the Manatee River, and the development of a stormwater management system to address water quality concerns. As the lead environmental scientist for Sarah Johnson Environmental Scientist 3.A.1.e Packet Pg. 228 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Sarah Johnson Relevant Experience Continued this project, was responsible for the assessment of the project area for the presence of federal and/or state listed protected species, determination of wetland jurisdictional boundaries using federal and state guidelines, a quantitative assessment of the wetlands using the Unified Mitigation Assessment Method (UMAM), preparing documentation for a US Coast Guard permit, SWFWMD Environmental Resource Permit. General Environmental Services, Environmental Management Office, FDOT District One — As assistant project manager on WKLVSURMHFWWDVNVLQFOXGHGHYDOXDWLRQRIERWKQRQPDMRUVWDWHDQGIHGHUDOO\IXQGHGSURMHFWV LQFOXGLQJ/$3IXQGV SURYLGLQJ(OHFWURQLF Review Comments for minor projects in design phase for environmental involvement including wetlands, protected species, Section I FRQWDPLQDWLRQDQGFXOWXUDOUHVRXUFHV FRPSOHWLQJWKHHQYLURQPHQWDOFHUWLILFDWLRQVIRUPLQRUSURMHFWV ERWK7\SH&(DQG NMSAs) including the status of environmental certification, environmental checklist, environmental memo, applicable permits, cultural UHVRXUFHFRRUGLQDWLRQ6HFWLRQ I GHWHUPLQDWLRQRIDIIHFWDQGFRQWDPLQDWLRQDVVHVVPHQW XSORDGLQJWKHHQYLURQPHQWDOFHUWLILFDWLRQ GRFXPHQWDWLRQZLWKLQWKH6:(37GDWDEDVH DQGFRPSOHWLQJVSHFLHVVSHFLILFVXUYH\VIRUWKHFUHVWHGFDUDFDUDEDOGHDJOHJRSKHU tortoise, burrowing owls, sand skinks, and osprey. Other tasks included assisting with project re- evaluations, coordinating with construction project managers, providing staging area clearances, and developing protected species determination keys for minor project involvement. SR 70 from Jefferson Avenue to CR 29 PD&E, FDOT District One — Environmental scientist. This project involved development of the NEPA document and support documents for the widening of an approximately 7.5-mile section of SR 70 in Highlands County. Project alternatives included the widening of the existing roadway from two to four lanes, as well as operational improvements to the two-lane section. Specific tasks included the oversight of data collection, development and review of environmental documents, and coordination with federal and state regulatory and review agencies. Key issues included impacts to multiple federal and state protected species, public lands (4(f) properties), private research facilities, and extensive utilities. Environmental documents developed for the project included wetlands, protected species, hazardous materials, drainage, noise and archaeological/historical reports, as well as the NEPA document developed for FHWA and FDOT. Central Polk Parkway PD&E Study, FDOT District One — Deputy project manager who verified land use within the alternatives, surveyed for protected species and their habitat, provided coordination and oversight of the entire field work effort, coordinated with agencies, and assisted with report writing and graphics. This project involved an impact analysis for a new roadway alignment from I-4 to SR 60 and from Polk Parkway to SR 60. The total project involved approximately 50 miles of new roadway alignments within Polk County. Central Polk Parkway from SR 35 to Pollard Road Design, Polk County, FL — Assistant project manager responsible for the permitting of the construction of an approximately 10-mile section of the Central Polk Parkway in Polk County. The project consists of the construction of a new four lane roadway, including the design of eleven bridges over multiple channels, and the development of a stormwater management system to address water quality concerns. Specific tasks included the assessment of the project area for the presence of federal and/or state listed protected species, determination of wetland jurisdictional boundaries using federal and state guidelines, a quantitative assessment of existing wetland values and wetland values lost using the Unified Mitigation Assessment Method (UMAM). Wetland impacts exceeded 90 acres and the project required species specific surveys and the assessment of impacts for six federal and state listed species. Additional tasks include obtaining US Army Corps of Engineers 404 dredge and fill permit, Florida Department of Environmental Protection National Pollutant Discharge Elimination System permit, and Southwest Florida Water Management District Environmental Resource Permit. US 27 PD&E Study (from I-4 to US 192), FDOT District One — Environmental scientist who participated in extensive wildlife surveys that specifically included scrub jays, sand skinks, and gopher tortoises as well as assisting with the report writing and creating graphics for the reports. This project involved an impact analysis and study of design alternatives for the widening of 8 miles of a rapidly developing segment of US 27 from four to six lanes. Environmental concerns included protected scrub species such as the sand skink and gopher tortoise. SR 60 PD&E from CR 630 to Kissimmee River Bridge Widening, FDOT District One — Assistant project manager/environmental scientist. Tasks included assessment of wetland involvement for alignment alternatives, reviewed area for protected species potential and involvement, compilation of PD&E documents, and coordination with various agencies. 3.A.1.e Packet Pg. 229 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 2VFHROD%UHYDUG&RQQHFWRU)HDVLELOLW\6WXG\2VFHRODDQG%UHYDUG&RXQWLHV)/² (QYLURQPHQWDO6FLHQWLVWUHVSRQVLEOHIRUGHYHORSLQJHQYLURQPHQWDOVXSSRUWGRFXPHQWV IRUWKH2%&&)HDVLELOLW\6WXG\ 3ULYDWH6HFWRU'XH'LOLJHQFH5HSRUWV+LOOVERURXJKDQG%UHYDUG&RXQWLHV)/² (QYLURQPHQWDOVFLHQWLVWUHVSRQVLEOHIRUWKHSUHOLPLQDU\HQYLURQPHQWDOGXHGLOLJHQFH DVVHVVPHQWRIWKUHHFRPPHUFLDOLQGXVWULDOVLWHV 0XWLIDPLO\5HVLGHQWLDO'RFN3HUPLWWLQJ3DVFR&RXQW\)/²(QYLURQPHQWDOVFLHQWLVW UHVSRQVLEOHIRUWKHSHUPLWWLQJRIWKHLQVWDOODWLRQRIDQDSSUR[LPDWHO\VTIWGRFN RQDSULYDWHIUHVKZDWHUSRQGLQ3DVFR&RXQW\ 3ULYDWH6HFWRU1DWXUDO5HVRXUFH$VVHVVPHQW+LOOVERURXJK&RXQW\)/² (QYLURQPHQWDOVFLHQWLVWUHVSRQVLEOHIRUWKHSUHOLPLQDU\QDWXUDOUHVRXUFHDVVHVVPHQW RIDFRPPHUFLDOGHYHORSPHQWVLWHV Silicon Ranch Craig Farms Solar Project, Adams County, CO — Project manager responsible for the pre-development environmental assessment of the 1,100 acre Craig Farms Solar Project including wetland delineations, protected species surveys, a Phase I ESA, and a comprehensive permitting matrix. Pacificorp Sagebrush Habitat Enhancement and Restoration Project, Carbon County, WY — Project manager responsible for the establishment and creation of an Implementation Plan for sagebrush habitat enhancement at the 1,800-acre Hanna Mine Arch Coal Reclamation Area in Hanna, WY, in support of PacifiCorp’s desire to provide compensatory mitigation of sage grouse impacts due to the construction of the Gateway West transmission line. Well Pad NEPA Permitting, Crook County, WY — Project manager responsible for the establishment and creation of environmental documents such as the NEPA environmental assessment, SUPO, stormwater pollution prevention plan, and environmental resource permits for an oil well on split estate property (BLM mineral/ private surface). SH 119 Reconstruction, Boulder County, CO — Project manager responsible for managing the survey and mapping of protected species and their habitats for the reconstruction of SH 119 through Boulder Canyon. Parkside Village Residential Mixed-Use Complex, Denver, CO — Project manager responsible for the establishment and creation of environmental documents such as stormwater management plans, environmental site assessments, and environmental permits. Responsible for holding stakeholder meetings with clients, subcontractors, and regulatory officials. 65IURP-HIIHUVRQ$YHQXHWR&5 3' ( +LJKODQGV&RXQW\)/² (QYLURQPHQWDOVFLHQWLVWUHVSRQVLEOHIRUWKHVXUYH\DQGPDSSLQJRIH[LVWLQJODQGXVH SURWHFWHGVSHFLHVDQGWKHLUKDELWDWVRIDQDSSUR[LPDWHO\PLOHVHJPHQWLQFOXGLQJ HYDOXDWLQJLPSURYHPHQWVWRWKH65LQWHUVHFWLRQDW86 S P ECIAL QUALIFICATIONS »+DVPRUHWKDQILYH\HDUVRIH[SHULHQFH conducting environmental investigations for public and private sector projects »Experienced in environmental assessments, mitigation planning, project management, wetland and protected species surveys, and state and federal permitting PROFESSIONAL CREDENTIALS »Master of Science Ecological Restoration, University of Florida, In Progress »Bachelor of Science, Natural Resource Conservation, University of Florida, 2015 »Pace University, Desktop GIS &HUWLILFDWLRQ »OPEC, Safeland Training, 2018 »Plan-it Geo, GIS Mapping for Urban Forests, 2018 »OSHA, 10 Hour Construction Industry Safety Training, 2017 »FWC, Gopher Tortoise Agent - Survey and Excavation, 2017 »CAGC, Erosion and Sediment Control Inspector Training, 2017 »FDEP, Erosion and Sediment Control Inspector Training, 2016 »FSCC, Hydric Soils Workshop, 2016 Stephen Myers Environmental Scientist RELEVANT EXPERIENCE 3.A.1.e Packet Pg. 230 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Stephen Myers Relevant Experience Continued SR 50 Bypass from Buck Hope Road to Jefferson Street (Design), Hernando County, FL — Environmental scientist responsible for the survey and mapping of protected species and their habitats of an approximately 2-mile bypass of SR 50 in Hernando County. SR 40 from East of CR 314 to CR 314A (Design), Marion County, FL — Environmental scientist responsible for the permitting of the widening of an approximately six-mile segment of SR 40 through the Ocala National Forest in Marion County. The project consists of widening this segment of roadway from two to four lanes. Specific tasks included the assessment of the project area for the presence of federal and/or state listed protected species including MBTA listed species, determination of wetland jurisdictional boundaries using federal and state guidelines, and the development of construction guidelines for protection of existing on-site protected species, including a sand skink survey. SR 56 Extension from Meadow Pointe Boulevard to US 301 (Design/Build), Pasco County, FL — Environmental scientist responsible for the establishment and mapping of wetland jurisdictional boundaries of an approximately 8-mile extension of SR 56 in Pasco County. US 92 from County Line Road to Wabash Road (PD&E). Polk County, FL — Environmental scientist responsible for developing environmental documents such as the protected species biological assessment and wetlands evaluation report. This project involved an impact analysis and study of design alternatives for the widening of 4 miles of US 92 from two lanes to four lanes. Key issues include impacts to multiple federal and state protected species and wetlands. 3.A.1.e Packet Pg. 231 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) !! ! "# $ % ! # $# ! " # "#"$%& "#’ #!""’# ! # $( ) #* $+"#( ) # ! # *$ ( ) ###$ " & ’ (! !)’# * +% !# #( )’# ,,#-./0,". # * & 1 # "$’,#-./-2/" 3"## ,,4$5"!####66 ’6" # " " " " 76 76# # "7$ ,-.)!" !&!% / %!# %# #""+85! $ " " ! 9$ / %& 0 11, ’! 2# /# ###/: ! #;<:=;<//.$5#!#" >"*! #"*** #*!**# # "!" *"! "$ " $ /!!! & * /3 $ ! (! !# /!!!# $5># "’#)# ?$ ! +<"4+?$ 456 )/@# ’ ’#"! + #" ’ " " > + 66 / 0#* * *? )’ =/ ,# ,? -=. 9% 5+< ;$%5 // .? 3.A.1.e Packet Pg. 232 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) ’!(" !&! ! &’"7!##$# ##**$"+ + <# +< + ? # +? "*"*"#$ $/ ’7"’7!#*7#0"?4"&)+ #""#0"?<2=#</1 </1=$5’"# "*# *"*!*$5>#" !"’$#> " * # +<0? 44 -$ 5 > # * $ $"87&" !% ! !%& 8*!! !%! !# 7	 #"#/1. .#"""#$ ##"+?-$ 3&#"" !%! " !7"’7!:&!% ! !%#!#!!’ !7!’ &# "" !%!#3 ( ) 7#>#2 #$"-# $ 3.A.1.e Packet Pg. 233 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) TRAFFIC IMPACT LETTER 3.A.1.e Packet Pg. 234 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3300 PGA Boulevard, Suite 780 Palm Beach Gardens, Florida 33410 United States T +1.561.799.3855 F +1.561.799.6579 www.jacobs.com Jacobs Engineering Group Inc. November 2, 2020 Attention: Timothy Finn, AICP Collier County, Growth Management Department 2800 North Horseshoe Drive Naples, Florida 34104 Project Name: FPL Immokalee Solar Energy Center - Conditional Use (PL20200001865) Subject: FPL Immokalee Solar Energy Center –Transportation Impact Letter Dear Mr. Finn: Please accept this letter as the required Transportation Impact Letter for the proposed Conditional Use application for the above referenced project. This letter is being provided pursuant to the methodology meeting notes provided by Mike Sawyer, and comments received during the Conditional Use Pre-Application conference call on September 29, 2020. It is my professional opinion that upon completion of construction, the proposed project creates a de minimis transportation impact. The proposed project is a 74.5 MW solar energy center located on approximately 578 acres located in eastern Collier County directly east of the intersection of SR29 and SR82. The Conditional Use proposes a remotely operated, unmanned essential service solar facility. Occasional visits to the solar facility will be made for periodic maintenance and grass mowing. Based upon the operation of similar size existing solar facilities in Florida, it is anticipated that approximately four (4) trips per month will be made to the site. It is my opinion that this level of traffic constitutes a de minimis traffic impact and therefore we respectfully request that this letter serve as the Transportation Impact Letter required to support the Conditional Use request. Sincerely, David Scott, P.E. Project Manager Jacobs Engineering Group FL PE No. 58166 FL COA NO. 2822 3.A.1.e Packet Pg. 235 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) HHISTORICAL REVIEW WAIVER 3.A.1.e Packet Pg. 236 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Historic Preservation/Forms/rev. 06/05/08 1 COLLIER COUNTY WAIVER APPLICATION FROM THE REQUIRED HISTORICAL AND ARCHAEOLOGICAL SURVEY AND ASSESSMENT DATE SUBMITTED: _______________ PLANNER: Melissa Zone, Principal Planner PETITION NUMBER ASSOCIATED WITH THE WAIVER: _____________________ (To Be Completed By Zoning and Land Development Review Staff) PROJECT NAME: ______________________________________________________ LOCATION: (Common Description) __________________________________________ ________________________________________________________________________ ________________________________________________________________________ SUMMARY OF WAIVER REQUEST: _______________________________________ ________________________________________________________________________ ________________________________________________________________________ (Properties located within an area of Historical and Archaeological Probability but with a low potential for historical/archaeological sites may petition the Community Development & Environmental Services Administrator County Manager or designee to waive the requirement for a Historical/Archaeological Survey and Assessment. Once the waiver application has been submitted, it shall be reviewed and acted upon within five (5) working days. The waiver request shall adequately demonstrate that the area has low potential for historical/archaeological sites.) 3.A.1.e Packet Pg. 237 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Historic Preservation/Forms/rev. 06/05/08 2 SECTION ONE: APPLICANT AND PROPERTY OWNERSHIP DATA A. Name of applicant (s) (if other than property owner, state relationship such as option holder, contract purchaser, lessee, trustee, etc.): _____________________________ ___________________________________________________________________ Mailing Address: _____________________________________________________ ___________________________________________________________________ Phone: ( ) ____________________________ FAX: _______________________ E-Mail: _____________________________________________________________ B. Name of agent(s) for applicant, if any: ____________________________________ ___________________________________________________________________ Mailing Address: _____________________________________________________ ___________________________________________________________________ Phone: ( ) _____________________________FAX: ____________________ E-Mail: _____________________________________________________________ C. Name of owner(s) of property: __________________________________________ ___________________________________________________________________ Mailing Address: _____________________________________________________ ___________________________________________________________________ Phone: ( ) _____________________________ FAX: ___________________ E-Mail: _____________________________________________________________ Note: If names in answers to A and/or B are different than name in C, notarized letter(s) of authorization from property owner (C) must be attached. 3.A.1.e Packet Pg. 238 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Historic Preservation/Forms/rev. 06/05/08 3 SECTION TWO: SUBJECT PROPERTY DATA (Attach copy of the plat book page (obtainable from Clerk’s Office at the original scale) with subject property clearly marked.) A. Legal description of subject property. Answer only 1 or 2, as applicable. 1. Within platted subdivision, recorded in official Plat Books of Collier County. Subdivision Name: __________________________________________________ Plat Book ________ Page ________ Unit _______ Block _______ Lot ________ Section __________ Township __________ Range __________ 2. If not in platted subdivision, a complete legal description must be attached which is sufficiently detailed so as to locate said property on County maps or aerial photographs. The legal description must include the Section, Township and Range. If the applicant includes multiple contiguous parcels, the legal description may describe the perimeter boundary of the total area, and need not describe each individual parcel, except where different zoning requests are made on individual parcels. A boundary sketch is also required. Collier County has the right to reject any legal description, which is not sufficiently detailed so as to locate said property, and may require a certified survey or boundary sketch to be submitted. B. Property dimensions: Area: __________________ square feet, or _______________________ acres Width along roadway: _______________________________________________ Depth: ____________________________________________________________ C. Present use of property: ______________________________________________ __________________________________________________________________ D. Present zoning classification: __________________________________________ 3.A.1.e Packet Pg. 239 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Historic Preservation/Forms/rev. 06/05/08 4 SECTION THREE: WAIVER CRITERIA Note: This provision is to cover instances in which it is obvious that any archaeological or historic resource that may have existed has been destroyed. Examples would be evidence that a major building has been constructed on the site or that an area has been excavated. A. Waiver Request Justification. 1. Interpretation of Aerial Photograph _________________________________ 2. Historical Land Use Description: ___________________________________ 3. Land, cover, formation and vegetation description: _____________________ 4. Other: ________________________________________________________ B. The County Manager or designee may deny a waiver, grant the waiver, or grant the waiver with conditions. He shall be authorized to require examination of the site by an accredited archaeologist where deemed appropriate. The applicant shall bear the cost of such evaluation by an independent accredited archaeologist. The decision of the County Manager or designee regarding the waiver request shall be provided to the applicant in writing. In the event of a denial of the waiver request, written notice shall be provided stating the reasons for such denial. Any party aggrieved by a decision of the County Manager or designee regarding a waiver request may appeal to the Preservation Board. Any party aggrieved by a decision of the Preservation Board regarding a waiver request may appeal that decision to the Board of County Commissioners. 3.A.1.e Packet Pg. 240 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 241 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.ePacket Pg. 242Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) LEGAL DESCRIPTION OF LANDS SURVEYED: A parcel of land being a part of Sections 4, 9, and 16, Township 46 South, Range 29 East, Collier County, Florida, Being more particularly described as follows: Commencing at the Southwest corner of said Section 16; thence N89°05'11”E, along the south line of the southwest ¼ of said section 16, a distance of 2650.16 feet to the east line of the southwest ¼ of said Section 16; thence N00°37'45”W, along said east line, a distance of 893.57 feet to the POINT OF BEGINNING; thence departing said east line, run S75°20'01”E, a distance of 663.02 feet; thence S75°55'51”E, a distance of 80.66 feet; thence S73°16'08”E, a distance of 59.89 feet; thence N24°20'38"E, a distance of 46.79 feet; thence N00°11'01"E, a distance of 166.98 feet; thence N65°09'07"W, a distance of 354.49 feet; thence N57°16'10"W, a distance of 222.58 feet; thence N43°09'13"W, a distance of 160.98 feet; thence N27°43'02"W, a distance of 223.14 feet; thence N26°53'04"W, a distance of 181.96 feet; feet to aforesaid east line of the southwest ¼ of Section 16; thence departing said east line, continue N26°53'04"W, a distance of 196.53 feet; thence N29°23'47"W, a distance of 172.09 feet to a point on a non-tangent curve with a radius of 180.15 feet, concave to the east; thence northwesterly along said curve to the right through a central angle of 59°54'32", a distance of 188.36 feet where the chord bears N03°11'40"W a distance of 179.90 feet to the point of intersection with a non-tangent line; thence N23°39'31"E, a distance of 84.45 feet; thence N26°18'30"W, a distance of 238.04 feet; thence N60°35'03"W, a distance of 32.45 feet; thence S60°53'17"W, a distance of 82.09 feet; thence S82°21'35"W, a distance of 154.36 feet; thence N85°55'54"W, a distance of 100.73 feet; thence N76°01'53"W, a distance of 171.69 feet; thence N72°44'10"W, a distance of 162.49 feet to a point on a non-tangent curve with a radius of 334.58 feet, concave to the northeast; thence westerly along said curve to the right through a central angle of 54°01'23", a distance of 315.47 feet to the south line of the northwest ¼ of aforesaid Section 16 (where the chord bears N42°10'17"W a distance of 303.91 feet to the point of intersection with a non-tangent line); thence departing said south line, run N12°10'48"W, a distance of 34.67 feet; thence N01°44'38"W, a distance of 315.28 feet; thence N03°16'14"W, a distance of 234.59 feet; thence N54°58'48"W, a distance of 141.82 feet; thence S66°23'57"W, a distance of 130.52 feet to a point on a non-tangent curve with a radius of 337.03 feet, concave to the north; thence southwesterly along said curve to the right through a central angle of 59°55'46", a distance of 352.52 feet where the chord bears N85°02'20"W a distance of 336.67 feet to the point of intersection with a non-tangent line; thence N42°17'26"W, a distance of 81.24 feet; thence N39°29'03"W, a distance of 183.00 feet; thence N40°26'22"W, a distance of 157.67 feet; thence N47°00'34"W, a distance of 139.93 feet to a point on a non-tangent curve with a radius of 287.61 feet, concave to the east; thence northwesterly along said curve to the right through a central angle of 71°48'29", a distance of 360.46 feet where the chord bears N04°19'28"W a distance of 337.33 feet to the point of intersection with a non-tangent line; thence N46°28'03"E, a distance of 124.92 feet; thence N51°19'36"E, a distance of 124.92 feet to a point on a non-tangent curve with a radius of 346.99 feet, concave to the south; thence northeasterly along said curve to the right through a central angle of 57°02'26", a distance of 345.44 feet where the chord bears S87°47'38"E a distance of 331.35 feet to the point of intersection with a non-tangent line; thence S44°38'05"E, a distance of 384.44 feet; thence S32°07'41"E, a distance of 185.42 feet; thence S26°29'56"E, a distance of 106.41 feet; thence S16°41'39"E, a distance of 97.52 feet; thence S11°15'06"W, a distance of 64.58 feet; thence S51°38'18"E, a distance of 174.02 feet; thence N58°59'56"E, a distance of 95.19 feet; thence N66°50'39"E, a distance of 102.19 feet to a point on a non-tangent curve with a radius of 226.62 feet, concave to the south; thence easterly along said curve to the right through a central angle of 60°07'16", a distance of 237.80 feet where the chord bears S81°47'06"E a distance of 227.04 feet to the point of intersection with a non-tangent line; thence S58°23'44"E, a distance of 118.23 feet; thence S49°00'58"E, a distance of 159.00 feet; thence S29°30'33"E, a distance of 210.80 feet; thence S26°48'25"E, a distance of 439.41 feet; thence S21°07'20"E, a distance of 42.79 feet; thence 3.A.1.e Packet Pg. 243 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) S01°54'46"W, a distance of 15.86 feet to aforesaid south line of the northwest ¼ of Section 16; thence departing said south line, continue S01°54'46"W, a distance of 101.19 feet; thence S28°03'10"E, a distance of 226.25 feet to aforesaid east line of the southwest ¼ of Section 16; thence departing said east line, run S28°00'26"E, a distance of 99.95 feet; thence S89°48'40"E, a distance of 54.82 feet; thence S66°14'26"E, a distance of 196.18 feet; thence S57°52'50"E, a distance of 294.12 feet; thence S45°37'09"E, a distance of 423.70 feet; thence S31°19'19"E, a distance of 327.77 feet; thence S37°05'37"E, a distance of 60.56 feet; thence N80°36'14"E, a distance of 95.15 feet; thence N88°08'24"E, a distance of 282.49 feet; thence S61°38'14"E, a distance of 207.86 feet; thence S09°59'57"E, a distance of 320.20 feet; thence S11°53'31"E, a distance of 279.08 feet; thence S62°47'07"E, a distance of 77.50 feet; thence S75°15'51"E, a distance of 883.29 feet; thence N00°38'44"W, a distance of 1864.68 feet; thence S51°03'41"W, a distance of 115.91 feet to a point on a non-tangent curve with a radius of 292.21 feet, concave to the northeast; thence southwesterly along said curve to the right through a central angle of 105°47'48", a distance of 539.57 feet where the chord bears N65°09'57"W a distance of 466.11 feet to the point of intersection with a non-tangent line; thence N16°45'04"W, a distance of 173.47 feet; thence N00°37'25"W, a distance of 48.87 feet to the south line of the northeast ¼ of Section 16, thence departing said south line, continue N00°37'25"W, a distance of 29.69 feet to a point on a non- tangent curve with a radius of 135.93 feet, concave to the southwest; thence northerly along said curve to the left through a central angle of 60°09'32", a distance of 142.73 feet where the chord bears N22°37'15"W a distance of 136.26 feet to the point of intersection with a non-tangent line; thence N58°07'50"W, a distance of 516.62 feet; thence N60°58'32"W, a distance of 54.63 feet to a point on a non-tangent curve with a radius of 112.22 feet, concave to the south; thence northwesterly along said curve to the left through a central angle of 60°15'25", a distance of 118.01 feet where the chord bears N83°31'49"W a distance of 112.65 feet to the point of intersection with a non-tangent line; thence S74°42'31"W, a distance of 145.11 feet to a point on a non-tangent curve with a radius of 380.90 feet, concave to the northeast; thence westerly along said curve to the right through a central angle of 59°54'38", a distance of 398.28 feet where the chord bears N62°32'13"W a distance of 380.39 feet to the point of intersection with a non-tangent line; thence N24°42'10"W, a distance of 277.56 feet; thence N30°15'20"W, a distance of 132.74 feet; thence N40°28'47"W, a distance of 112.93 feet; thence N41°30'42"W,a distance of 393.81 feet; thence N27°09'40"W, a distance of 812.57 feet; thence N47°41'01"W, a distance of 81.72 feet to the east line of the northwest ¼ of said Section 16; thence departing said east line, run N47°45'02"W, a distance of 793.37 feet; thence S89°17'09"W, a distance of 787.79 feet; thence N14°36'16"W, a distance of 35.37 feet to the south line of the southwest ¼ of said Section 9; thence departing said south line; thence N24°46'59"W, a distance of 187.13 feet; thence N00°59'49"W, a distance of 421.04 feet; thence N12°00'51"W, a distance of 176.45 feet; thence N19°15'03"W, a distance of 175.51 feet; thence S78°29'00"W, a distance of 173.54 feet; thence S87°20'35"W, a distance of 106.34 feet; thence N67°17'58"W, a distance of 183.95 feet; thence N58°48'58"W, a distance of 208.56 feet to a point on a non-tangent curve with a radius of 310.99 feet, concave to the east; thence northwesterly along said curve to the right through a central angle of 60°00'27", a distance of 325.71 feet where the chord bears N06°27'09"W a distance of 311.03 feet to the point of intersection with a non- tangent line; thence N44°25'54"E, a distance of 219.41 feet to a point on a non-tangent curve with a radius of 386.01 feet, concave to the south; thence northeasterly along said curve to the right through a central angle of 60°11'16", a distance of 405.50 feet where the chord bears S89°30'14"E a distance of 387.11 feet to the point of intersection with a non-tangent line; thence S50°21'03"E, a distance of 142.88 feet; thence S31°09'57"E, a distance of 146.21 feet; thence S19°05'08"E, a distance of 233.59 feet; thence S16°02'13"E, a distance of 209.04 feet; thence S17°29'29"E, a distance of 227.30 feet; thence S59°43'57"E, a distance of 161.60 feet; thence S44°57'50"E, a distance of 152.29 feet; thence S78°33'33"E, a distance of 63.17 feet; thence N84°04'34"E, a distance of 115.72 feet; thence S83°57'49"E, a distance of 121.00 feet to a point on a non-tangent curve with a radius of 72.07 feet, concave to the northwest; thence easterly along said curve to the left through a central angle of 59°32'26", a distance of 74.90 feet where the chord bears N57°25'32"E a distance of 71.57 feet to the point of intersection with a non-tangent line; thence 3.A.1.e Packet Pg. 244 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) N07°00'55"E, a distance of 74.47 feet; thence N22°51'25"E, a distance of 124.02 feet; thence N36°27'33"E, a distance of 232.68 feet; thence N54°53'24"E, a distance of 274.99 feet; thence N64°07'04"E, a distance of 153.09 feet; thence N00°52'43"W, a distance of 403.18 feet; thence N88°54'48"E, a distance of 115.19 feet to the east line of the southwest ¼ of Section 9; thence departing said east line, run N88°54'48"E, a distance of 183.21 feet; thence N00°48'36"W, a distance of 759.02 feet; thence N68°23'03"W, a distance of 64.52 feet; thence N54°59'17"W, a distance of 149.10 feet to aforesaid east line of the southwest ¼ of Section 9; thence departing said east line, N54°59'17"W, a distance of 480.61 feet; thence S75°46'20"W, a distance of 374.76 feet; thence N88°35'50"W, a distance of 166.43 feet; thence N45°29'35"W, a distance of 222.14 feet to the south line of the northwest ¼ of said Section 9; thence departing said south line, run N45°32'03"W, a distance of 351.59 feet; thence N31°54'09"W, a distance of 209.90 feet; thence N22°17'55"W, a distance of 323.94 feet; thence N17°37'56"W, a distance of 138.86 feet to a point on a non-tangent curve with a radius of 298.99 feet, concave to the east; thence northerly along said curve to the right through a central angle of 60°00'00", a distance of 313.10 feet where the chord bears N12°37'33"E a distance of 298.99 feet to the point of intersection with a non-tangent line; thence N48°46'26"E, a distance of 377.70 feet; thence N54°12'46"E, a distance of 240.92 feet; thence N58°31'38"E, a distance of 134.18 feet; thence N85°48'47"E, a distance of 59.56 feet; thence S83°16'43"E, a distance of 576.57 feet; thence N01°28'07"W, a distance of 734.95 feet; thence N41°08'30"W, a distance of 620.76 feet to the south line of the southwest ¼ of said Section 4; thence departing said south line, run N02°52'53"W, a distance of 524.65 feet; thence N35°32'28"W, a distance of 248.76 feet; thence N44°57'52"W, a distance of 70.03 feet; thence N85°22'41"W, a distance of 129.08 feet; thence N81°24'25"W, a distance of 85.32 feet; thence N70°36'56"W, a distance of 123.88 feet; thence N57°44'59"W, a distance of 249.10 feet; thence S86°31'53"W, a distance of 262.02 feet; thence S16°13'27"W, a distance of 244.98 feet to a point on a non-tangent curve with a radius of 159.87 feet, concave to the north; thence southwesterly along said curve to the right through a central angle of 128°28'53", a distance of 358.50 feet where the chord bears N86°03'03"W a distance of 287.97 feet to the point of intersection with a non-tangent line; thence S89°11'36"W, a distance of 465.18 feet to the east right-of-way line of State Road 29; thence along said east right-of-way line the following five (5) courses: thence S00°31'26"E, a distance of 761.64 feet to aforesaid south line of the southwest ¼ of said Section 4; thence S00°38'16"E, a distance of 2734.95 feet to aforesaid south line of the northwest ¼ of said Section 9; thence continue S00°38'16"E, a distance of 2734.05 feet to aforesaid south line of the southwest ¼ of said Section 9; thence continue S00°38'16"E, a distance of 2738.75 feet to aforesaid south line of the northwest ¼ of Section 16, thence continue S00°38'16"E, a distance of 1008.74 feet; thence departing said east right-of-way line, run S79°08'44"E, a distance of 207.57 feet; thence S74°48'48"E, a distance of 113.82 feet; thence S07°03'21"W, a distance of 137.12 feet; thence S75°20'01”E, a distance of 2333.17 feet to the POINT OF BEGINNING. Containing 25174520 square feet or 577.93 acres, more or less LEGAL DESCRIPTION: Ingress - Egress Easement A parcel of land being a part of Section 16, Township 46 South, Range 29 East, Collier County, Florida, Being more particularly described as follows: Commencing at the Southwest corner of said Section 16; thence N89°05'11”E, along the south line of the southwest ¼ of said section 16, a distance of 105.28 feet to the east right-of-way line of State Road 29; thence N00°38'16"W, along said east right-of-way line, a distance of 1565.96 feet to the POINT OF BEGINNING; thence continue N00°38'16"W, a distance of 51.84 feet; thence departing 3.A.1.e Packet Pg. 245 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) said east right-of-way line, run S75°20'01"E, a distance of 307.48; thence S07°03'21"W, a distance of 15.13 feet; thence S75°20'01"E, a distance of 50.00 feet; thence S14°38'34"W, a distance of 35.00 feet; thence; thence N75°20'01"W, a distance of 345.82 feet to the POINT OF BEGINNING. Containing 16868 square feet or 0.39 acres, more or less 3.A.1.e Packet Pg. 246 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) BASIC STORMWATER MANAGEMENT PLANN 3.A.1.e Packet Pg. 247 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) BASIC STORMWATER PLAN OFFISITE DISCHARGE VEE-NOTCH WEIR 4A CONTROL EL. @ 33.0' NGVD LENGTH = 6.3' CREST EL. @ 34.0' NGVD OFFISITE DISCHARGE VEE-NOTCH WEIR 4B CONTROL EL. @ 33.0' NGVD LENGTH = 1.3' CREET EL. @ 34.0' NGVD PUMP STATION #13 30" @ 16,000 G.P.M. PUMP STATION 30" @ 16,000 G.P.M. PUMP STATION 24" @ 10,000 G.P.M PUMP STATION 24" @ 10,000 G.P.M. PUMP STATION 24" @ 10,000 G.P.M. PUMP STATION 24" @ 10,000 G.P.M.PUMP STATION 24" @ 10,000 G.P.M. 3300 PGA BLVD, SUITE 780 PALM BEACH GARDENS, FL 33410 PHONE: 561.799.3855 FLORIDA C.O.A. #2822 FLORIDA POWER & LIGHT COMPANY (FPL) 700 UNIVERSE BOULEVARD JUNO BEACH, FL 33408 (561) 691-7001 IMMOKALEE SOLAR CONDITIONAL USE REV DATE: OCT 30, 2020 3.A.1.e Packet Pg. 248 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) MASTER SITE FILE LETTER 3.A.1.e Packet Pg. 249 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 500 South Bronough Street • Tallahassee, FL 32399-0250 • www.flheritage.com/preservation/sitefile 850.245.6440 ph | 850.245.6439 fax | SiteFile@dos.state.fl.us This record search is for informational purposes only and does NOT constitute a project review. This search only identifies resources recorded at the Florida Master Site File and does NOT provide project approval from the Division of Historical Resources. Contact the Compliance and Review Section of the Division of Historical Resources at CompliancePermits@dos.MyFlorida.com for project review information. October 9, 2020 Lindsay F. Robin MPA Project Manager lindsay.robin@waldropengineering.com o (239) 405-7777 | d (239) 908-3079 | c (561) 704-7633 BONITA SPRINGS | FORT MYERS | ORLANDO | SARASOTA | TAMPA 28100 Bonita Grande Drive, Suite 305, Bonita Springs, FL 34135 In response to your request on October 9, 2020, the Florida Master Site File lists two resource groups recorded in the designated area for Sections 04, 09 & 16 Township 46S, Range 29 East When interpreting the results of our search, please consider the following information: • This search area may contain unrecorded archaeological sites, historical structures or other resources even if previously surveyed for cultural resources. • Because vandalism and looting are common at Florida sites, we ask that you limit the distribution of location information on archaeological sites. • While many of our records document historically significant resources, the documentation of a resource at the Florida Master Site File does not necessarily mean the resource is historically significant. • Federal, state and local laws require formal environmental review for most projects. This search DOES NOT constitute such a review. If your project falls under these laws, you should contact the Compliance and Review Section of the Division of Historical Resources at CompliancePermits@dos.MyFlorida.com Please do not hesitate to contact us if you have any questions regarding the results of this search. Sincerely, Eman M. Vovsi, Ph.D. Florida Master Site File Eman.Vovsi@DOS.MyFlorida.com 3.A.1.e Packet Pg. 250 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User Community, Sources: Esri, HERE, Garmin, Intermap, increment P Corp., GEBCO, USGS, FAO, NPS, NRCAN, GeoBase, IGN, Kadaster NL, Ordnance Survey, Esri Japan, METI, Esri China (Hong Kong), (c) OpenStreetMap contributors, and the GIS User Community 3.A.1.e Packet Pg. 251 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) SiteID Type Site Name Address Additional Info SHPO Eval NR Status CR00979 RG SR82 Immokalee Linear Resource - 1 Contrib Resources Not Eligible CR01309 RG SR 29 Immokalee Linear Resource - 1 Contrib Resources Not Eligible AR=0 SS=0 CM=0 RG=2 BR=0 Total=2 Cultural Resource Roster Page 1 of 1 Created: 10/9/2020Florida Master Site File 3.A.1.e Packet Pg. 252 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) SIGN POST AFFIDAVIT & PHOTOS 3.A.1.e Packet Pg. 253 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 254 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) SIGN POST IMMOKALEE SOLAR CU-PL2020-1865 & VA-PL2020-2161 3.A.1.e Packet Pg. 255 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) SIGN POST IMMOKALEE SOLAR CU-PL2020-1865 & VA-PL2020-2161 3.A.1.e Packet Pg. 256 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 1 of 1 Memorandum To: Timothy Finn, AICP From: Alexis Crespo, AICP cc: Scott Scovill; Noel Davies Date: February 25, 2021 Subject: Immokalee Solar Conditional Use (PL20200001865) Neighborhood Information Meeting Synopsis Florida Power & Light (Applicant), Waldrop Engineering, P.A. (Agent), and Collier County Staff conducted a Neighborhood Information Meeting (NIM) on Thursday, February 25, 2021. The meeting was held at 5:30 p.m. at the North Collier Regional Park at 15000 Livingston Road, Naples, Florida 34109 in Exhibit Hall A. The meeting was advertised in Naples Daily News and property owners within 1,000 feet of the property were notified of the meeting per Exhibits A and B attached. The meeting was also offered on Zoom to allow for virtual attendance due to the COVID-19 pandemic. No attendees were present other than the Applicants, Agents, and Staff. The meeting concluded at 5:45 p.m. 3.A.1.e Packet Pg. 257 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 258 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.e Packet Pg. 259 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) February 9, 2021 RE: Immokalee Solar PL20200001865 (Conditional Use) Dear Property Owner: Please be advised that Florida Power and Light Company has filed an application (PL20200001865) with Collier County. The application is seeking approval of a Conditional Use to allow for an “electric or gas generating plant” a.k.a. a solar energy center. The Immokalee Solar project totals 578+/- acres and is generally located directly east of the SR 29 and SR 82 intersection in unincorporated Collier County, Florida. In compliance with the Land Development Code requirements, a Neighborhood Information Meeting will be held to provide you an opportunity to hear a presentation about this application and ask questions. The Neighborhood Information Meeting will be held on Thursday, February 25, 2021 at 5:30 p.m. at the North Collier Regional Park, Exhibit Hall A, 15000 Livingston Road, Naples, FL 34109. *Social distancing and masks are required. Attending virtually is also available via Zoom. Please visit www.zoom.us, click on “Join A Meeting” in the top right corner, and enter Meeting ID: 843 8511 5402 Should you have questions prior to the meeting, please contact me directly at (239) 850-8525, or alexis.crespo@waldropengineering.com. Sincerely, WALDROP ENGINEERING, P.A. Alexis Crespo, AICP Senior Vice President - Planning *Please note that Collier County Parks and Recreation does not sponsor or endorse this program. 3.A.1.e Packet Pg. 260 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 1 FOLIO NAME1 ADDRESS1 ADDRESS2 ADDRESS3 COUNTRY CITY TATUSZIPOREIGNMA USZIPPLUS4 00067920000 BARRON COLLIER PARTNERSHIP 2600 GOLDEN GATE PKWY STE 20 USA NAPLES FL3410534105 3227 00067880001 BARRON COLLIER PARTNERSHIP 2600 GOLDEN GATE PKWY STE 20 USA NAPLES FL3410534105 3227 00067840009 ANZUALDA, RUDY MARIA OLVERA 1148 ESSEX ST E USA LEHIGH ACRES FL3397433974 0 00066640006 BARFIELD, MARY ALICE 3065 STATE ROAD 29 N USA IMMOKALEE FL3414234142 9703 00065720008 JACK W JOHNSON JR TRUST PO BOX 5003 USA IMMOKALEE FL3414334143 0 00066160007 CAPRI INTERNATIONAL INC PO BOX 771027 USA NAPLES FL3410734107 0 00065400001 KUNTRY KUBBARD INC 10 SARASOTA CENTER BLVD USA SARASOTA FL3424034240 0 00065240009 RINKER MATERIALS WEST LLC 1501 BELVEDERE RD USA WEST PALM BEACFL3340633406 1501 00065200007 JUAN & VERONICA BARNHART REVOCABLE TRUST 3751 STATE ROAD 29 N USA IMMOKALEE FL3414234142 9792 00065160008 E & B MILLER FAMILY FLORIDA LIMITED PARTNERSHIP PO BOX 728 USA LABELLE FL3397533975 728 00065120006 AYALA, VIRGINIA MARY ANN GARCIA NORA AYALA 207 WASHINGTON AVE USA IMMOKALEE FL3414234142 3133 00065080007 ROSBOUGH ENTERPRISES LTD PO BOX 3206 USA IMMOKALEE FL3414334143 0 00065040005 JOHNSON FAMILY DEVELOPMENT 1255 N 15TH ST STE 7 USA IMMOKALEE FL3414234142 2859 00064960102 BARRON COLLIER PARTNERSHIP 2600 GOLDEN GATE PKWY STE 20 USA NAPLES FL3410534105 3227 00064960005 BARRON COLLIER PARTNERSHIP 2600 GOLDEN GATE PKWY STE 20 USA NAPLES FL3410534105 3227 00064360003 BARRON COLLIER PARTNERSHIP 2600 GOLDEN GATE PKWY STE 20 USA NAPLES FL3410534105 3227 00063760002 BLOCKER, DEAN M KENNETH J BLOCKER JR 1303 NEW MARKET RD W USA IMMOKALEE FL3414234142 2253 00064200008 CCW82 LLC CULLEN Z & CONSTANCE J WALK 2170 LOGAN BLVD N USA NAPLES FL3411934119 1411 00064080008 WATSON, DANA PO BOX 52 USA IMMOKALEE FL3414334143 52 00063600007 SMITH, J STOKES C/O BENITEZ LAW GROUP P L 1223 E CONCORD ST USA ORLANDO FL3280332803 0 00063320002 BARRON COLLIER P'SHIP LLLP 2600 GOLDEN GATE PKWY # 200 USA NAPLES FL3410534105 3227 00063240001 BARRON COLLIER PARTNERSHIP 2600 GOLDEN GATE PKWY STE 20 USA NAPLES FL3410534105 3227 Buffer List 1000ft 3.A.1.e Packet Pg. 261 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 1 FOLIO NAME1 ADDRESS1 ADDRESS2 ADDRESS3 COUNTRY CITY TATUSZIPOREIGNMA USZIPPLUS4 00067920000 BARRON COLLIER PARTNERSHIP 2600 GOLDEN GATE PKWY STE 20 USA NAPLES FL3410534105 3227 00067880001 BARRON COLLIER PARTNERSHIP 2600 GOLDEN GATE PKWY STE 20 USA NAPLES FL3410534105 3227 00067840009 ANZUALDA, RUDY MARIA OLVERA 1148 ESSEX ST E USA LEHIGH ACRES FL3397433974 0 00066640006 BARFIELD, MARY ALICE 3065 STATE ROAD 29 N USA IMMOKALEE FL3414234142 9703 00065720008 JACK W JOHNSON JR TRUST PO BOX 5003 USA IMMOKALEE FL3414334143 0 00066160007 CAPRI INTERNATIONAL INC PO BOX 771027 USA NAPLES FL3410734107 0 00065400001 KUNTRY KUBBARD INC 10 SARASOTA CENTER BLVD USA SARASOTA FL3424034240 0 00065240009 RINKER MATERIALS WEST LLC 1501 BELVEDERE RD USA WEST PALM BEACFL3340633406 1501 00065200007 JUAN & VERONICA BARNHART REVOCABLE TRUST 3751 STATE ROAD 29 N USA IMMOKALEE FL3414234142 9792 00065160008 E & B MILLER FAMILY FLORIDA LIMITED PARTNERSHIP PO BOX 728 USA LABELLE FL3397533975 728 00065120006 AYALA, VIRGINIA MARY ANN GARCIA NORA AYALA 207 WASHINGTON AVE USA IMMOKALEE FL3414234142 3133 00065080007 ROSBOUGH ENTERPRISES LTD PO BOX 3206 USA IMMOKALEE FL3414334143 0 00065040005 JOHNSON FAMILY DEVELOPMENT 1255 N 15TH ST STE 7 USA IMMOKALEE FL3414234142 2859 00064960102 BARRON COLLIER PARTNERSHIP 2600 GOLDEN GATE PKWY STE 20 USA NAPLES FL3410534105 3227 00064960005 BARRON COLLIER PARTNERSHIP 2600 GOLDEN GATE PKWY STE 20 USA NAPLES FL3410534105 3227 00064360003 BARRON COLLIER PARTNERSHIP 2600 GOLDEN GATE PKWY STE 20 USA NAPLES FL3410534105 3227 00063760002 BLOCKER, DEAN M KENNETH J BLOCKER JR 1303 NEW MARKET RD W USA IMMOKALEE FL3414234142 2253 00064200008 CCW82 LLC CULLEN Z & CONSTANCE J WALK 2170 LOGAN BLVD N USA NAPLES FL3411934119 1411 00064080008 WATSON, DANA PO BOX 52 USA IMMOKALEE FL3414334143 52 00063600007 SMITH, J STOKES C/O BENITEZ LAW GROUP P L 1223 E CONCORD ST USA ORLANDO FL3280332803 0 00063320002 BARRON COLLIER P'SHIP LLLP 2600 GOLDEN GATE PKWY # 200 USA NAPLES FL3410534105 3227 00063240001 BARRON COLLIER PARTNERSHIP 2600 GOLDEN GATE PKWY STE 20 USA NAPLES FL3410534105 3227 Buffer List 1000ft 3.A.1.e Packet Pg. 262 Attachment: Attachment D - Application Backup Materials (15591 : PL20200001865 Immokalee Solar CU) 3.A.1.fPacket Pg. 263Attachment: Attachment E - Hybrid Meeting Waiver (15591 : PL20200001865 Immokalee Solar CU) 05/26/2021 COLLIER COUNTY Collier County Planning Commission Item Number: 3.A.2 Item Summary: PL20200002161 - VA: A Resolution of the Board of Zoning Appeals of Collier County, Florida, relating to a request for a variance from Section 4.06.02.c Table 2.4 of the Collier County Land Development Code which requires a 20 foot landscape buffer along road right -of-way and a 10 foot landscape buffer abutting adjacent agricultural property to allow no buffer on the perimeter of the property, to be mitigated by supplementary native plantings along portions of SR 29, for the Immokalee Solar project, which property is in the Agricultural -Mobile Home Overlay Rural Lands Stewardship Area Overlay (A-MHO RLSAO) zoning district and located on the east side of the intersection at SR 29 and SR 82 in Sections 4, 9 And 16, Township 46 South, Range 29 East, Collier County, Florida. [Coordinator: Timothy Finn, AICP, Principal Planner] Meeting Date: 05/26/2021 Prepared by: Title: – Zoning Name: Tim Finn 05/10/2021 2:16 PM Submitted by: Title: Planner, Principal – Zoning Name: Anita Jenkins 05/10/2021 2:16 PM Approved By: Review: Planning Commission Diane Lynch Review item Completed 05/10/2021 9:49 PM Growth Management Operations & Regulatory Management Donna Guitard Review Item Completed 05/11/2021 11:48 AM Zoning Ray Bellows Additional Reviewer Completed 05/12/2021 9:08 AM Zoning Anita Jenkins Zoning Director Review Completed 05/13/2021 1:18 PM Growth Management Department James C French Additional Reviewer Completed 05/13/2021 3:51 PM Planning Commission Edwin Fryer Meeting Pending 05/26/2021 9:00 AM 3.A.2 Packet Pg. 264 VA-PL20200002161 (Immokalee Solar Landscape Buffer Variance) Revised: May 7, 2021 Page 1 of 10 STAFF REPORT TO: COLLIER COUNTY PLANNING COMMISSION FROM: GROWTH MANAGEMENT DEPARTMENT ZONING DIVISION- ZONING SERVICES SECTION HEARING DATE: MAY 26, 2021 SUBJECT: PETITION VA-PL20200002161; IMMOKALEE SOLAR LANDSCAPE BUFFER VARIANCE COMPANION ITEM: CU-20200001865; IMMOKALEE SOLAR CONDITIONAL USE _____________________________________________________________________________ PROPERTY OWNER/CONTRACT PURCHASER/AGENT: Owner: Contract Purchaser: Barron Collier Partnership 2600 Golden Gate Parkway, Suite 200 Naples, FL 34105 Scott Scovill Florida Power and Light Company 700 Universe Boulevard Juno Beach, FL 33408 Agent: Alexis Crespo, AICP Waldrop Engineering, P.A. 28100 Bonita Grande Drive Bonita Springs, FL 34135 Note: FPL is also an applicant REQUESTED ACTION: To have the Collier County Planning Commission (CCPC) consider a variance from Section 4.06.02.c Table 2.4 of the Collier County Land Development Code which requires a 20 foot landscape buffer along road right-of-way and a 10 foot landscape buffer abutting adjacent agricultural property to allow no buffer on the perimeter of the property, to be mitigated by supplementary native plantings along portions of SR 29, for the Immokalee Solar project, which property is in the Agricultural-Mobile Home Overlay Rural Lands Stewardship Area Overlay (A- MHO RLSAO) zoning district. GEOGRAPHIC LOCATION: The subject property is 578 +/- acres and is located on the east side of the intersection at SR 29 and SR 82 in Sections 4, 9 and 16, Township 46 South, Range 29 East, Collier County, Florida. (See location map on the following page) 3.A.2.a Packet Pg. 265 Attachment: Staff Report - Immokalee Solar Buffer Variance (15587 : PL20200002161 Immokalee Solar VA) VA-PL20200002161 (Immokalee Solar Landscape Buffer Variance) Revised: May 7, 2021 Page 2 of 10 3.A.2.aPacket Pg. 266Attachment: Staff Report - Immokalee Solar Buffer Variance (15587 : PL20200002161 Immokalee Solar VA) VA-PL20200002161 (Immokalee Solar Landscape Buffer Variance) Revised: May 7, 2021 Page 3 of 10 PURPOSE/DESCRIPTION OF PROJECT: Variance from Land Development Code LDC Section 4.06.02.C Table 2.4 Table of Buffer Requirements by Land Use Classifications, which requires a 20’ Type D Buffer where Public Use abuts Right-Of-Way and a 10’ Type A Buffer where a Public Use abuts Agriculture; whereas the Applicant is requesting no buffers required surrounding the perimeter of the subject property. Development of the project will comply with all other RLSA zoning district requirements and conditions set forth in the companion Conditional Use approval. The Applicant is proffering supplemental native plantings in accordance with attached exhibit, and the following condition of approval: 1. Supplemental native plantings will be planted in locations shown on the Supplemental Native Plantings Exhibit, Sheet C-100. (See Attachment A) 2. The supplemental plantings must consist of native species, proposed as red tip cocoplum or Walter’s viburnum, with installation specifications and spacing as shown on the Supplemental Native Plantings Exhibit, Sheet C-100. (See Attachment A) 3. Site preparation must include removal of non-native vegetation that will compete with newly planted plantings. Site preparation may be necessary to adequately prepare the site for planting. Site preparation may include such activities as re-contouring, disking, roller chopping, bush hogging, prescribed burning, herbiciding, or other recognized vegetation management activities. 4. Fertilization and appropriate watering are required at time of planting as shown on Supplemental Native Planting Exhibit, Sheet C-101. (See Attachment A) SURROUNDING LAND USE AND ZONING: This section of the staff report identifies the land uses and zoning classifications for properties surrounding the boundaries of the subject property, which is developed agricultural and zoned Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO): North: Developed agricultural, with a current zoning designation of Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO) East: Developed agricultural, with a current zoning designation of Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO) South: Developed agricultural, with a current zoning designation of Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO) South: SR-29 (two-lane state road), then developed as agricultural and sparce single family residential with a current zoning designation of Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO 3.A.2.a Packet Pg. 267 Attachment: Staff Report - Immokalee Solar Buffer Variance (15587 : PL20200002161 Immokalee Solar VA) VA-PL20200002161 (Immokalee Solar Landscape Buffer Variance) Revised: May 7, 2021 Page 4 of 10 Jacobs Engineering Group, Inc. 3.A.2.a Packet Pg. 268 Attachment: Staff Report - Immokalee Solar Buffer Variance (15587 : PL20200002161 Immokalee Solar VA) VA-PL20200002161 (Immokalee Solar Landscape Buffer Variance) Revised: May 7, 2021 Page 5 of 10 GROWTH MANAGEMENT PLAN (GMP) CONSISTENCY: The subject property is located within the Agricultural/Rural Designation; Rural Lands Stewardship Area Overlay (RLSA) on the Future Land Use Map of the Growth Management Plan. As previously noted, Florida Power and Light, Inc. (Applicant) is requesting approval of a Conditional Use to allow a solar power plant on 578+/- acres of land (Property) located directly to the east of the SR 29 and SR 82 intersection in unincorporated Collier County, Florida. The subject use is consistent with the FLUM of the GMP. The requested variance does not have any impact on this property's consistency with the County's GMP. STAFF ANALYSIS: The proposed solar power field has more than two (2) miles of frontage on SR 29, all of which contain areas of existing vegetation, and in some areas, wetland preserves. The western boundary of the project is 11,675+/- linear feet or 2.2+/- miles total. The significant frontage is unusual for any kind of project and providing a 2+ mile right-of-way buffer is unnecessary and will be burdensome and cost-prohibitive to the Applicant, a cost which will ultimately be passed on to the consumer, or the public. Although the areas of existing vegetation are on the FDOT right-of-way property, the vegetation does exist and would effectively block views of any buffer planted along the perimeter of the project. As depicted on the enclosed Cross Sections, Line of Sight Exhibit, and boundary survey, the project’s frontage on SR 29 is encumbered by a 10-foot-wide utility easement that explicitly prohibits plantings, further reducing any potential plantable area along this significantly large boundary. The easement document is provided to demonstrate the strict language prohibiting plantings within the easement. The companion CU proposes an enhanced 100-foot setback from the project boundary. This setback is above what is required by the LDC and mitigates impact to viewsheds, thus off-setting the impact of this variance request. In addition to the significant setback from SR 29, there is a noticeable elevation difference between the project boundary and the existing conditions on SR 29, where the site is much lower than the travel lanes of the roadway. Due to the difference in elevation, the solar panels are lower to the ground, and visibility will be limited from any surrounding properties. The project will not utilize fill dirt to raise the solar panels up as is typical on most residential or commercial projects. This is demonstrated on the Cross Section and Line of Sight to assist in Staff’s review of this request. While the existing vegetation in the SR 29 right-of-way provides substantial vegetation and screening of the subject property along the majority of the western property line, it is understood there are some locations where the existing vegetation is sparse and may not completely obstruct views of the solar panels. To off-site this impact, the Applicant is proposing supplementary native plantings in portions of the SR 29 frontage where vegetation is deemed inadequate. The Supplemental Native Planting Exhibit, Sheet C-100, provides the location of these supplemental native plantings, and planting specifications. Stormwater Review: No adverse impacts to the Collier County stormwater conveyance systems or 3.A.2.a Packet Pg. 269 Attachment: Staff Report - Immokalee Solar Buffer Variance (15587 : PL20200002161 Immokalee Solar VA) VA-PL20200002161 (Immokalee Solar Landscape Buffer Variance) Revised: May 7, 2021 Page 6 of 10 adjacent properties are anticipated from the proposed Immokalee solar landscape buffer variance and conditional use. Landscape Review: The applicant has demonstrated that the requirement for formal landscape buffers can be waived without any detrimental effects. The applicant has demonstrated in their exhibits the locations along the adjacent road that would allow visibility of the solar panels and has committed to plantings in these locations. The plantings proposed as part of the variance are species that attain a height and spread that, at maturity, will provide a greater opacity than the LDC required buffer. The LDC required buffer would only include trees 30’ on center. Environmental Review: Environmental Planning staff has reviewed the petition to address environmental concerns. The property is located within Rural Lands Stewardship Area Overlay (RLSAO) on lands designated as “Open.” The property has been historically cleared and used for agricultural uses since the early 1960’s. The minimum preserve requirement is 4.96 acres (40% of 12.4acres); the applicant has provided 5.74 acres of preservation onsite. The environmental data indicates the proposed project is in an area that has the potential to contain a variety of protected animal species. The two listed species observed onsite were American Alligator (Alligator mississippiensis) and Tricolored Heron (Egretta tricolor). The proposed project does not impact the existing habitats for the American Alligator since the project boundary does not include the large freshwater marshes areas located to the east of the subject property and preserves the remaining freshwater marshes within the subject property. It is anticipated that the suitable foraging habitat (freshwater marshes and drainage ditches) will not be impacted by the proposed project; therefore, any Tricolored Heron utilizing the site will be unaffected by the proposed project. The subject property is located within core foraging ranges for three Wood stork (Mycteria americana) colonies and contains foraging habitat for the Florida Sandhill Crane (Antigone candensis pratensis). Suitable foraging habitat for both the Florida Sandhill Crane and Wood Stork is present within the subject property (Drainage ditches, preserved marsh areas); however, no individuals were observed onsite. The proposed project is located within the U.S. Fish and Wildlife Service (FWS) consultation area for Bonneted Bat (Eumops floridanus). Although there are native vegetated areas present onsite, no evidence was found indicating the trees were being utilized by Bonneted Bat. Finally, the property contains potential habitat for caracara (Caracara cheriway); however, no caracara was observed onsite. Consultation with the US Federal Wildlife Service (USFWS) and the Florida Fish and Wildlife Conservation Commission (FWCC) regarding guidelines and permitting requirements will be required prior to construction. The Florida Fish and Wildlife Conservation Commission (FWC) wildlife data indicates the presence of Black Bear (Ursus americanus floridanus) in the area. A black bear management plan will need to be included at PPL or SDP review to provide awareness for employees working onsite. The Environmental Data indicates the subject property falls within (FWS) Secondary Florida Panther (Felis concolor coryi) habitat. There were no observations of panther onsite and the telemetry data indicates Florida panther are not abundant within the boundary of the proposed project. The property contains habitats preferred by the Florida panther, including 4 acres of 3.A.2.a Packet Pg. 270 Attachment: Staff Report - Immokalee Solar Buffer Variance (15587 : PL20200002161 Immokalee Solar VA) VA-PL20200002161 (Immokalee Solar Landscape Buffer Variance) Revised: May 7, 2021 Page 7 of 10 Cabbage Palm (FLUCFCS 428) and 7.8 acres of Freshwater Marshes (FLUCFCS 641); therefore, consultation with FWS to obtain panther mitigation may be required. Prior to approval of the first development order, a second protected species survey of the subject property will be required to ensure construction activity will not impact listed species. The second listed species survey will primarily be focused on avian species; however, all listed species will be evaluated for their presence in and adjacent to the subject property. Environmental Services staff recommends approval of the proposed petition. Conservation and Coastal Management Element (CCME): Environmental review staff has found this project to be consistent with the Conservation & Coastal Management Element (CCME). The project site consists of 12.4 acres of native vegetation. A minimum of 4.96 (40%) acres of native vegetation shall be placed under preservation and dedicated to Collier County. Section 9.04.01 of the Land Development Code gives the Board of Zoning Appeals (BZA) the authority to grant Variances. The Planning Commission is advisory to the BZA and utilizes the provisions of Section 9.04.03 A. through H. (in bold font below), as general guidelines to assist in making their recommendation of approval or denial. Staff has analyzed this petition relative to these provisions and offers the following responses: a. Are there special conditions and circumstances existing, which are peculiar to the location, size and characteristics of the land, structure or building involved? Yes, the project has a unique boundary, which is extremely circuitous in nature and was designed to omit the surrounding wetlands. Very few parcels are created to follow a jurisdictional wetland boundary. The project boundary is unique in this sense and creates significant and expansive areas of spatial separation between the project boundary and the properties north, east, and in some areas along the west, of the wetland system. The SR 29 project frontage also contains a 10-foot easement directly adjacent to the FDOT right-of-way that prohibits plantings. The easement language is fairly unique as well in that it prohibits all plantings except for citrus crop. Most utility easements allow for certain species to be planted. It is also unique that the project contains over two (2) miles of frontage on this state- maintained arterial roadway. Literal interpretation of the Buffer Table creates a significant buffer requirement for a land use with special conditions and characteristics. To offset the impact of the request, the Applicant is proposing supplementary native plantings in specific locations along the SR 29 frontage, totaling 6,000+ linear feet, where existing vegetation may be sparse. The plantings will not conflict with the LCEC easement and will provide for additional visual mitigation in strategic locations along SR 29. b. Are there special conditions and circumstances, which do not result from the action of the applicant such as pre-existing conditions relative to the property, which are the subject of the Variance request? 3.A.2.a Packet Pg. 271 Attachment: Staff Report - Immokalee Solar Buffer Variance (15587 : PL20200002161 Immokalee Solar VA) VA-PL20200002161 (Immokalee Solar Landscape Buffer Variance) Revised: May 7, 2021 Page 8 of 10 Yes, the unique project boundary was created decades ago for the purposes of using the land for citrus crops and agricultural uses and was not due to the action of the Applicant. c. Will a literal interpretation of the provisions of this zoning code work unnecessary and undue hardship on the applicant or create practical difficulties for the applicant? Yes, literal interpretation of the Table of Buffer Requirements by Land Use Classification will result in the project providing more than 9 miles of landscaping and irrigation for a land use that does not in any way necessitate screening and buffering based on the existing and proposed conditions shown in the Cross Section and Line of Sight. The intent and purpose of the buffering and screening code will be met by the project as proposed. Thus, a literal interpretation of the provision will put an undue and unnecessary hardship on the Applicant. d. Will the Variance, if granted, be the minimum Variance that will make possible the reasonable use of the land, building or structure and which promote standards of health, safety, and welfare? The variance that is being requested is the minimum required to allow the property owner to develop the property with the solar power field while maintaining compliance with all other RLSAO district standards and compatibility with the surrounding properties. Allowing this variance will meet the purpose and intent of landscape buffering standards to reduce the potential incompatibility of adjacent land uses; promote preservation and planting of native plants and plant communities; and conserve natural resources and maintain open space, while allowing the Applicant to make reasonable use of their land. Also, as noted above, the Applicant is proposing supplementary native plantings in specific locations along the SR 29 frontage where existing vegetation is sparse to further promote public health, safety, and welfare, and seek the minimum relief necessary for the project. e. Will granting the Variance confer on the applicant any special privilege that is denied by these zoning regulations to other lands, buildings, or structures in the same zoning district? No, the variance will not confer on the petitioner special privileges. The need for the variance is based upon the unique boundary of the project, unique conditions, and the proposed land use itself, and is entirely unique to this property and this request. f. Will granting the Variance be in harmony with the general intent and purpose of this Land Development Code, and not be injurious to the neighborhood, or otherwise detrimental to the public welfare? The zoning code’s intention is to provide separation and screening from incompatible and negative land uses. Approval of this variance will not result in negative impacts on surrounding viewsheds based upon the Line of Sight provided in this submittal. The use itself is a public benefit and will provide an overall economic benefit to the County by ultimately lowering the utility bills of those FPL customers. The project will also provide 3.A.2.a Packet Pg. 272 Attachment: Staff Report - Immokalee Solar Buffer Variance (15587 : PL20200002161 Immokalee Solar VA) VA-PL20200002161 (Immokalee Solar Landscape Buffer Variance) Revised: May 7, 2021 Page 9 of 10 an economic boost to the local economy and Immokalee area and provide for clean energy to the community. Requiring significant landscape buffers adds a substantial cost to the public use project. To ensure the variance is in harmony with the intent of the code, and protects the neighborhood and SR 29 viewsheds, Applicant is proposing supplementary native plantings in specific locations along the SR 29 frontage where existing vegetation is sparse. g. Are there natural conditions or physically induced conditions that ameliorate the goals and objectives of the regulation such as natural preserves, lakes, golf courses, etc.? Yes, the subject property abuts SR 29 on the west and wetland preserve areas on the north, east, and west. The developable area of the project site is the result of the historical use of the property for agricultural purposes. The surrounding wetlands create expansive areas where the project is physically separated from the surrounding agricultural lands. The location of SR 29 along the project’s entire western boundary is also a physical condition that would require the Applicant to provide more than 2 miles of buffering and screening based on a literal interpretation that does not take into account the unique nature of the land use and the existing conditions of the site. h. Will granting the Variance be consistent with the GMP? The variance request is consistent with the goals, objectives, and policies in the Growth Management Plan, including maintaining areas of open space in the RLSA-designated lands. ENVIRONMENTAL ADVISORY COUNCIL (EAC) RECOMMENDATION This project does not require Environmental Advisory Council (EAC) review, as this project did not meet the EAC scope of land development project reviews as identified in Section 2 -1193 of the Collier County Codes of Laws and Ordinances. COUNTY ATTORNEY OFFICE REVIEW: The County Attorney Office has reviewed the staff report for PL20200002161 revised on May 7, 2021. RECOMMENDATION: Staff recommends that the Collier County Planning Commission (CCPC) approve Petition VA- PL20200002161, Immokalee Solar Landscape Buffer Variance from Section 4.06.02.c Table 2.4 of the Collier County Land Development Code which requires a 20 foot landscape buffer along road right-of-way and a 10 foot landscape buffer abutting adjacent agricultural property to allow no buffer on the perimeter of the property, to be mitigated by supplementary native plantings along portions of SR 29, for the Immokalee Solar project, per the following conditions of approval: 3.A.2.a Packet Pg. 273 Attachment: Staff Report - Immokalee Solar Buffer Variance (15587 : PL20200002161 Immokalee Solar VA) VA-PL20200002161 (Immokalee Solar Landscape Buffer Variance) Revised: May 7, 2021 Page 10 of 10 1. Supplemental native plantings will be planted in locations shown on the Su pplemental Native Plantings Exhibit, Sheet C-100. 2. The supplemental plantings must consist of native species, proposed as red tip cocoplum or Walter’s viburnum, with installation specifications and spacing as shown on the Supplemental Native Plantings Exhibit, Sheet C-100. 3. Site preparation must include removal of non-native vegetation that will compete with newly planted plantings. Site preparation may be necessary to adequately prepare the site for planting. Site preparation may include such activities as re-contouring, disking, roller chopping, bush hogging, prescribed burning, herbiciding, or other recognized vegetation management activities. 4. Fertilization and appropriate watering are required at time of planting as shown on Supplemental Native Planting Exhibit, Sheet C-101. Attachments: A) Proposed Resolution B) Backup Materials 3.A.2.a Packet Pg. 274 Attachment: Staff Report - Immokalee Solar Buffer Variance (15587 : PL20200002161 Immokalee Solar VA) 3.A.2.b Packet Pg. 275 Attachment: Attachment A - Proposed Resolution (15587 : PL20200002161 Immokalee Solar VA) 3.A.2.b Packet Pg. 276 Attachment: Attachment A - Proposed Resolution (15587 : PL20200002161 Immokalee Solar VA) 3.A.2.b Packet Pg. 277 Attachment: Attachment A - Proposed Resolution (15587 : PL20200002161 Immokalee Solar VA) 3.A.2.b Packet Pg. 278 Attachment: Attachment A - Proposed Resolution (15587 : PL20200002161 Immokalee Solar VA) 3.A.2.b Packet Pg. 279 Attachment: Attachment A - Proposed Resolution (15587 : PL20200002161 Immokalee Solar VA) 3.A.2.b Packet Pg. 280 Attachment: Attachment A - Proposed Resolution (15587 : PL20200002161 Immokalee Solar VA) W W W W W O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HXX X XX X X X X X X X X XX XXXXX XXXXX X XXXX X X X XX X X XXXX X X XXX X X X X X X XXXXXXXXXX X X XXXXXXXX X X XXXXXXXX XXX XX X XXX X X XXX XX XXXX X XXXX XXXX XXXX X XX XX XXXX X X X XX X XXXXXXXXXXXXXX X X XXXXXXXXXXXXXXXXXXXXXX X XX X X X X X X X X XXX O/H O/H O/H O/H O/H O/H O/H O/H GATE TYPICAL HEDGE 10' 4'2'ALTERNATING 500 FOOT HEDGE SECTIONS HEDGE SPECIES #1 QTY: 750 6 HEDGE SECTIONS @ 500' LONG CHRYSOBALANUS ICACO 'RED TIP' RED TIP COCOPLUM 10 G - 36" HEIGHT X 24" WIDTH, 48" ON CENTER HEDGE SPECIES #2 QTY: 750 6 HEDGE SECTIONS @ 500' LONG VIBURNUM OBOVATUM WALTER'S VIBURNUM 10 G - 36" HEIGHT X 24" WIDTH, 48" ON CENTER EXISTING GROUND EXISTING ACCESS PATH 10' SOLAR ACCESS PATH20'6' TALL PANTHER FENCE BY OTHERS MULCH LINE MULCH AREA 6' TALL PANTHER FENCE BY OTHERS HEDGE MULCH LINE 10' 4'2'EXISTING GROUND EXISTING DITCH TOB EXISTING DITCH TOE MULCH AREA 20'ALTERNATING 500 FOOT HEDGE SECTIONS HEDGE SPECIES #1 QTY: 750 6 HEDGE SECTIONS @ 500' LONG CHRYSOBALANUS ICACO 'RED TIP' RED TIP COCOPLUM 10 G - 36" HEIGHT X 24" WIDTH, 48" ON CENTER HEDGE SPECIES #2 QTY: 750 6 HEDGE SECTIONS @ 500' LONG VIBURNUM OBOVATUM WALTER'S VIBURNUM 10 G - 36" HEIGHT X 24" WIDTH, 48" ON CENTER PROJECT NO: DATE: SHEET TITLE SHEET THIS LINE IS ONE INCH LONG WHEN PLOTTED FULL SCALE THIS DRAWING MUST BE USED IN CONJUNCTION WITH THE APPLICABLE OR GOVERNING TECHNICAL SPECIFICATIONS AND OTHER CONTRACT DOCUMENTS. DISC. LEAD: DESIGNER: CHECKER:REV DATEREVISION DESCRIPTION1 A B C D E F 2 3 4 5 6 7 8 3300 PGA BLVD, SUITE 780 PALM BEACH GARDENS, FL 33410PHONE: 561.799.3855FLORIDA C.O.A. #2822DRAWING NO.OFDESIGN ENGINEER:DAVID O. SCOTT, PE.FLORIDA REGISTRATION NO. 58166EEXJ0411 MARCH 2021 FLORIDA POWER & LIGHT COMPANYSOLAR ENERGY CENTERFPL IMMOKALEE DOS JCH SUPPLEMENTARY PLANTING EXHIBIT C-10012 MARCH 2021 AGI AGISR 82 SR 29SR 29PROPOSED SOLAR SITE PROPOSED BUFFER VARIANCE PLANTINGS 6 FT SITE PANTHER FENCE PROPOSED BUFFER VARIANCE PLANTINGS PROPOSED BUFFER VARIANCE PLANTINGS 6 FT PANTHER SITE FENCE APPROXIMATE LENGTH OF BUFFER PLANTINGS = 6000 FEET PERIMETER HEDGE GATE BREAK DETAIL N.T.S. PERIMETER HEDGE DITCH BREAK DETAIL N.T.S. NO BUFFER REQUIRED NO BUFFER REQUIRED NO BUFFER REQUIREDExhibit B3.A.2.b Packet Pg. 281 Attachment: Attachment A - Proposed Resolution (15587 : PL20200002161 Immokalee Solar VA) Elevation (ft NAVD)Station 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 -0+50 0+00 0+50 1+00 1+50 2+00 2+50 3+00 3+50 44 45 1 1 Elevation (ft NAVD)Station 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 -0+50 0+00 0+50 1+00 1+50 2+00 2+50 3+00 3+50 4+00 45 46 47 48 1 1 45° SCARIFY WALLS AND BOTTOM OF PLANT PIT DEPTH VARIES DEPENDING ON ROOTBALL HEIGHT. PLANT SHRUB w/ROOT CROWN AT SOIL SURFACE LIGHTLY TAMP PIT BOTTOM TO PREVENT SETTLING MULCH - 3" DEPTH SHREDDED HARDWOOD. KEEP 2"-3" AWAY FROM STEM. DO NOT CYPRESS. FINISH GRADE EXISTING ADJACENT GRASS AREA 3X BALL DIAMETER 6' TALL PANTHER FENCE BY OTHERS HEDGE 2'2' 10' CAN BE BACKFILLED WITH NATIVE SOIL AS LONG AS THE NATIVE SOIL MEETS FDOT SPEC 987-2.4. OTHERWISE MUST USE PREPARED TOPSOIL: BACKFILL WITH A MIX OF 70/30 CLEAN SAND AND MUCK. WATER THOROUGHLY DURING INSTALLATION. DO NOT FERTILIZE.PROJECT NO: DATE: SHEET TITLE SHEET THIS LINE IS ONE INCH LONG WHEN PLOTTED FULL SCALE THIS DRAWING MUST BE USED IN CONJUNCTION WITH THE APPLICABLE OR GOVERNING TECHNICAL SPECIFICATIONS AND OTHER CONTRACT DOCUMENTS. DISC. LEAD: DESIGNER: CHECKER:REV DATEREVISION DESCRIPTION1 A B C D E F 2 3 4 5 6 7 8 3300 PGA BLVD, SUITE 780 PALM BEACH GARDENS, FL 33410PHONE: 561.799.3855FLORIDA C.O.A. #2822DRAWING NO.OFDESIGN ENGINEER:DAVID O. SCOTT, PE.FLORIDA REGISTRATION NO. 58166EEXJ0411 FEBRUARY 2021 FLORIDA POWER & LIGHT COMPANYSOLAR ENERGY CENTERFPL IMMOKALEE ---- ---- ---- DOS JCH SUPPLEMENTARY PLANTING EXHIBIT SECTIONS C-10122 STATE ROAD 29 EXISTING STATE ROAD 29 DRAINAGE DITCH PERIMETER BERM & EXISTING ACCESS ROAD EXISTING GROVE DRAINAGE DITCH SOLAR PANEL PROPERTY LINE OVERHEAD ELECTRICAL (ESTIMATED FROM SURVEY AND AERIALS) 10' OHE EASEMENT - NO PLANTINGS ALLOWED PROPOSED SOLAR GRADE SOLAR ACCESS PATH +/- 38.5' +/- 33.4' +/- 40.0' +/- 31.8'+/- 33.9' PROPOSED BUFFER VARIANCE PLANTINGS AT FULL HEIGHT 10' FROM EXISTING PATH TO PLANTINGS 10' PROPOSED SOLAR GRADE NO BUFFER LOCATION TYPICAL CROSS-SECTION 1H:5V STATE ROAD 29 EXISTING STATE ROAD 29 DRAINAGE DITCH PERIMETER BERM & EXISTING ACCESS PATH EXISTING GROVE DRAINAGE DITCH SOLAR PANEL EXISTING VEGETATION OUTSIDE PROPERTY PROPERTY LINE OVERHEAD ELECTRICAL 10' OHE EASEMENT - NO PLANTINGS ALLOWED 158' 5' SOLAR ACCESS PATH PROPOSED SOLAR GRADE +/- 39.6' +/- 35.6' +/- 41.0' +/- 32.6' +/- 36.9' SOLAR PANEL BUFFER LOCATION TYPICAL CROSS-SECTION 1H:5V TYPICAL PLANTING DETAIL N.T.S. TASK AMOUNT MINIMUM FREQUENCY WATERING MAINTAIN ADEQUATE SOIL MOISTURE TOKEEP PLANTS IN FLORIDA #1 CONDITION.CONTRACTOR TO SUPPLY WATER. WEEDING ALL MULCH AREAS.MONTHLY DURING THE WARRANTY PERIOD EDGING ALL SHRUB MULCHED BEDS MONTHLY DURING THE WARRANTY PERIOD WATERING AND MAINTENANCE SCHEDULE HAND WATER DAILY FOR THE FIRST MONTH WITH 2.5 GALLONS, PER SHRUB (EXCLUDING RAIN DAYS), THEN THREE TIMES A A WEEK FOR THE 2ND AND 3RD MONTHS, THEN AS NEEDED TO KEEP PLANTS HEALTHY DURING THE WARRANTY PERIOD. *IN ADDITION TO THE ROOT BALL, THE BACKFILLED SOIL MUST ALSO BE ADEQUATELY WATERED TO ENSURE THE SUCCESSFUL GROWTH OF THE NEW PLANTINGS 3.A.2.b Packet Pg. 282 Attachment: Attachment A - Proposed Resolution (15587 : PL20200002161 Immokalee Solar VA) 3.A.2.b Packet Pg. 283 Attachment: Attachment A - Proposed Resolution (15587 : PL20200002161 Immokalee Solar VA) CCPC PACKAGE IMMOKALEE SOLAR BUFFER VARIANCE VA-PL2020-2161 3.A.2.c Packet Pg. 284 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) APPLICATION FORM 3.A.2.c Packet Pg. 285 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252‐2400 FAX: (239) 252‐6358 4/27/2018 Page 1 of 6 VARIANCE PETITION APPLICATION Variance from Setbacks Required for a Particular Zoning District LDC section 9.04.00 & Code of Laws section 2‐83 – 2‐90 Chapter 3 J. of the Administrative Code PROJECT NUMBER PROJECT NAME DATE PROCESSED APPLICANT CONTACT INFORMATION Name of Property Owner(s): ______________________________________________________ Name of Applicant if different than owner: __________________________________________ Address: _________________________City: ________________ State: _______ ZIP: ________ Telephone: ___________________ Cell: ____________________ Fax: ____________________ E‐Mail Address: ________________________________________________________________ Name of Agent: ________________________________________________________________ Firm: _________________________________________________________________________ Address: ___________________________City: ________________ State: _______ ZIP: ______ Telephone: ____________________ Cell: ___________________ Fax: ____________________ E‐Mail Address: ________________________________________________________________ BE AWARE THAT COLLIER COUNTY HAS LOBBYIST REGULATIONS. GUIDE YOURSELF ACCORDINGLY AND ENSURE THAT YOU ARE IN COMPLIANCE WITH THESE REGULATIONS. To be completed by staff 3.A.2.c Packet Pg. 286 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 4/27/2018 Page 2 of 6 PROPERTY INFORMATION Provide a detailed legal description of the property covered by the application: (If space is inadequate, attach on separate page) Property I.D. Number: ____________________ Section/Township/Range: / / Subdivision: _____________________________________ Unit: _____Lot: Block: Metes & Bounds Description: __________________________________ Total Acreage: ______ Address/ General Location of Subject Property: ______________________________________ ______________________________________________________________________________ ADJACENT ZONING AND LAND USE Zoning Land Use N S E W Minimum Yard Requirements for Subject Property: Front: Corner Lot: Yes No Side: Waterfront Lot: Yes No Rear: Chapter 8 of the Administrative Code requires that the applicant must remove their public hearing advertising sign(s) after final action is taken by the Board of County Commissioners. Based on the Board's final action on this item, please remove all public hearing advertising sign(s) immediately. 3.A.2.c Packet Pg. 287 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 4/27/2018 Page 3 of 6 ASSOCIATIONS Complete the following for all registered Association(s) that could be affected by this petition. Provide additional sheets if necessary. Information can be found on the Board of County Commissioner’s website at http://www.colliergov.net/Index.aspx?page=774. Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: _____ NATURE OF PETITION On a separate sheet, attached to the application, please provide the following: 1. A detailed explanation of the request including what structures are existing and what is proposed; the amount of encroachment proposed using numbers, i.e. reduce front setback from 25 ft. to 18 ft.; when property owner purchased property; when existing prin cipal structure was built (include building permit number(s) if possible); why encroachment is necessary; how existing encroachment came to be; etc. 2. For projects authorized under LDC Section 9.04.02, provide a detailed description of site alterations, including any dredging and filling. 3. Pursuant to LDC section 9.04.00, staff shall be guided in their recommendation to the Hearing Examiner, and the Hearing Examiner shall be guided in the determination to approve or deny a variance petition by the criteria (a-h) listed below. Please address the following criteria: a) Are there special conditions and circumstances existing which are peculiar to the location, size and characteristics of the land, structure, or building involved. 3.A.2.c Packet Pg. 288 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 4/27/2018 Page 4 of 6 b) Are there special conditions and circumstances which do not result from the action of the applicant such as pre-existing conditions relative to the property which is the subject of the variance request. c) Will a literal interpretation of the provisions of this zoning code work unnecessary and undue hardship on the applicant or create practical difficulties on the applicant. d) Will the variance, if granted, be the minimum variance that will make possible the reasonable use of the land, building or structure and which promote standards of health, safety or welfare. e) Will granting the variance requested confer on the petitioner any special privilege that is denied by these zoning regulations to other lands, buildings, or structures in the same zoning district. f) Will granting the variance be in harmony with the intent and purpose of this zoning code, and not be injurious to the neighborhood, or otherwise detrimental to the public welfare. g) Are there natural conditions or physically induced conditions that ameliorate the goals and objectives of the regulation such as natural preserves, lakes, golf course, etc. h) Will granting the variance be consistent with the Growth Management Plan? 4. Official Interpretations or Zoning Verifications: To your knowledge, has there been an official interpretation or zoning verification rendered on this property within the last year? Yes No If yes, please provide copies. 3.A.2.c Packet Pg. 289 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 4/27/2018 Page 5 of 6 Pre-Application Meeting and Final Submittal Requirement Checklist for: Variance Chapter 3 J. of the Administrative Code The following Submittal Requirement Checklist is to be utilized during the Pre-Application Meeting and at time of application submittal. At time of submittal, the checklist is to be completed and submitted with the application packet. Please provide the submittal items in the exact order listed below with cover sheets attached to each section. Incomplete submittals will not be accepted. REQUIREMENTS FOR REVIEW # OF COPIES REQUIRED NOT REQUIRED Completed Application (download current form from County website) Pre-Application Meeting Notes 1 Project Narrative Completed Addressing Checklist 1 Property Ownership Disclosure Form 1 Conceptual Site Plan 24” x 36” and one 8 ½ ” x 11” copy Survey of property showing the encroachment (measured in feet) 2 Affidavit of Authorization, signed and notarized 2 Deeds/Legal’s 3 Location map 1 Current aerial photographs (available from Property Appraiser) with project boundary and, if vegetated, FLUCFCS Codes with legend included on aerial 5 Historical Survey or waiver request 1 Environmental Data Requirements or exemption justification 3 Once the first set of review comments are posted, provide the assigned planner the Property Owner Advisory Letter and Certification 1 Electronic copy of all documents and plans *Please advise: The Office of the Hearing Examiner requires all materials to be submitted electronically in PDF format. 1 ADDITIONAL REQUIREMENTS FOR THE PUBLIC HEARING PROCESS: • Following the completion of the review process by County review staff, the applicant shall submit all materials electronically to the designated project manager. • Please contact the project manager to confirm the number of additional copies required. 3.A.2.c Packet Pg. 290 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) 3.A.2.c Packet Pg. 291 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) COVER LETTER/ REQUEST NARRATIVE 3.A.2.c Packet Pg. 292 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) Immokalee Solar Buffer Variance Cover Letter/Request Narrative Page 1 of 8 November 30, 2020 REVISED MARCH 15, 2021 Timothy Finn, AICP Senior Planner Collier County Growth Management Division 2800 Horseshoe Drive North Naples, Florida 34104 RE: Florida Power & Light Immokalee Solar Project Buffer Variance (PL20200002161) Dear Mr. Finn: On behalf of Florida Power and Light, Inc. (Applicant), enclosed please find a variance petition relating to the perimeter landscape buffers for the Immokalee Solar project (Subject Property). The Subject Property is 578+/- acres of land located directly to the east of the SR 29 and SR 82 intersection in unincorporated Collier County, Florida. The Property is zoned Agricultural-Mobile Home Overlay Rural Lands Stewardship Area Overlay (A-MHO RLSAO) and is designated as Agriculture/Rural Mixed Use District Rural Lands Stewardship Overlay Area (RLSA) on the Future Land Use Map. The Applicant has filed a companion Conditional Use petition (PL20200001865) for the Property to allow for an “Electric or Gas Generating Plant”, or what is more commonly known as a solar power field. This essential service is permitted in the RLSA, excluding Habitat Stewardship Areas (HSAs) and Flowway Stewardship Areas (FSAs) as a Conditional Use. The Property is not located within an HSA or FSA. PROPERTY INFORMATION/HISTORY: The Property’s existing land use is agricultural/citrus crops. Historically, as evidenced on aerial imagery, the property has been utilized for agricultural purposes for decades. The unique project boundary ensures the existing Above Ground Impoundment (AGI) system surrounding the property remains intact and continues to manage stormwater on the site as it has done so previously for the agricultural uses. Historical aerials are included in the environmental report prepared for this project and demonstrate the AGI that has been in place to support the agricultural development over the years. The project does not propose to impact these areas and will continue to maintain the existing wetland flow way functions through the project as required for wetlands within the RLSA Open lands. These areas provide substantial screening and buffering of the propose solar field from adjacent agricultural lands. REQUEST: The Applicant is requesting the following variance from the buffer requirements set forth in the Land Development Code: 3.A.2.c Packet Pg. 293 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) Immokalee Solar Buffer Variance Cover Letter/Request Narrative Page 2 of 8 1. Variance from Land Development Code LDC Section 4.06.02.C Table 2.4 Table of Buffer Requirements by Land Use Classifications, which requires a 20’ Type D Buffer where Public Use abuts Right-Of-Way and a 10’ Type A Buffer where a Public Use abuts Agriculture; whereas the Applicant is requesting no buffers required surrounding the perimeter of the subject property. Development of the project will comply with all other RLSA zoning district requirements and conditions set forth in the companion Conditional Use approval. The Applicant is proffering supplemental native plantings in accordance with attached exhibit, and the following condition of approval: 1. Supplemental native plantings will be planted in locations shown on the Supplemental Native Plantings Exhibit, Sheet C-100. 2. The supplemental plantings must consist of native species, proposed as red tip cocoplum or Walter’s viburnum, with installation specifications and spacing as shown on the Supplemental Native Plantings Exhibit, Sheet C-100. 3. Site preparation must include removal of non-native vegetation that will compete with newly planted plantings. Site preparation may be necessary to adequately prepare the site for planting. Site preparation may include such activities as re-contouring, disking, roller chopping, bush hogging, prescribed burning, herbiciding, or other recognized vegetation management activities. 4. Fertilization and appropriate watering are required at time of planting as shown on Supplemental Native Planting Exhibit, Sheet C-101. ABOUT FPL & SOLAR POWER: The solar power plant will provide Collier County with a unique project that benefits the public by providing solar power to the overall power grid, which in time reduces the cost of power for all customers without generating toxic emissions. There are numerous benefits associated with each FPL solar project that include creating employment opportunities during construction, procurement of local resources when possible, economic boost to local businesses during construction, zero-emissions electricity generation, increased awareness of sustainable energy sources, and increased tax revenues for the county. FPL’s new solar plants generate zero emissions energy, using only the sun for fuel. When the sun is shining, the panels absorb the sunlight and convert it into direct current energy. The energy then flows through an inverter where it is transformed into alternating current electricity, the kind that is used in a residential home. The energy travels through FPL’s energy grid, where it is delivered to homes and businesses. The Applicant currently operates 28 solar power plants, two (2) that feature innovative energy storage, and hundreds of smaller solar installations. FPL’s solar power plants are the fastest and most cost-effective way to bring solar energy to more Floridians. Already one of the cleanest energy companies in the nation, FPL recently announced a groundbreaking ’30-by-30’ plan to install 30 million solar panels by 2030, making Florida a world leader in solar energy. This year, solar will outpace coal and oil combined as a percentage of FPL’s energy mix. In other words, soon FPL will be generating more energy from the sun than from power plants fueled by coal and oil. As Florida’s largest generator of solar power, FPL currently has approximately 2,000 megawatts of universal solar capacity, with more than 8 million solar panels installed, including the following sites across Florida: 3.A.2.c Packet Pg. 294 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) Immokalee Solar Buffer Variance Cover Letter/Request Narrative Page 3 of 8 • FPL Babcock Ranch Solar Energy and Battery Storage Center, Charlotte County • FPL Barefoot Bay Solar Energy Center, Brevard County • FPL Blue Cypress Solar Energy Center, Indian River County • FPL Citrus Solar Energy and Battery Storage Center, DeSoto County • FPL Coral Farms Solar Energy Center, Putnam County • FPL DeSoto Next Generation Solar Energy Center, DeSoto County • FPL Loggerhead Solar Energy Center, St. Lucie County • FPL Hammock Solar Energy Center, Hendry County • FPL Horizon Solar Energy Center, Alachua and Putnam counties • FPL Indian River Solar Energy Center, Indian River County • FPL Interstate Solar Energy Center, St. Lucie County • FPL Manatee Solar Energy Center, Manatee County • FPL Martin Next Generation Clean Energy Center (hybrid solar/natural gas), Martin County • FPL Miami-Dade Solar Energy Center, Miami-Dade County • FPL Pioneer Trail Solar Energy Center, Volusia County • FPL Space Coast Next Generation Solar Energy Center, Brevard County • FPL Sunshine Gateway Solar Energy Center, Columbia County • FPL Wildflower Solar Energy Center, DeSoto County • FPL Solar Circuit at Daytona International Speedway, Volusia County • Solar research installation at Florida International University, Miami-Dade County FPL’s 10 newest solar plants entered service in 2020 and are projected to generate millions in total system savings for customers during their operating lifetime. REQUEST JUSTIFICATION: The Immokalee Solar project will provide the public and County with the benefit of clean power as well as a compatible and complimentary land use that has virtually no impact from a traffic, noise, light or visual standpoint. The solar panels are relatively low to the ground (approximately 8 feet), and no buildings are proposed. For the reasons outlined below, the Applicant is seeking to eliminate the perimeter landscape buffers that are required based on a literal interpretation of the LDC Table of Buffer Requirements by Land Use Classification (Buffer Table). • Unique Land Use While the Buffer Table accounts for a “Public Use”, it does not account for a unique public use that does not contain vertical development such as the proposed solar power field. Examples of typical “public uses” for which this buffer would be applied are a wastewater treatment plant, an educational facility, sanitary landfills, detention facilities and jails, etc. As stated in LDC Section 2.03.05, Civic and Institutional Zoning Districts, “The purpose and intent of public use district (P) is to accommodate only local, state and federally owned or leased and operated government facilities that provide essential public services.” While the proposed essential service provides a public benefit, it is much less intensive than the typical range of “Public Use” intended in the Buffer Table. The use is classified as an “electric or gas generating plant”, and includes power plants which would contain vertical structures that would necessitate buffering and screening as the Buffer Table intends. Unlike the typical electric or gas generating plants, there are no structures 3.A.2.c Packet Pg. 295 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) Immokalee Solar Buffer Variance Cover Letter/Request Narrative Page 4 of 8 proposed other than the 6.5’ tall solar panels. thereby reducing any potential negative impacts and the need for the project to provide code-required perimeter landscape buffers. In terms of how unique this project is, the land use relies on sunlight to operate at its fullest capacity in order to generate power. The addition of trees surrounding the perimeter of the project will create shading that will directly affect the project’s ability to retain as much sunlight as possible through the solar panels. • SR 29 Frontage The proposed solar power field has more than two (2) miles of frontage on SR 29, all of which contain areas of existing vegetation, and in some areas, wetland preserves. The western boundary of the project, is 11,675+/- linear feet or 2.2+/- miles total. The significant frontage is unusual for any kind of project and providing a 2+ mile right-of-way buffer is unnecessary and will be burdensome and cost-prohibitive to the Applicant, a cost which will ultimately be passed on to the consumer, or the public. Although the areas of existing vegetation are on the FDOT right-of-way property, the vegetation does exist and would effectively block views of any buffer planted along the perimeter of the project. As depicted on the enclosed Cross Sections, Line of Sight Exhibit, and boundary survey, the project’s frontage on SR 29 is encumbered by a 10-foot-wide utility easement that explicitly prohibits plantings, further reducing any potential plantable area along this significantly large boundary. The easement document is provided to demonstrate the strict language prohibiting plantings within the easement. The companion CU proposes an enhanced 100-foot setback from the project boundary. This setback is above and beyond what is required by the LDC and mitigates impact to viewsheds, thus off-setting the impact of this variance request. In addition to the significant setback from SR 29, there is a noticeable elevation difference between the project boundary and the existing conditions on SR 29, where the site is much lower than the travel lanes of the roadway. Due to the difference in elevation, the solar panels are lower to the ground, and visibility will be limited from any surrounding properties. The project will not utilize fill dirt to raise the solar panels up as is typical on most residential or commercial projects. This is demonstrated on the Cross Section and Line of Sight to assist in Staff’s review of this request. While the existing vegetation in the SR 29 right-of-way provides substantial vegetation and screening of the subject property along the majority of the western property line, it is understood there are some locations where the existing vegetation is sparse and may not completely obstruct views of the solar panels. To off-site this impact, the Applicant is proposing supplementary native plantings in portions of the SR 29 frontage where vegetation is deemed inadequate. The Supplemental Native Planting Exhibit, Sheet C-100, provides the location of these supplemental native plantings, and planting specifications. • Surrounding Land Uses & Compatibility 3.A.2.c Packet Pg. 296 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) Immokalee Solar Buffer Variance Cover Letter/Request Narrative Page 5 of 8 The surrounding land uses are comprised of mostly rural agricultural lands and expansive areas of wetlands, with the nearest residential structure being approximately 440 feet from the closest solar panel development area. The project’s unique boundary is adjacent to wetlands on nearly the entire eastern and northern boundaries. These areas are zoned A- MHO RLSAO, but the land use itself is wetlands and not agricultural in nature. These wetland areas provide a substantial physical separation from the agricultural lands directly to the east and north with areas ranging in width from 1,000 to 2,500 feet. As previously stated, the project’s western boundary also contains pockets of wetland preserve areas providing physical separation from SR 29 with those areas ranging in size from 80-500 feet in width. The physical separation provided, the vegetation and screening from the natural wetland environment, the lack of vertical development or buildings in the project boundary, and the land use itself not creating any nuisance impacts including noise, lighting, or odor, uphold the intent of LDC Section 4.06.01.A.2., Buffering and Screening. Also, as noted above, the Applicant is proposing supplementary native plantings in specific locations along the SR 29 frontage where existing vegetation is sparse. Furthermore, LDC Section 4.06.01.A.2.K states “In order to minimize negative effects between adjacent land uses, this section promotes the use of landscape buffers and screens to eliminate or minimize potential nuisances such as dirt, litter, noise, lights, unsightly buildings and structures, and off-street parking and loading areas. Additionally, buffers and screens provide spacing and landscaping to reduce potentially adverse impacts of noise, odor, or lighting…” The project itself for which the LDC is requiring the perimeter buffers for is not a typical public use and will not produce any of the above-mentioned negative effects or potential nuisances. Solar energy centers are virtually silent, operate autonomously and require no water for operation or maintenance. The panels sit low to the ground, and the layout of the site is uniquely designed to avoid impacts to wetlands and preserve areas. A typical solar site is between 96 – 97 percent pervious, which allows most of the site to remain as open space, as the panels are raised slightly above the ground. In terms of off-street parking and loading areas, the solar center does not require staff to operate, so it will not bring traffic to the area after construction. The use itself does not generate any deliveries which would require a loading area that would necessitate screening and buffering to shield from any associated visual impacts. The project will not produce any odor that would impact neighboring properties. A solar energy center supports a clean and green method of producing energy. Unlike ground-level ozone and other pollutants produced by cars, power plants, industrial boilers, refineries, and chemical plants, a solar energy plant eliminates the potential for harmful toxic emissions caused by fossil fuels. Solar provides healthy air for future generations. In terms of glare, the Applicant will provide a Glint and Glare study at the time of Site Development Order approval, which outlines how the proposed solar panels create little glare due to the positioning of the panels and their significant setback from nearby roadways. The issue of glint and glare, as it pertains to photovoltaic systems, has been studied by the Federal Aviation Administration (FAA) and the US Air Force extensively. The Applicant takes precautionary design measures to ensure any glare from the placement of the solar panels does not cause travel hazards or impair the quality of life of the surrounding residences or buildings. The proposed 100-foot minimum setback of the solar panels from the project boundary will also assist in mitigating any visibility of glare by vehicles traveling north or south along SR 29. 3.A.2.c Packet Pg. 297 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) Immokalee Solar Buffer Variance Cover Letter/Request Narrative Page 6 of 8 VARIANCE CRITERIA: In addition to the justification provided above, the following is a detailed analysis of this request’s compliance with the variance review criteria set forth in LDC Section 9.04.03: 1. Are there special conditions and circumstances existing which are peculiar to the location, size and characteristics of the land, structure, or building involved. Yes, the project has a unique boundary, which is extremely circuitous in nature and was designed to omit the surrounding wetlands. Very few parcels are created to follow a jurisdictional wetland boundary. The project boundary is unique in this sense and creates significant and expansive areas of spatial separation between the project boundary and the properties north, east, and in some areas along the west, of the wetland system. The SR 29 project frontage also contains a 10-foot easement directly adjacent to the FDOT right-of-way that prohibits plantings. The easement language is fairly unique as well in that it prohibits all plantings except for citrus crop. Most utility easements allow for certain species to be planted. It is also unique that the project contains over two (2) miles of frontage on this state- maintained arterial roadway. Literal interpretation of the Buffer Table creates a significant buffer requirement for a land use with special conditions and characteristics. To offset the impact of the request, the Applicant is proposing supplementary native plantings in specific locations along the SR 29 frontage, totaling 6,000+ linear feet, where existing vegetation is may be sparse. The plantings will not conflict with the LCEC easement and will provide for additional visual mitigation in strategic locations along SR 29. 2. Are there special conditions and circumstances which do not result from the action of the applicant such as pre-existing conditions relative to the property which is the subject of the variance request. Yes, the unique project boundary was created decades ago for the purposes of using the land for citrus crops and agricultural uses, and was not due to the action of the Applicant. 3. Will a literal interpretation of the provisions of this zoning code work unnecessary and undue hardship on the applicant or create practical difficulties on the applicant. Yes, literal interpretation of the Table of Buffer Requirements by Land Use Classification will result in the project providing more than 9 miles of landscaping and irrigation for a land use that does not in any way necessitate screening and buffering based on the existing and proposed conditions shown in the Cross Section and Line of Sight. The intent and purpose of the buffering and screening code will be met by the project as proposed. Thus, a literal interpretation of the provision will put an undue and unnecessary hardship on the Applicant. 3.A.2.c Packet Pg. 298 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) Immokalee Solar Buffer Variance Cover Letter/Request Narrative Page 7 of 8 4. Will the variance, if granted, be the minimum variance that will make possible the reasonable use of the land, building or structure and which promote standards of health, safety or welfare. The variance that is being requested is the minimum required to allow the property owner to develop the property with the solar power field while maintaining compliance with all other RLSAO district standards and compatibility with the surrounding properties. Allowing this variance will meet the purpose and intent of landscape buffering standards to reduce the potential incompatibility of adjacent land uses; promote preservation and planting of native plants and plant communities; and conserve natural resources and maintain open space, while allowing the Applicant to make reasonable use of their land. Also, as noted above, the Applicant is proposing supplementary native plantings in specific locations along the SR 29 frontage where existing vegetation is sparse to further promote public health, safety and welfare, and seek the minimum relief necessary for the project. 5. Will granting the variance requested confer on the petitioner any special privilege that is denied by these zoning regulations to other lands, buildings, or structures in the same zoning district. No, the variance will not confer on the petitioner special privileges. The need for the variance is based upon the unique boundary of the project, unique conditions, and the proposed land use itself, and is entirely unique to this property and this request. 6. Will granting the variance be in harmony with the intent and purpose of this zoning code, and not be injurious to the neighborhood, or otherwise detrimental to the public welfare. The zoning code’s intention is to provide separation and screening from incompatible and negative land uses. Approval of this variance will not result in negative impacts on surrounding viewsheds based upon the Line of Sight provided in this submittal. The use itself is a public benefit and will provide an overall economic benefit to the County by ultimately lowering the utility bills of those FPL customers. The project will also provide an economic boost to the local economy and Immokalee area and provide for clean energy to the community. Requiring significant landscape buffers adds a substantial cost to the public use project. To ensure the variance is in harmony with the intent of the code, and protects the neighborhood and SR 29 viewsheds, Applicant is proposing supplementary native plantings in specific locations along the SR 29 frontage where existing vegetation is sparse. 7. Are there natural conditions or physically induced conditions that ameliorate the goals and objectives of the regulation such as natural preserves, lakes, golf course, etc. Yes, the subject property abuts SR 29 on the west and wetland preserve areas on the north, east, and west. The developable area of the project site is the result of the historical use of the property for agricultural purposes. The surrounding wetlands create expansive areas where the project is physically separated from the surrounding agricultural lands. The location of SR 29 along the project’s entire western boundary is also a physical condition that would require the Applicant to provide more than 2 miles of buffering and screening based on a literal interpretation that does not take into account the unique nature of the land use and the existing conditions of the site. 8. Will granting the variance be consistent with the Growth Management Plan 3.A.2.c Packet Pg. 299 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) Immokalee Solar Buffer Variance Cover Letter/Request Narrative Page 8 of 8 The variance request is consistent with the goals, objectives, and policies in the Growth Management Plan, including maintaining areas of open space in the RLSA-designated lands. Based upon the above analysis, the Applicant respectfully requests approval of this variance petition. The approval will uphold the intent of the Land Development Code and Growth Management Plan. The request complies with the variance review criteria, and will not negatively impact compatibility, public health, safety or welfare. If you have and further questions, please feel free to contact me directly at (239) 850-8525 or alexis.crespo@waldropengineering.com Sincerely, WALDROP ENGINEERING, P.A. Alexis V. Crespo, AICP Senior Vice President - Planning 3.A.2.c Packet Pg. 300 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) EASEMENT PROHIBITING PLANTINGS 3.A.2.c Packet Pg. 301 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) 3.A.2.c Packet Pg. 302 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) 3.A.2.c Packet Pg. 303 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) AFFIDAVITS 3.A.2.c Packet Pg. 304 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) Company 3.A.2.c Packet Pg. 305 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) 3.A.2.cPacket Pg. 306Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) 700 UNIVERSE BLVD. ATTN: CORP GOV JUNO BEACH, FL 33408 Current Principal Place of Business: Current Mailing Address: 700 UNIVERSE BLVD. JUNO BEACH, FL 33408 US Entity Name: FLORIDA POWER & LIGHT COMPANY DOCUMENT# 106395 FEI Number: NOT APPLICABLE Certificate of Status Desired: Name and Address of Current Registered Agent: LEE, DAVID M. 700 UNIVERSE BLVD. JUNO BEACH, FL 33408 US The above named entity submits this statement for the purpose of changing its registered office or registered agent, or both, in the State of Florida. SIGNATURE: Electronic Signature of Registered Agent Date Officer/Director Detail : I hereby certify that the information indicated on this report or supplemental report is true and accurate and that my electronic signature shall have the same legal effect as if made under oath; that I am an officer or director of the corporation or the receiver or trustee empowered to execute this report as required by Chapter 607, Florida Statutes; and that my name appears above, or on an attachment with all other like empowered. SIGNATURE: Electronic Signature of Signing Officer/Director Detail Date DAVID M. LEE FILED May 17, 2020 Secretary of State 0773041742CC MELISSA A. PLOTSKY ASSISTANT SECRETARY 05/17/2020 2020 FLORIDA PROFIT CORPORATION ANNUAL REPORT No 05/17/2020 Title DIRECTOR, CHAIRMAN Name ROBO, JAMES L. Address 700 UNIVERSE BLVD. City-State-Zip:JUNO BEACH FL 33408 Title DIRECTOR, EVP FINANCE, CFO Name KUJAWA, REBECCA J. Address 700 UNIVERSE BLVD. City-State-Zip:JUNO BEACH FL 33408 Title VP, SECRETARY Name SEELEY, W. SCOTT Address 700 UNIVERSE BLVD. City-State-Zip:JUNO BEACH FL 33408 Title VP Name SOLE, MICHAEL W. Address 700 UNIVERSE BLVD. City-State-Zip:JUNO BEACH FL 33408 Title DIRECTOR, PRESIDENT, CEO Name SILAGY, ERIC E. Address 700 UNIVERSE BLVD. City-State-Zip:JUNO BEACH FL 33408 Title VP Name REAGAN, RONALD R. Address 700 UNIVERSE BLVD. City-State-Zip:JUNO BEACH FL 33408 Title ASST. SECRETARY Name PLOTSKY, MELISSA A. Address 700 UNIVERSE BLVD. City-State-Zip:JUNO BEACH FL 33408 Title VP Name GOLDSTEIN, BRUCE Address 700 UNIVERSE BLVD. City-State-Zip:JUNO BEACH FL 33408 Continues on page 2 3.A.2.c Packet Pg. 307 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) Title VP Name FORREST, SAM A. Address 700 UNIVERSE BLVD. City-State-Zip:JUNO BEACH FL 33408 Title VP Name RAUCH, PAMELA M. Address 700 UNIVERSE BLVD. City-State-Zip:JUNO BEACH FL 33408 Title VP Name SPOOR, MICHAEL G. Address 700 UNIVERSE BLVD. City-State-Zip:JUNO BEACH FL 33408 Title VP Name RUBIO, ALEX Address 700 UNIVERSE BLVD. ATTN: CORP GOV City-State-Zip:JUNO BEACH FL 33408 Title VP Name LEMASNEY, MARK Address 700 UNIVERSE BLVD. ATTN: CORP GOV City-State-Zip:JUNO BEACH FL 33408 Title VP Name BROAD, TOM Address 700 UNIVERSE BLVD. ATTN: CORP GOV City-State-Zip:JUNO BEACH FL 33408 Officer/Director Detail Continued : Title SENIOR VP Name MIRANDA, MANUEL B. Address 700 UNIVERSE BLVD. City-State-Zip:JUNO BEACH FL 33408 Title VP Name PRIORE, CARMINE A. III Address 700 UNIVERSE BLVD. City-State-Zip:JUNO BEACH FL 33408 Title VP Name CHAPEL, CHRISTOPHER Address 700 UNIVERSE BLVD. City-State-Zip:JUNO BEACH FL 33408 Title TREASURER Name CUTLER, PAUL I. Address 700 UNIVERSE BLVD. City-State-Zip:JUNO BEACH FL 33408 Title VP Name COFFEY, ROBERT Address 700 UNIVERSE BLVD. ATTN: CORP GOV City-State-Zip:JUNO BEACH FL 33408 Title VP Name DAGGS, NICOLE J. Address 700 UNIVERSE BLVD. ATTN: CORP GOV City-State-Zip:JUNO BEACH FL 33408 3.A.2.c Packet Pg. 308 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) AFFIDAVIT OF COMPLIANCE 3.A.2.c Packet Pg. 309 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) 3.A.2.c Packet Pg. 310 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) Notification of Variance to Property Owners and Associations within 150 feet February 1, 2021 Lindsay F. Robin, AICP Project Manager 28100 Bonita Grande Dr. #305 Bonita Springs, FL 34135 Dear Property Owner: Please be advised that the sender has made a formal application to Collier County for a variance from the requirements of the buffer regulations as they apply to the following described property: The Subject Property is 578+/- acres of land located directly to the east of the SR 29 and SR 82 intersection in unincorporated Collier County, Florida. It is our intent to ask the County to allow us to request a variance from the buffer regulations set forth in the Collier County Land Development Code Sec. 4.06.02.C Table 2.4 Table of Buffer Requirements by Land Use Classifications, which requires a 20’ Type D Buffer where Public Use abuts Right-Of-Way and a 10’ Type A Buffer where a Public Use abuts Agriculture; whereas the Applicant is requesting no buffers required surrounding the perimeter of the subject property. Development of the project will comply with all other RLSA zoning district requirements and conditions set forth in the companion Conditional Use approval, which seeks to permit a solar field (electric or gas generating plant). In order to provide you an opportunity to become fully aware of our intention, we will be contacting you directly within the next few days or you may choose to telephone the sender for further information. In any event, please be advised that we are interested in assuring you that our request should not adversely affect your property interest. If you have any further questions, please do not hesitate to contact me directly at (239) 908-3079, or lindsay.robin@waldropengineering.com. Sincerely, WALDROP ENGINEERING, P.A. Lindsay F. Robin, MPA, AICP Project Manager Enclosures cc: Scott Scovill, Florida Power and Light Company 3.A.2.c Packet Pg. 311 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) 1 FOLIO NAME1 ADDRESS COUNTRY CITY STATE USZIP FOREIGNMAI SZIPPLUS4 00067920000 BARRON COLLIER PARTNERSHIP 2600 GOLDEN GATE PKWY STE 200 USA NAPLES FL 34105 34105 3227 00067880001 BARRON COLLIER PARTNERSHIP 2600 GOLDEN GATE PKWY STE 200 USA NAPLES FL 34105 34105 3227 00066160007 CAPRI INTERNATIONAL INC PO BOX 771027 USA NAPLES FL 34107 34107 0 00064960005 BARRON COLLIER PARTNERSHIP 2600 GOLDEN GATE PKWY STE 200 USA NAPLES FL 34105 34105 3227 00064360003 BARRON COLLIER PARTNERSHIP 2600 GOLDEN GATE PKWY STE 200 USA NAPLES FL 34105 34105 3227 00063240001 BARRON COLLIER PARTNERSHIP 2600 GOLDEN GATE PKWY STE 200 USA NAPLES FL 34105 34105 3227 Buffer List 150ft 3.A.2.c Packet Pg. 312 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) ADDRESSING CHECKLIST 3.A.2.c Packet Pg. 313 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) COLLIER COUNTY GOVERNMENT GROWTH MANAGEMENT DEPARTMENT www.colliergov.net 2800 NORTH HORSESHOE DRIVE NAPLES, FLORIDA 34104 (239) 252-2400 FAX (239) 252-5724 ADDRESSING CHECKLIST Please complete the following and email to GMD_Addressing@colliergov.net or fax to the Operations Division at 239-252-5724 or submit in person to the Addressing Section at the above address. Form must be signed by Addressing personnel prior to pre-application meeting, please allow 3 days for processing. Not all items will apply to every project. Items in bold type are required. FOLIO NUMBERS MUST BE PROVIDED. Forms older than 6 months will require additional review and approval by the Addressing Section. PETITION TYPE (Indicate type below, complete a separate Addressing Checklist for each Petition type) BL (Blasting Permit) BD (Boat Dock Extension) Carnival/Circus Permit CU (Conditional Use) EXP (Excavation Permit) FP (Final Plat LLA (Lot Line Adjustment) PNC (Project Name Change) PPL (Plans & Plat Review) PSP (Preliminary Subdivision Plat) PUD Rezone RZ (Standard Rezone) SDP (Site Development Plan) SDPA (SDP Amendment) SDPI (Insubstantial Change to SDP) SIP (Site Im provement Plan) SIPI (Insubstantial Change to SIP) SNR (Street Name Change) SNC (Street Name Change – Unplatted) TDR (Transfer of Development Rights) VA (Variance) VRP (Vegetation Removal Permit) VRSFP (Vegetation Removal & Site Fill Permit) OTHER LEGAL DESCRIPT ION of subject property or properties (copy of lengthy description may be attached) FOLIO (Property ID) NUMBER(s) of above (attach to, or associate with, legal description if more than one) STREET ADDRESS or ADDRESSES (as applicable, if already assigned) PROPOSED STREET NAMES (if applicable) SITE DEVELOPMENT PLAN NUMBER (for existing projects/sites only) LOCATION MAP must be attached showing exact location of project/site in relation to nearest public road right- of-way PROPOSED PROJECT NAME (if applicable) SDP - or AR or PL # SURVEY (copy - needed only for unplatted properties) CURRENT PROJECT NAME (if applicable) Rev. 6/9/2017 Page 1 of 2 Immokalee Solar (Project Name not yet approved) (4,9,16-46-29) 3.A.2.c Packet Pg. 314 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) COLLIER COUNTY GOVERNMENT GROWTH MANAGEMENT DEPARTMENT www.colliergov.net 2800 NORTH HORSESHOE DRIVE NAPLES, FLORIDA 34104 (239) 252-2400 FAX (239) 252-5724 Please Return Approved Checklist By: Email Personally picked up Applicant Name: Signature on Addressing Checklist does not constitute Project and/or Street Name approval and is subject to further review by the Operations Division. FOR STAFF USE ONLY Folio Number Folio Number Folio Number Folio Number Folio Number Folio Number Approved by: Date: Updated by: Date: IF OLDER THAN 6 MONTHS, FORM MUST BE UPDATED OR NEW FORM SUBMITTED Fax Email/Fax:Phone: Project or development names proposed for, or already appearing in, condominium documents (if application; indicate whether proposed or existing) Rev. 6/9/2017 Page 2 of 2 00063280003 00064320001 00065000003 9/21/2020 3.A.2.c Packet Pg. 315 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) / $ 0 $ 13,000,000 $ 0 $ 0 $ 3,971,900 $ 168,753 $ 4,140,653 $ 4,140,653 $ 979,286 $ 979,286 Collier County Proper ty AppraiserProperty Summar y Parcel No 00064320001 SiteAddress*Disclaimer 4300SR 29N Site City IMMOKALEE Site Zone*Note 34142 Name / Address BARRON COLLIER PARTNERSHIP 2600 GOLDEN GATE PKWY STE 200 City NAPLES State FL Zip 34105-3227 Map No.Strap No.Section Township Range Acres *Estimated 1E09 000100 001 01E09 9 46 29 628 Legal 9 46 29 ALL EXC. HWY Millage Area 209 Millage Rates *Calculations Sub./Condo 100 - ACREAGE HEADER School Other Total Use Code 66 - ORCHARD GROVES, CITRUS, ETC.5.016 8.3762 13.3922 Latest Sales Histor y (Not all Sales are listed due to Confidentiality) Date Book-Page Amount 09/22/95 2102-401 03/01/91 1601-1087 11/01/85 1166-1887 12/01/69 337-336 2020 Preliminar y Tax Roll (Subject to Change) Land Value (+) Improved Value (=) Market Value (=) Assessed Value (=) School Taxable Value (=) Taxable Value If all Values shown above equal 0 this parcel was created after theFinal Tax Roll 3.A.2.c Packet Pg. 316 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) / $ 0 $ 13,000,000 $ 0 $ 0 $ 4,407,775 $ 0 $ 4,407,775 $ 4,407,775 $ 894,481 $ 894,481 Collier County Proper ty AppraiserProperty Summar y Parcel No 00063280003 SiteAddress*Disclaimer Site City IMMOKALEE Site Zone*Note 34142 Name / Address BARRON COLLIER PARTNERSHIP 2600 GOLDEN GATE PKWY STE 200 City NAPLES State FL Zip 34105-3227 Map No.Strap No.Section Township Range Acres *Estimated 1E04 000100 001 1E04 4 46 29 628 Legal 4 46 29 ALL EXC. HWAY. Millage Area 243 Millage Rates *Calculations Sub./Condo 100 - ACREAGE HEADER School Other Total Use Code 66 - ORCHARD GROVES, CITRUS, ETC.5.016 8.3762 13.3922 Latest Sales Histor y (Not all Sales are listed due to Confidentiality) Date Book-Page Amount 09/22/95 2102-401 03/01/91 1601-1087 11/01/85 1166-1887 12/01/69 337-336 2020 Preliminar y Tax Roll (Subject to Change) Land Value (+) Improved Value (=) Market Value (=) Assessed Value (=) School Taxable Value (=) Taxable Value If all Values shown above equal 0 this parcel was created after theFinal Tax Roll 3.A.2.c Packet Pg. 317 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) / $ 0 $ 13,000,000 $ 0 $ 4,582,125 $ 0 $ 4,582,125 $ 4,582,125 $ 936,751 $ 936,751 Collier County Proper ty AppraiserProperty Summar y Parcel No 00065000003 SiteAddress*Disclaimer Site City IMMOKALEE Site Zone*Note 34142 Name / Address BARRON COLLIER PARTNERSHIP 2600 GOLDEN GATE PKWY STE 200 City NAPLES State FL Zip 34105-3227 Map No.Strap No.Section Township Range Acres *Estimated 1E16 000100 001 1E16 16 46 29 628 Legal 16 46 29 ALL EXC. HWY Millage Area 209 Millage Rates *Calculations Sub./Condo 100 - ACREAGE HEADER School Other Total Use Code 66 - ORCHARD GROVES, CITRUS, ETC.5.016 8.3762 13.3922 Latest Sales Histor y (Not all Sales are listed due to Confidentiality) Date Book-Page Amount 09/22/95 2102-401 03/01/91 1601-1087 06/01/82 975-684 2020 Preliminar y Tax Roll (Subject to Change) Land Value (+) Improved Value (=) Market Value (=) Assessed Value (=) School Taxable Value (=) Taxable Value If all Values shown above equal 0 this parcel was created after theFinal Tax Roll 3.A.2.c Packet Pg. 318 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) 3.A.2.cPacket Pg. 319Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) DISCLOSURE FORM 3.A.2.c Packet Pg. 320 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) 3.A.2.cPacket Pg. 321Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) 3.A.2.cPacket Pg. 322Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) 3.A.2.cPacket Pg. 323Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) 3.A.2.cPacket Pg. 324Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) WARRANTY DEED 3.A.2.c Packet Pg. 325 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) 3.A.2.c Packet Pg. 326 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) SURVEY 3.A.2.c Packet Pg. 327 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) T 45 S, R 30 ET 45 S, R 29 ET 45 S, R 28 ET 46 S, R 30 ET 46 S, R 29 ET 46 S, R 28 ET 47 S, R 30 ET 47 S, R 29 ET 47 S, R 28 E1314151617202021212223232323242526262728293233343434353535363613131314141516161718192021222222232324242424252627282930313233343536161718192021282930313232323312345589101112131415161720212223242526272829323334353612234567891011121314151617181920202122232425262728293031323333343536456789161718192021282930313233331223458910111212345678910111244456789131415161713141516171820212223249161718192021FELDAIMMOKALEESTATE ROAD 82 STATE ROAD 29 HENRY COUNTYCOLLIER COUNTYProject LocationLocation Map(Not to Scale)SURVEYOR'S NOTES:1). THIS ALTA/ACSM LAND TITLE (BOUNDARY) SURVEY IS NOT VALID WITHOUT THE SIGNATURE AND ORIGINAL RAISED SEAL OF THE FLORIDALICENSED SURVEYOR AND MAPPER LISTED BELOW.2). PROJECT HORIZONTAL DATUM IS RELATIVE TO THE NORTH AMERICAN DATUM OF 1983, 2011 ADJUSTMENT (NAD83 / 2011) WITH COORDINATESSHOWN HEREON EXPRESSED IN THE FLORIDA STATE PLANE COORDINATE SYSTEM, EAST ZONE (0901), US SURVEY FEET, BASED UPON REDUNDANTGLOBAL POSITIONING SYSTEM (GPS) MEASUREMENTS TO THE NATIONAL GEODETIC SURVEY (NGS) CONTROL STATIONS LISTED BELOW:PID: AJ7285 PID:AJ7337 DESIGNATION: E 520 Designation: D 520NORTHING: 782,331.04 NORTHING: 785,354.30EASTING: 513,919.04 EASTING: 513,899.38Stainless steel rod with sleeve and disk set in top of concrete monument stampedcover stamped “E 520 2001 CERP” “ D 520 2001 CERP”Go to http://www.ngs.noaa.gov for additional information regarding these control stations 3). BEARINGS SHOWN HEREON ARE RELATIVE TO THE FLORIDA STATE PLANE COORDINATE SYSTEM, EAST ZONE (0901), NAD83/2011, BASED ON THECENTERLINE OF SURVEY OF FLORIDA DEPARTMENT OF TRANSPORTATION STATE ROAD 29 RIGHT OF WAY MAP, STATE PROJECT NO. 03050-000,BETWEEN STATION 2251+00.00, AND STATION 2288+00.00 AS BEING S 00° 38'16 ” W.4). THE LOCATION AND CONFIGURATION OF THE LANDS SURVEYED WAS PROVIDED BY THE CLIENT5). LANDS SHOWN HEREON WERE NOT ABSTRACTED FOR OWNERSHIP, EASEMENTS, RIGHTS-OF-WAY OR OTHER TITLE MATTERS BY THIS FIRM. ANYTITLE MATTERS SHOWN OR NOTED HEREON ARE BASED UPON A REVIEW OF FIDELITY NATIONAL TITLE INSURANCE COMPANY COMMITMENT FORTITLE INSURANCE, ORDER No. 7826583, COMMITMENT DATE: JULY 31, 2019 at 08: 00AM.TITLE COMMITMENT SCHEDULE BII EXCEPTIONS THAT MAY AFFECT TITLE ARE LISTED BELOW AND SHOWN OR NOTED ON THE SURVEY.NOTE: NUMBERS LISTED BELOW MATCH EXCEPTION NUMBERS LISTED IN THE COMMITMENT. ALL REFERENCED DOCUMENTS ARE FILED IN THE PUBLICRECORDS OF COLLIER COUNTY, FLORIDA.6. Covenants, conditions reservations and restrictions contained in Warranty Deed recorded in OfficialRecords Book 1166, Page 1887. Those portions of the land surveyed lying in Sections 4 and 9, T46S, R29E are contained within the lands described in Exhibit “D” ofthis document. -Not plottable-7. Oil, gas and mineral rights contained in Deed recorded in Official Records Book 884, Page 1517 andOfficial Records Book 884, Page 1524; and as amended in Official Records Book 949, Page 364.(1) Those portions of the lands surveyed lying in Section 16, T46S,R29E are contained within the lands described in Schedule D of ORB 884, Page 1517. -Not plottable- (2) Those portions of the lands surveyed lying in Section 16,T46S, R29E are contained within the lands described in Schedule A of ORB 884, Page 1524- Not Plottable- (3) . Those portions of the land surveyed lying inSections 4 and 9, T46S, R29E are contained within the lands described in Schedule B of ORB 884, Page 1524- Not plottable- (3) The lands surveyed are notdescribed in ORB 949, Page 3648. Right-of-Way Easement recorded in Official Records Book 416, Page 699. -As depicted hereon-9. Oil, Gas & Mineral Lease to Sun Oil Company recorded in Official Records Book 151, Page 189; and assigned to Exxon Corporation by Assignment recorded inOfficial Records Book 1321, Page 1721; as affected by Release recorded in Official Records Book 1826, Page 1887 (1) Those portions of the land surveyed lying inSections 4 and 9, T46S, R29E are contained within the lands described in ORB 151, Page 189 as well as in Exhibit “A” of ORB 1321, Page 1721 -Not plottable-(2) Those portions of the land surveyed lying in Sections 4 and 9, T46S, R29E are contained within the lands described in ORB 1826. Page 1887- Not Plottable10. Terms and conditions contained in Oil, Gas & Mineral Deeds recorded in Official Records Book 1413, Page 929; Official Records Book 1413, Page 1063; OfficialRecords Book 1482, Page 781; and as corrected in Official Records Book 1498, Page 1124 (1) Those portions of the lands surveyed lying in Section 16, T46S, R29Eare contained within the lands described in Schedule A Tract 2 and those portions of the land surveyed lying in Sections 4 and 9, T46S, R29E are contained within thelands described in Schedule B Tract 1 of ORB 1413. Page 929 -Not plottable- (2) Those portions of the lands surveyed lying in Section 16, T46S, R29E are containedwithin the lands described in Schedule A Tract 2 and portions of the land surveyed lying in Sections 4 and 9, T46S, R29E are contained within the lands described inSchedule B Tract 1 of ORB 1413. Page 1063 -Not plottable- (3) Those portions of the lands surveyed lying in Section 16, T46S, R29E are contained within the landsdescribed in Schedule A Tract 2 and portions of the land surveyed lying in Sections 4 and 9, T46S, R29E are contained within the lands described in Schedule B Tract1 of ORB 1482. Page 781 -Not plottable- (4) The lands surveyed are affected by corrective deed recorded in ORB 1498, Page 1124- Not plottable-11. Memorandum of Notice recorded in Official Records Book 2394, Page 378. The lands surveyed lie within the lands described in Exhibit “A” of ORB 2394, Page 378. -Not plottable-12. Terms and conditions of Oil, Gas and Mineral Deed recorded in Official Records Book 4393, Page 2324. Those portions of the lands surveyed lying in Section 16,T46S, R29E are contained within the lands described in Schedule A Tract 2 and those portions of the land surveyed lying in Sections 4 and 9, T46S, R29E arecontained within the lands described in Schedule B Tract 1 of ORB 4393. Page 2324 -Not plottable-13. Notice of Interest In Land Pursuant To Florida Statutes Section 704.05 And Florida Statutes Chapter 712 recorded in Official Records Book 4592, Page 154. Thoseportions of the lands surveyed lying in Section 16, T46S, R29E are contained within the lands described in Exhibit A, Schedule A Tract 1 and those portions of the landsurveyed lying in Sections 4 and 9, T46S, R29E are contained within the lands described in Exhibit A, Schedule B Tract 1 of ORB 4592. Page 154 -Not plottable-14. Resolution No. 2013-183 and Resolution No. 2013-184 recorded in Official Records Book 4965, Page 1660. The lands surveyed lie within the lands described in Resolution No. 2013-184 in ORB 4965, Page 1660- Not Plottable-15. Resolution No. 2014-176 recorded in Official Records Book 5077, Page 1392. The lands surveyed lie within the lands described in Resolution No. 2014-176 in ORB5077, Page 1392- Not Plottable-16. Resolution No. 2015-175 recorded in Official Records Book 5194, Page 2200. The lands surveyed lie within the lands described in Resolution No. 2014-175 in ORB5194, Page 2200- Not Plottable-17. Resolution No. 2018-150 recorded in Official Records Book 5552, Page 3785. The lands surveyed lie within the lands described in Resolution No. 2014-150 in ORB5552, Page 3785- Not Plottable-18. State of Florida Department of Transportation Project Resolution For State Highway System Projects recorded in Official Records Book 5337, Page 307. Thoseportions of the land surveyed lying in Section 9, T46S, R29E are contained within the lands described in this document. -Not plottable-19. Temporary Easement granted to State of Florida Department of Transportation recorded in OfficialRecords Book 5476, Page 1468. - As depicted hereon-20. Subordination of Utility Interests For Temporary Easements recorded in Official Records Book 5482, Page2986. - As depicted hereon-21. Temporary Access Easement recorded in Official Records Book 5630, Page 2051. Runs adjacent to lands surveyed- As depicted hereon- Does not affect subjectproperty.22. Easements recorded in Deed Book 12, Page 483. …Right-of-way and easement to build, maintain, operate and use of roads of a width not to exceed onehundred (100) feet across certain lands in Collier, Lee, and Hendry Counties, Florida owned by Collier Corporation. Not certain if Collier Corporation owned landssurveyed in 1948.23. Terms, conditions, reservations and easements contained in Oil, Gas and Mineral Lease recorded in DeedBook 9, Page 560; and assigned to Humble Oil & Refining Company in Deed Book 10, Page 54. The lands surveyed lie within the lands described. In Exhibit A ofDeed Book 9, Page 560 - Not Plottable -24. Oil, Gas and Mineral Deed recorded in Deed Book 22, Page 37. Lands surveyed do not appear to lie within the lands described in this document. - Not Plottable-25. Oil, Gas and Mineral Lease to Humble Oil & Refining Company recorded in Deed Book 24, Page 379, andDeed Book 24, Page 385. The lands surveyed are not contained within the lands described in these documents. Not plottable -26. Right of Way Deed to the State of Florida Department of Transportation recorded in Deed Book 31, Page 49.As best as can be determined from a partially illegible document, the lands surveyed are not contained within the lands described in this document. - Not plottable-6). THERE MAY BE OTHER MATTERS AFFECTING TITLE NOT SHOWN ON THIS SURVEY.7). UNDERGROUND IMPROVEMENTS SUCH AS FOUNDATIONS AND UTILITIES WERE NOT LOCATED. MINOR JEEP TRAILS WERE NOT LOCATED.8). THIS SURVEY DOES NOT ADDRESS ANY ADVERSE OWNERSHIP CLAIM BY THE STATE OF FLORIDA BY RIGHT OF SOVEREIGNTY TO ANY PORTIONOF THE LANDS SURVEYED, INCLUDING SUBMERGED, FILLED AND ARTIFICIALLY EXPOSED LANDS, AND LANDS ACCRETED TO THOSE LANDS.9). THIS SURVEY DOES NOT ADDRESS THE LOCATION OF JURISDICTIONAL WETLANDS OR HAZARDOUS MATERIALS.10). THIS SURVEY HAS BEEN PERFORMED IN CONFORMANCE WITH APPLICABLE SECTIONS OF FLORIDA ADMINISTRATIVE CODE RULE CHAPTER 5J-17,PURSUANT TO CHAPTER 472, FLORIDA STATUTES.11). THE LANDS DESCRIBED AND DEPICTED HEREON ARE ONE AND THE SAME LANDS DESCRIBED IN THE ABOVE REFERENCED COMMITMENT FORTITLE INSURANCE.ROBERT M. JONESFLORIDA PROFESSIONAL SURVEYOR AND MAPPERLICENSE No. LS 4201Collier County, FloridaofALTA/NSPS Land Title SurveyBARRON COLLIER - NAPLES SOLAR ENERGY SITELocated inSection 4, 9, 16 Township 46 South, Range 29 EastSheet IndexSheet DescriptionParcel 00063280003 (Section 4) =33.41Parcel 00064320001 (Section 9)=221.82Parcel 00065000003 (Section 16) =322.70 ______________________________________________Surveyed Gross Acres ±=577.93Less-out Acreage ± (See Sheet 6)=29.59Net Acreage ±=548.34(See Sheet 6 for calculation of Gross and Net Areas) Surveyed Areas of RevisionProject Title: 6of Sheet No. Prepared for: Dwg. Date:County:Collier County, Florida Photo Date:Field Books: 1356 Drawn by:Office No.: 6374191196 Checked by:Dwg. Name: 6374191196.DWG 09/29/2019 BJG RMJ 2017 Collier County, Florida Located in ALTA/NSPS Land Title Survey DatePrepared by:Last Day in Field: 10/23/2019Revision DateGRAPHIC SCALE1 inch = 1000 ft.(IN FEET)NORTH050010002000 1 BARRON COLLIER - NAPLESAltamonte Springs, FL 32701 USAWood Environment & Infrastructure Solutions, Inc.www.woodplc.comPhone: (407) 522-7570Certificate of Authorization Number LB-0007932550 Northlake Boulevard, Suite 1000NORTH SURVEYOR'S CERTIFICATIONTo: Florida Power & Light Company, a Florida corporation, DPW Law Firm, and Fidelity National Title InsuranceCompany. This is to certify that this map or plat and the survey on which it is based were made in accordance withthe 2016 Minimum Standard Detail Requirements for ALTA/NSPS Land Title Surveys, jointly established andadopted by ALTA and NSPS and includes Items 1, 2, 3, 4, 6, 7, 8, 13, 14, 16, 17,and 19.The field work was completed on July 15, 2020Date of Plat or Map: July 29, 2020For the Firm,1Cover2-4Details5Line and Curve Tables6Gross & Net Acreage Map12). LANDS LIE IN ZONE "X SHADED" & “AH", PER NATIONAL FLOOD INSURANCE RATE MAP "COLLIER COUNTY, FLORIDA ANDINCORPORATED AREAS" PANEL 135 OF 1225, MAP NUMBER 12021C0135H, EFFECTIVE DATE: MAY 16, 2012. ZONE "X" = "Area ofmoderate flood hazard, between the limits of 100 - year and 500 year floods. Zone "AH" = Areas with a 1% annual chance of shallow flooding(ponding) with an average depth ranging from 1 to 3 feet.13). ADDITIONS OR DELETIONS TO THIS ALTA/NSPS LAND TITLE SURVEY ARE PROHIBITED WITHOUT WRITTENCONSENT OF THE SIGNING FLORIDA LICENSED SURVEYOR AND MAPPER.THE SIGNING PARTY IS NOT RESPONSIBLEFOR ADDITIONS, DELETIONS OR MANIPULATION OF THE DATA CONTAINED IN THE SURVEY MAPOR ASSOCIATED DIGITAL FILE.14.) SOURCE OF AERIAL PHOTOGRAPHY/IMAGE: THIS DIGITAL IMAGERY WAS ACQUIRED VIA FLORIDA DEPARTMENT OF TRANSPORTATION (FDOT) AERIAL PHOTO LOOK-UP SYSTEM (APLUS). https://fdotewp1.dot.state.fl.us/AerialPhotoLookUpSystemTHIS IMAGERY IS SHOWN FOR REFERENCE ONLY; THIS SURVEY DOES NOT WARRANT THE ACCURACY OF THIS IMAGERY.15). PROPERTY IS PRIMARILY CITRUS GROVE, NO STREET ADDRESS OF SUBJECT PROPERTY.16). THE ORIGINAL FIELD DATA ACQUISITION PHASE OF THIS SURVEY WAS COMPLETED IN DECEMBER 19, 2019, AS DOCUMENTED IN WOOD FIELD BOOKS 1356 AND 1402. FIELD DATA ACQUISITION TO SUPPORT REVISION OF BOUNDARY ANDINGRESS-EGRESS EASEMENT WAS COMPLETED JULY 15, 2020 IN WOOD FIELD BOOK 1407.FLORIDA POWER & LIGHT 700 UNIVERSE BOULEVARD JUNO BEACH, FL 33408SHEET 4SHEET 3SHEET 2NW 1/4NE 1/4SE 1/4SW 1/4NW 1/4NE 1/4SE 1/4SW 1/4NE 1/4NW 1/4SE 1/4SW 1/4STATE ROAD 82STATE ROAD 29 STATE ROAD 29 SECTION 4SECTION 4SECTION 4SECTION 4SECTION 9SECTION 9SECTION 9SECTION 9SECTION 16SECTION 16SECTION 16SECTION 16POINT OF BEGINNINGPOINT OF COMMENCEMENTSW CORNER OF SECTION 16SOLAR ENERGY SITE LEGAL DESCRIPTION OF LANDS SURVEYED:A parcel of land being a part of Sections 4, 9, and 16, Township 46 South, Range 29 East, Collier County, Florida,Being more particularly described as follows:Commencing at the Southwest corner of said Section 16; thence N89°05'11”E, along the south line of the southwest ¼ of said section 16, a distanceof 2650.16 feet to the east line of the southwest ¼ of said Section 16; thence N00°37'45”W, along said east line, a distance of 893.57 feet to the POINT OFBEGINNING; thence departing said east line, run S75°20'01”E, a distance of 663.02 feet; thence S75°55'51”E, a distance of 80.66 feet; thence S73°16'08”E, adistance of 59.89 feet; thence N24°20'38"E, a distance of 46.79 feet; thence N00°11'01"E, a distance of 166.98 feet; thence N65°09'07"W, a distance of354.49 feet; thence N57°16'10"W, a distance of 222.58 feet; thence N43°09'13"W, a distance of 160.98 feet; thence N27°43'02"W, a distance of 223.14 feet;thence N26°53'04"W, a distance of 181.96 feet; feet to aforesaid east line of the southwest ¼ of Section 16; thence departing said east line, continueN26°53'04"W, a distance of 196.53 feet; thence N29°23'47"W, a distance of 172.09 feet to a point on a non-tangent curve with a radius of 180.15 feet,concave to the east; thence northwesterly along said curve to the right through a central angle of 59°54'32", a distance of 188.36 feet where the chord bearsN03°11'40"W a distance of 179.90 feet to the point of intersection with a non-tangent line; thence N23°39'31"E, a distance of 84.45 feet; thence N26°18'30"W,a distance of 238.04 feet; thence N60°35'03"W, a distance of 32.45 feet; thence S60°53'17"W, a distance of 82.09 feet; thence S82°21'35"W, a distance of154.36 feet; thence N85°55'54"W, a distance of 100.73 feet; thence N76°01'53"W, a distance of 171.69 feet; thence N72°44'10"W, a distance of 162.49 feet toa point on a non-tangent curve with a radius of 334.58 feet, concave to the northeast; thence westerly along said curve to the right through a central angle of54°01'23", a distance of 315.47 feet to the south line of the northwest ¼ of aforesaid Section 16 (where the chord bears N42°10'17"W a distance of 303.91feet to the point of intersection with a non-tangent line); thence departing said south line, run N12°10'48"W, a distance of 34.67 feet; thence N01°44'38"W, adistance of 315.28 feet; thence N03°16'14"W, a distance of 234.59 feet; thence N54°58'48"W, a distance of 141.82 feet; thence S66°23'57"W, a distance of130.52 feet to a point on a non-tangent curve with a radius of 337.03 feet, concave to the north; thence southwesterly along said curve to the right through acentral angle of 59°55'46", a distance of 352.52 feet where the chord bears N85°02'20"W a distance of 336.67 feet to the point of intersection with anon-tangent line; thence N42°17'26"W, a distance of 81.24 feet; thence N39°29'03"W, a distance of 183.00 feet; thence N40°26'22"W, a distance of 157.67feet; thence N47°00'34"W, a distance of 139.93 feet to a point on a non-tangent curve with a radius of 287.61 feet, concave to the east; thence northwesterlyalong said curve to the right through a central angle of 71°48'29", a distance of 360.46 feet where the chord bears N04°19'28"W a distance of 337.33 feet tothe point of intersection with a non-tangent line; thence N46°28'03"E, a distance of 124.92 feet; thence N51°19'36"E, a distance of 124.92 feet to a point on anon-tangent curve with a radius of 346.99 feet, concave to the south; thence northeasterly along said curve to the right through a central angle of 57°02'26", adistance of 345.44 feet where the chord bears S87°47'38"E a distance of 331.35 feet to the point of intersection with a non-tangent line; thence S44°38'05"E,a distance of 384.44 feet; thence S32°07'41"E, a distance of 185.42 feet; thence S26°29'56"E, a distance of 106.41 feet; thence S16°41'39"E, a distance of97.52 feet; thence S11°15'06"W, a distance of 64.58 feet; thence S51°38'18"E, a distance of 174.02 feet; thence N58°59'56"E, a distance of 95.19 feet; thenceN66°50'39"E, a distance of 102.19 feet to a point on a non-tangent curve with a radius of 226.62 feet, concave to the south; thence easterly along said curveto the right through a central angle of 60°07'16", a distance of 237.80 feet where the chord bears S81°47'06"E a distance of 227.04 feet to the point ofintersection with a non-tangent line; thence S58°23'44"E, a distance of 118.23 feet; thence S49°00'58"E, a distance of 159.00 feet; thence S29°30'33"E, adistance of 210.80 feet; thence S26°48'25"E, a distance of 439.41 feet; thence S21°07'20"E, a distance of 42.79 feet; thence S01°54'46"W, a distance of 15.86feet to aforesaid south line of the northwest ¼ of Section 16; thence departing said south line, continue S01°54'46"W, a distance of 101.19 feet; thenceS28°03'10"E, a distance of 226.25 feet to aforesaid east line of the southwest ¼ of Section 16; thence departing said east line, run S28°00'26"E, a distance of99.95 feet; thence S89°48'40"E, a distance of 54.82 feet; thence S66°14'26"E, a distance of 196.18 feet; thence S57°52'50"E, a distance of 294.12 feet;thence S45°37'09"E, a distance of 423.70 feet; thence S31°19'19"E, a distance of 327.77 feet; thence S37°05'37"E, a distance of 60.56 feet; thenceN80°36'14"E, a distance of 95.15 feet; thence N88°08'24"E, a distance of 282.49 feet; thence S61°38'14"E, a distance of 207.86 feet; thence S09°59'57"E, adistance of 320.20 feet; thence S11°53'31"E, a distance of 279.08 feet; thence S62°47'07"E, a distance of 77.50 feet; thence S75°15'51"E, a distance of883.29 feet; thence N00°38'44"W, a distance of 1864.68 feet; thence S51°03'41"W, a distance of 115.91 feet to a point on a non-tangent curve with a radiusof 292.21 feet, concave to the northeast; thence southwesterly along said curve to the right through a central angle of 105°47'48", a distance of 539.57 feetwhere the chord bears N65°09'57"W a distance of 466.11 feet to the point of intersection with a non-tangent line; thence N16°45'04"W, a distance of 173.47feet; thence N00°37'25"W, a distance of 48.87 feet to the south line of the northeast ¼ of Section 16, thence departing said south line, continue N00°37'25"W,a distance of 29.69 feet to a point on a non-tangent curve with a radius of 135.93 feet, concave to the southwest; thence northerly along said curve to the leftthrough a central angle of 60°09'32", a distance of 142.73 feet where the chord bears N22°37'15"W a distance of 136.26 feet to the point of intersection with anon-tangent line; thence N58°07'50"W, a distance of 516.62 feet; thence N60°58'32"W, a distance of 54.63 feet to a point on a non-tangent curve with a radiusof 112.22 feet, concave to the south; thence northwesterly along said curve to the left through a central angle of 60°15'25", a distance of 118.01 feet wherethe chord bears N83°31'49"W a distance of 112.65 feet to the point of intersection with a non-tangent line; thence S74°42'31"W, a distance of 145.11 feet to apoint on a non-tangent curve with a radius of 380.90 feet, concave to the northeast; thence westerly along said curve to the right through a central angle of59°54'38", a distance of 398.28 feet where the chord bears N62°32'13"W a distance of 380.39 feet to the point of intersection with a non-tangent line; thenceN24°42'10"W, a distance of 277.56 feet; thence N30°15'20"W, a distance of 132.74 feet; thence N40°28'47"W, a distance of 112.93 feet; thence N41°30'42"W,a distance of 393.81 feet; thence N27°09'40"W, a distance of 812.57 feet; thence N47°41'01"W, a distance of 81.72 feet to the east line of the northwest ¼ ofsaid Section 16; thence departing said east line, run N47°45'02"W, a distance of 793.37 feet; thence S89°17'09"W, a distance of 787.79 feet; thenceN14°36'16"W, a distance of 35.37 feet to the south line of the southwest ¼ of said Section 9; thence departing said south line; thence N24°46'59"W, adistance of 187.13 feet; thence N00°59'49"W, a distance of 421.04 feet; thence N12°00'51"W, a distance of 176.45 feet; thence N19°15'03"W, a distance of175.51 feet; thence S78°29'00"W, a distance of 173.54 feet; thence S87°20'35"W, a distance of 106.34 feet; thence N67°17'58"W, a distance of 183.95 feet;thence N58°48'58"W, a distance of 208.56 feet to a point on a non-tangent curve with a radius of 310.99 feet, concave to the east; thence northwesterly alongsaid curve to the right through a central angle of 60°00'27", a distance of 325.71 feet where the chord bears N06°27'09"W a distance of 311.03 feet to thepoint of intersection with a non-tangent line; thence N44°25'54"E, a distance of 219.41 feet to a point on a non-tangent curve with a radius of 386.01 feet,concave to the south; thence northeasterly along said curve to the right through a central angle of 60°11'16", a distance of 405.50 feet where the chord bearsS89°30'14"E a distance of 387.11 feet to the point of intersection with a non-tangent line; thence S50°21'03"E, a distance of 142.88 feet; thence S31°09'57"E,a distance of 146.21 feet; thence S19°05'08"E, a distance of 233.59 feet; thence S16°02'13"E, a distance of 209.04 feet; thence S17°29'29"E, a distance of227.30 feet; thence S59°43'57"E, a distance of 161.60 feet; thence S44°57'50"E, a distance of 152.29 feet; thence S78°33'33"E, a distance of 63.17 feet;thence N84°04'34"E, a distance of 115.72 feet; thence S83°57'49"E, a distance of 121.00 feet to a point on a non-tangent curve with a radius of 72.07 feet,concave to the northwest; thence easterly along said curve to the left through a central angle of 59°32'26", a distance of 74.90 feet where the chord bearsN57°25'32"E a distance of 71.57 feet to the point of intersection with a non-tangent line; thence N07°00'55"E, a distance of 74.47 feet; thence N22°51'25"E, adistance of 124.02 feet; thence N36°27'33"E, a distance of 232.68 feet; thence N54°53'24"E, a distance of 274.99 feet; thence N64°07'04"E, a distance of153.09 feet; thence N00°52'43"W, a distance of 403.18 feet; thence N88°54'48"E, a distance of 115.19 feet to the east line of the southwest ¼ of Section 9;thence departing said east line, run N88°54'48"E, a distance of 183.21 feet; thence N00°48'36"W, a distance of 759.02 feet; thence N68°23'03"W, a distanceof 64.52 feet; thence N54°59'17"W, a distance of 149.10 feet to aforesaid east line of the southwest ¼ of Section 9; thence departing said east line,N54°59'17"W, a distance of 480.61 feet; thence S75°46'20"W, a distance of 374.76 feet; thence N88°35'50"W, a distance of 166.43 feet; thence N45°29'35"W,a distance of 222.14 feet to the south line of the northwest ¼ of said Section 9; thence departing said south line, run N45°32'03"W, a distance of 351.59 feet;thence N31°54'09"W, a distance of 209.90 feet; thence N22°17'55"W, a distance of 323.94 feet; thence N17°37'56"W, a distance of 138.86 feet to a point on anon-tangent curve with a radius of 298.99 feet, concave to the east; thence northerly along said curve to the right through a central angle of 60°00'00", adistance of 313.10 feet where the chord bears N12°37'33"E a distance of 298.99 feet to the point of intersection with a non-tangent line; thence N48°46'26"E,a distance of 377.70 feet; thence N54°12'46"E, a distance of 240.92 feet; thence N58°31'38"E, a distance of 134.18 feet; thence N85°48'47"E, a distance of59.56 feet; thence S83°16'43"E, a distance of 576.57 feet; thence N01°28'07"W, a distance of 734.95 feet; thence N41°08'30"W, a distance of 620.76 feet tothe south line of the southwest ¼ of said Section 4; thence departing said south line, run N02°52'53"W, a distance of 524.65 feet; thence N35°32'28"W, adistance of 248.76 feet; thence N44°57'52"W, a distance of 70.03 feet; thence N85°22'41"W, a distance of 129.08 feet; thence N81°24'25"W, a distance of85.32 feet; thence N70°36'56"W, a distance of 123.88 feet; thence N57°44'59"W, a distance of 249.10 feet; thence S86°31'53"W, a distance of 262.02 feet;thence S16°13'27"W, a distance of 244.98 feet to a point on a non-tangent curve with a radius of 159.87 feet, concave to the north; thence southwesterlyalong said curve to the right through a central angle of 128°28'53", a distance of 358.50 feet where the chord bears N86°03'03"W a distance of 287.97 feet tothe point of intersection with a non-tangent line; thence S89°11'36"W, a distance of 465.18 feet to the east right-of-way line of State Road 29; thence alongsaid east right-of-way line the following five (5) courses: thence S00°31'26"E, a distance of 761.64 feet to aforesaid south line of the southwest ¼ of saidSection 4; thence S00°38'16"E, a distance of 2734.95 feet to aforesaid south line of the northwest ¼ of said Section 9; thence continue S00°38'16"E, adistance of 2734.05 feet to aforesaid south line of the southwest ¼ of said Section 9; thence continue S00°38'16"E, a distance of 2738.75 feet to aforesaidsouth line of the northwest ¼ of Section 16, thence continue S00°38'16"E, a distance of 1008.74 feet; thence departing said east right-of-way line, runS79°08'44"E, a distance of 207.57 feet; thence S74°48'48"E, a distance of 113.82 feet; thence S07°03'21"W, a distance of 137.12 feet; thence S75°20'01”E, adistance of 2333.17 feet to the POINT OF BEGINNING.Containing 25174520 square feet or 577.93 acres, more or lessLEGAL DESCRIPTION: Ingress - Egress EasementA parcel of land being a part of Section 16, Township 46 South, Range 29 East, Collier County, Florida,Being more particularly described as follows:Commencing at the Southwest corner of said Section 16; thence N89°05'11”E, along the south line of the southwest ¼ of said section 16, a distanceof 105.28 feet to the east right-of-way line of State Road 29; thence N00°38'16"W, along said east right-of-way line, a distance of 1565.96 feet to the POINTOF BEGINNING; thence continue N00°38'16"W, a distance of 51.84 feet; thence departing said east right-of-way line, run S75°20'01"E, a distance of 307.48;thence S07°03'21"W, a distance of 15.13 feet; thence S75°20'01"E, a distance of 50.00 feet; thence S14°38'34"W, a distance of 35.00 feet; thence; thenceN75°20'01"W, a distance of 345.82 feet to the POINT OF BEGINNING.Containing 16868 square feet or 0.39 acres, more or less.Revised Boundary and added 10/23/2019POINT OF BEGINNINGINGRESS/EGRESSEASEMENTIngress - Egress Easement NGS CONTROL POINT"D 520"NGS CONTROL POINT"E 520"SECTION 4PARCEL I.D. 00063280003PARCEL I.D. 00064320001PARCEL I.D. 00065000003Revised call to east line of NW 1/4 of Section 16 1/6/20 Revised boundary, Ingress-egress easement 07/29/2020 Revised Surveyor's Note 5) 21, 23-26 08/07/2020 C:\Wood Jobs\FPL State Road 29\AutoCAD Civil 3D\Boundary v2.dwg, 8/7/2020 4:38:22 PM 3.A.2.cPacket Pg. 328Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) MBX TT OUOUOUOU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OUOUOUOUOUOUOUOUOUOUOUOU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU N 89°05'11" E 2650.16'N 89°05'44" E 2649.73' N 89°11'02" E 2648.79'N 89°11'14" E 2648.29'S 00°37'45" E 2734.18'XXXXOUOUOUOUOUOUOUOUOUOUOUOUNW 1/4 SW 1/4 SE 1/4 NE 1/4 SECTION 16 FOUND 5/8" IRON ROD & CAP (CIVILSURV LB 7805) FOUND 5/8" IRON ROD & CAP (CIVILSURV LB 7805) FOUND 4"X4" CONCRETE MONUMENT (NO I.D.) CCR # 103810 SE CORNER SECTION 16 (BROKEN TOP) CCR # 103528 SW CORNER SECTION 16 CCR # 103812 FOUND MAG NAIL (NO I.D.) 5.2' WEST OF SURVEY BASELINE OF STATE ROAD 29 FOUND NAIL & DISK (CIVILSURV LB 7805) 3.2' WEST OF SURVEY BASELINE S 89°16'49" W 2647.15' S 89°16'49" W 2647.14'S 00°38'54" E 2730.09'S 00°38'54" E 2730.09'FOUND MAG LB 7917 SURVEY BASELINE OF STATE ROAD 29 (NOT ON SECTION LINE) F.D.O.T. PROJECT 03050-000 STA. 2251+ 00.00 SECTION 16 SECTION 16 SECTION 16 SUBJECT PARCEL SUBJECT PARCEL SUBJECT PARCEL BARBED W I R E F E N C E Ingress/Egress Easement0.39± Acres BARBED WIRE FENCE EDGE OF ASPHALT PUMP BUILDING CONCRETE PUMP HOUSEON CONCRETE PAD CONCRETE SLAB STRUCTURE CONCRETE SLABSTRUCTURE CONCRETE SLABSTRUCTURE CONCRETE SLABSTRUCTURE 10' LEE COUNTY ELECTRIC CO-OPERATIVE, INC.RIGHT-OF-WAY EASEMENTO.R. 416 PG. 6998 10.00 10' LEE COUNTY ELECTRIC CO-OPERATIVE, INC.RIGHT-OF-WAY EASEMENT O.R. 416 PG. 699810.00 FPL EASEMENT (EXISTING ROAD)21 FPL EASEMENT (EXISTING ROAD)21S 00°35'25" E 2738.85'THE SOUTH LINE OF THE NORTHWEST 14 OF SECTION 16 THE SOUTH LINE OF THE SOUTHWEST 14 OF SECTION 16 THE EAST LINE OF THE SOUTHWEST 14 OF SECTION 16 THE EAST LINE OF THE NORTHWEST 14 OF SECTION 16 POINT OF COMMENCEMENT POINT OF BEGINNING THE SOUTH LINE OF THE SOUTHEAST 14 OF SECTION 16CANAL EXISTING OVERHEADFPL ELECTRIC TRANSMISSION LINE(NOTE: CORRIDOR IS UNDER CONSTRUCTION) THE SOUTH LINE OF THE NORTHEAST 14 OF SECTION 16WEST 1/4 SECTION 16 CCR # 103813 SE CORNER SECTION 16 CCR # 103810 EAST 1/4 CORNER SECTION 16 NOT FOUND (CALCULATED PER CCR # 103809) (INACCESSIBLE- HIGH WATER) SOUTH 1/4 SECTION 16 CCR # 103811 CENTER SECTION 16 CCR # 103814 (CORNER TO CORNER)SURVEY BASELINE (NOT ON SECTION LINE) EXTENDEDN 00°38'16" W 1776.71'N 00°35'25" W 1776.72'S 00°35'25" E 2738.85'(CORNER TO CORNER)N 14 CORNER SECTION 16 (INACCESSIBLE - HIGH WATER) CALCULATED PER CCR # 103528 NW CORNER SECTION 16 NOT FOUND (AREA UNDER CONSTRUCTION) SET NAIL & DISK (LB 7932) PER CCR # 111756 S 00°38'16" E 962.20'STATE ROAD 29VARIABLE WIDTH RIGHT-OF-WAYSECTIONS 03050-000 & 0308-5200100.00100.00 GRADED R O A D EXISTING EAST R/W LINE OF STATE ROAD 29S 00°38'16" E(SURVEY BASELINE)PUMP HOUSEON CONCRETE PAD 6' CHAIN LINK FENCE POINT OF BEGINNINGIngress/Egress Easement STATE ROAD 29Site Boundary (See Detail "C" At Right) IRON ROD & CAP SET 16' NORTH OF CORNER 3.5368 3.9650 S 00°36'45" E 2734.62'L1 L2 L3 L4L5L6 L7 L8 L 9 L 1 0 L 1 1 L 1 2L13L 1 4 L15L16 L17L18L19 L20L21L22L23L 2 4L25 L2 6 L2 7 L2 8 L2 9 L30L31 L3 2 L 3 3 L 3 4 L35L36L37L38 L39 L4 0 L41L 4 2 L 4 3 L44L45L46L 4 7 L 4 8 L49 L50 L5 1 L5 2 L 5 3 L 5 4L55 L56 L57 L58L59L60 L61 L62L63L64L65L66L6 7 L68L69 L 7 0 L 7 1 L7 2 L7 3 L 7 4 L 7 5 L 7 6 L77L78L 7 9 L137L138L139 L140 L141L142 C1C 2 C3C4C5 C6 C7C8C9C10 N 00°37'45" W 893.57'FOUND MAG NAIL LB 7917 SURVEY BASELINE OF STATE ROAD 29 (NOT ON SECTION LINE)F.D.O.T. PROJECT 03050-000STA. 2251+ 00.00 WEST LINE OF THE NW 14 SECTION 16STATE ROAD 29 SURVEY BASELINEN 00°38'16" W 1776.71'N 00°35'25" W 1776.72'S 89°24'35" W 1.54' WEST 14 CORNERSECTION 16 3.01 XXXXXXXXX XXXXXXXXXXXXXXN 00°38'16" W 51.84' S 75°20'01" E 50.00' N 75°20'01" W 345.82' POINT OF BEGINNING Ingress/EgressEasement Ingress /Egress Easement Site Boundary 3.5368 3.9650 S 75°20'01" E307.48'S 07°03'21" W15.13' S 14°38'34" W 35.00' L139 L140 L141N 00°38'16" W 1565.96'STATE ROAD 29EAST RIGHT-OF-WAY LINE OF STATE ROAD 29 N 89°05'11" E 105.28' SW CORNER SECTION 16 CCR # 103812 FOUND MAG NAIL (NO I.D.) 5.2' WEST OF SURVEY BASELINEOF STATE ROAD 29 POINT OF COMMENCEMENT ofRevisionProject Title:6ofSheet No.Prepared for:Dwg. Date:County:Collier County, FloridaPhoto Date:Field Books: 1356Drawn by:Office No.: 6374191196Checked by:Dwg. Name: 6374191196.DWG09/29/2019BJGRMJ2017Collier County, FloridaLocated inALTA/NSPS Land Title SurveyDatePrepared by:RevisionDateGRAPHIC SCALE 1 inch = 250 ft. (IN FEET)NORTH0 125 250 500 2Altamonte Springs, FL 32701 USA Wood Environment & Infrastructure Solutions, Inc. www.woodplc.com Phone: (407) 522-7570 Certificate of Authorization Number LB-0007932 550 Northlake Boulevard, Suite 1000 FLORIDA POWER & LIGHT700 UNIVERSE BOULEVARDJUNO BEACH, FL 33408SEE DETAIL "B" DETAIL "B"BARRON COLLIER - NAPLESSOLAR ENERGY SITELegend: R/W Right of way LB Licensed Business CCR Certified Corner Record L Line C Curve (C)Calculated FPL Florida Power and Light FDOT Florida Department ofTransporation Set Iron Rod with Capmarked " LB 7932" T XXSign Light Pole Telephone Pedestal Power Pole Guy Anchor Barbed Wire Fence Chain Link Fence Overhead WireOU DETAIL "C"DITCHDITCHDITCHSCALE: 1" = 100' SCALE: 1" = 10' SOUTH LINE OF SW 14OF SECTION 16 INGRESS - EGRESS EASEMENT Enhanced mapping of ingress08/07/2020-egress easementC:\Wood Jobs\FPL State Road 29\AutoCAD Civil 3D\Boundary v2.dwg, 8/7/2020 4:39:01 PM3.A.2.c Packet Pg. 329 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) OUOUOUOUOUOUOUOU OU OU OU OU OU OU OUOUOUSW 1/4 SE 1/4 NE 1/4 NW 1/4 SECTION 9 FOUND 5/8" IRON ROD & CAP (CIVILSURV LB 7805) CCR # 103529 CENTER SECTION 9 SE CORNER SECTION 9 FOUND 3"X3" CONCRETE MONUMENT (BROKEN TOP) CCR # 103528 (BROKEN TOP) CCR # 103526 WEST 1/4 CORNER SECTION 9 CCR # 103522 FOUND DISK (CIVILSURV LB 7805) SURVEY BASELINE IS EAST 0.2' FOUND MAG LB 7917 SURVEY BASELINE OF STATE ROAD 29 N. 3.4' , E. 0.4' OF SECTION CORNER (NOT ON SECTION LINE) PROJECT 03050-000 STA. 2288+ 00.00 END OF R/W ACQUISITIONPER F.D.O.T. R/W MAP SECTION 03050-000EAST 14 CORNER SECTION 9 (INACCESSIBLE - HIGH WATER) CALCULATED PER CCR # 103527 S 89°16'49" W 2647.15' S 89°16'49" W 2647.14'80.00 OF ADDITIONAL R/W PER F.D.O.T.R/W MAP SECTION 03050-000STATE R O A D 8 2 R/W V A R I E S P E R F . D . O . T . R/W M A P S E C T I O N 0 3 0 5 0 - 0 0 0 180.00 80.00 ORIGINAL R/W LINE PER F.D.O.T. R/W MAPSECTION 0308-5200EXISTING WEST R/W LINE PER F.D.O.T. R/W MAP SECTION 0308-5200 EXISTING EAST R/W LINE PER F.D.O.T. R/W MAP SECTION 0308-5200 NE CORNER SECTION 9 FND 3"X3" CONCRETE MONUMENT (BROKEN TOP) CCR # 103526 SW CORNER SECTION 4 FOUND RAIL ROAD SPIKE CCR # 081061 SURVEY BASELINE IS EAST 0.2' THE SOUTH LINE OF SECTION 4-46-26 SECTION 9 SECTION 9 SECTION 9 HOUSE SHEDCONCRETEPAD PUMP HOUSE ON CONCRETE PAD PUMP HOUSEON CONCRETE PAD TEMPORARY CONSTRUCTION EASEMENTO.R. 5482 PG. 2990O.R. 5476 PG. 14701920 10' LEE COUNTY ELECTRIC CO-OPERATIVE, INC.RIGHT-OF-WAY EASEMENTO.R. 416 PG. 6998 10.00 10' LEE COUNTY ELECTRIC CO-OPERATIVE, INC.RIGHT-OF-WAY EASEMENTO.R. 416 PG. 6998 THE SOUTH LINE OF THE NORTHWEST 14 OF SECTION 9 THE SOUTH LINE OF THE SOUTHWEST 14 OF SECTION 9 THE EAST LINE OF THE SOUTHWEST 14 OF SECTION 9 THE EAST LINE OF THE NORTHWEST 14 OF SECTION 9 NW CORNER SECTION 16 NOT FOUND (AREA UNDER N 14 CORNER SECTION 16(INACCESSIBLE - HIGH WATER) CALCULATED PER CCR # 103528 S 89°27'37" W 2646.98' N 14 CORNER SECTION 9(INACCESSIBLE - HIGH WATER) CALCULATED PER CCR # 111751 S 00°39'05" E 2747.36'N 00°37'51" W 2734.44'(CORNER TO CORNER)STATE ROAD 29VARIABLE WIDTH RIGHT-OF-WAYSECTIONS 03050-000 & 0308-5200N 89°10'51" E 2646.15' 190.3 DIRT ROAD DIRT DRIVE DIRT ROAD 10.00S00°38'16"E 3699.84'(SURVEY BASELINE)(MAG NAIL TO MAG NAIL)S00°38'16"E 1699.86'100.00SURVEY BASELINE(NOT ON SECTION LINE)100.24S00°38'16"E(SURVEY BASELINE EXTENDED)100.00 DIRT ROADDIRT ROADS 89°27'05" W 2646.33' (C)S 00°39'06" E 2718.22' (C)S 00°39'18" E 2759.85' (C)N 89°10'51" E 2646.15' (C) 123.4S 00°38'03" E 2726.12'L77L78L 7 9L80L81L82L83L84 L85 L8 6 L87 L88L 8 9 L90L91L92L9 3 L94L95L96 L97 L98L99L100L101 L102 L103L104 L105 L106L107 L 1 0 8 L 1 0 9 L110 L111 L1 1 2 L1 1 3 L 1 1 4L115L116L117 L118 L119L120 L121 L122L1 2 3 L135L136C11C12 C13C14BASELINESECTION LINE FOUND DISK(CIVIL SURVEY LB 7805) CCR # 103522WEST 1/4 CORNER SECTION 9 FOUND MAG LB 7917BASELINEOF STATE ROAD 29N. 3.4' , E. 0.4' OFSECTION CORNER (NOT ON SECTION LINE) PROJECT 03050-000 STA. 2288+ 00.00 0.40 N 00°37'51" WS 00°38'16" EofRevisionProject Title:6ofSheet No.Prepared for:Dwg. Date:County:Collier County, FloridaPhoto Date:Field Books: 1356Drawn by:Office No.: 6374191196Checked by:Dwg. Name: 6374191196.DWG09/29/2019BJGRMJ2017Collier County, FloridaLocated inALTA/NSPS Land Title SurveyDatePrepared by:RevisionDateGRAPHIC SCALE 1 inch = 250 ft. (IN FEET)NORTH0 125 250 500 3Altamonte Springs, FL 32701 USA Wood Environment & Infrastructure Solutions, Inc. www.woodplc.com Phone: (407) 522-7570 Certificate of Authorization Number LB-0007932 550 Northlake Boulevard, Suite 1000 FLORIDA POWER & LIGHT700 UNIVERSE BOULEVARDJUNO BEACH, FL 33408SEE DETAIL "A" DETAIL "A"BARRON COLLIER - NAPLESSOLAR ENERGY SITEDITCHDITCHLegend: R/W Right of way LB Licensed Business CCR Certified Corner Record L Line C Curve (C)Calculated FPL Florida Power and Light FDOT Florida Department ofTransporation Set Iron Rod with Capmarked " LB 7932" T XXSign Light Pole Telephone Pedestal Power Pole Guy Anchor Barbed Wire Fence Chain Link Fence Overhead WireOU SCALE: 1" = 10'C:\Wood Jobs\FPL State Road 29\AutoCAD Civil 3D\Boundary v2.dwg, 8/7/2020 3:57:47 PM3.A.2.c Packet Pg. 330 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) OUOUOUSW 1/4 SE 1/4 SECTION 4 NE CORNER SECTION 9 FND 3"X3" CONCRETE MONUMENT (BROKEN TOP) CCR # 103526 SW CORNER SECTION 4 FOUND RAIL ROAD SPIKE CCR # 081061 SURVEY BASELINE IS EAST 0.2' WEST 14 CORNER SECTION 4 FOUND RAIL ROAD SPIKE CCR # 111738 NW CORNER SECTION 4 FOUND MAG NAIL (F.D.O.T. LB 8011) CCR # 81060 NW 1/4 NE 1/4 S 00°30'03" E 2731.66'N 00°32'28" W 2738.43'SECTION 4 SECTION 4SECTION 4 EAST RIGHT-OF-WAY LINE OF STATE ROAD 29 PER F.D.O.T. RIGHT-OF-WAY MAP SECTION 0308-5200 WEST RIGHT-OF-WAY LINE OF STATE ROAD 29 PER F.D.O.T. RIGHT-OF-WAY MAP SECTION 0308-5200 200.00 DIRT ROADWEST LINE OF SECTION 4 THE SOUTH LINE OF THE SOUTHWEST 14 OF SECTION 4STATE ROAD 29VARIABLE WIDTH RIGHT-OF-WAYSECTIONS 03050-000 & 0308-5200N 89°10'51" E 2646.15'STATE ROAD 29VARIABLE WIDTH RIGHT-OF-WAYSECTIONS 03050-000 & 0308-5200(CORNER TO CORNER)(CORNER TO CORNER)N 89°10'51" E 2646.15' (C)L124L 1 2 5L126L127L128 L129 L1 3 0 L131 L132L133 L134C15 ofRevisionProject Title:6ofSheet No.Prepared for:Dwg. Date:County:Collier County, FloridaPhoto Date:Field Books: 1356 Drawn by:Office No.: 6374191196Checked by:Dwg. Name: 6374191196.DWG09/29/2019BJGRMJ2017Collier County, FloridaLocated inALTA/NSPS Land Title SurveyDatePrepared by:RevisionDateGRAPHIC SCALE 1 inch = 250 ft. (IN FEET)NORTH0 125 250 500 4Altamonte Springs, FL 32701 USA Wood Environment & Infrastructure Solutions, Inc. www.woodplc.com Phone: (407) 522-7570 Certificate of Authorization Number LB-0007932 550 Northlake Boulevard, Suite 1000 FLORIDA POWER & LIGHT700 UNIVERSE BOULEVARDJUNO BEACH, FL 33408BARRON COLLIER - NAPLESSOLAR ENERGY SITELegend: R/W Right of way LB Licensed Business CCR Certified Corner Record L Line C Curve (C)Calculated FPL Florida Power and Light FDOT Florida Department ofTransporation Set Iron Rod with Capmarked " LB 7932" T XXSign Light Pole Telephone Pedestal Power Pole Guy Anchor Barbed Wire Fence Chain Link Fence Overhead WireOU C:\Wood Jobs\FPL State Road 29\AutoCAD Civil 3D\Boundary v2.dwg, 8/7/2020 3:57:54 PM3.A.2.c Packet Pg. 331 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) Line TableLine #L1L2L3L4L5L6L7L8L9L10L11L12L13L14L15L16L17L18L19L20DirectionS75°20'01"ES75°55'51"ES73°16'08"EN24°20'38"EN00°11'01"EN65°09'07"WN57°16'10"WN43°09'13"WN27°43'02"WN26°53'04"WN26°53'04"WN29°23'47"WN23°39'31"EN26°18'30"WN60°35'03"WS60°53'17"WS82°21'35"WN85°55'54"WN76°01'53"WN72°44'10"WLength663.02'80.66'59.89'46.79'166.98'354.49'222.58'160.98'223.14'181.96'196.53'172.09'84.45'238.04'32.45'82.09'154.36'100.73'171.69'162.49'Line TableLine #L21L22L23L24L25L26L27L28L29L30L31L32L33L34L35L36L37L38L39L40DirectionN12°10'48"WN01°44'38"WN03°16'14"WN54°58'48"WS66°23'57"WN42°17'26"WN39°29'03"WN40°26'22"WN47°00'34"WN46°28'03"EN51°19'36"ES44°38'05"ES32°07'41"ES26°29'56"ES16°41'39"ES11°15'06"WS51°38'18"EN58°59'56"EN66°50'39"ES58°23'44"ELength34.67'315.28'234.59'141.82'130.52'81.24'183.00'157.67'139.93'124.92'124.92'384.44'185.42'106.41'97.52'64.58'174.02'95.19'102.19'118.23'Line TableLine #L41L42L43L44L45L46L47L48L49L50L51L52L53L54L55L56L57L58L59L60DirectionS49°00'58"ES29°30'33"ES26°48'25"ES21°07'20"ES01°54'46"WS01°54'46"WS28°03'10"ES28°00'26"ES89°48'40"ES66°14'26"ES57°52'50"ES45°37'09"ES31°19'19"ES37°05'37"EN80°36'14"EN88°08'24"ES61°38'14"ES09°59'57"ES11°53'31"ES62°47'07"ELength159.00'210.80'439.41'42.79'15.86'101.19'226.25'99.95'54.82'196.18'294.12'423.70'327.77'60.56'95.15'282.49'207.86'320.20'279.08'77.50'Line TableLine #L61L62L63L64L65L66L67L68L69L70L71L72L73L74L75L76L77L78L79L80DirectionS75°15'51"EN00°38'44"WS51°03'41"WN16°45'04"WN00°37'25"WN00°37'25"WN58°07'50"WN60°58'32"WS74°42'31"WN24°42'10"WN30°15'20"WN40°28'47"WN41°30'42"WN27°09'40"WN47°41'01"WN47°45'02"WS89°17'09"WN14°36'16"WN24°46'59"WN00°59'49"WLength883.29'1864.68'115.91'173.47'48.87'29.69'516.62'54.63'145.11'277.56'132.74'112.93'393.81'812.57'81.72'793.37'787.79'35.37'187.13'421.04'Line TableLine #L81L82L83L84L85L86L87L88L89L90L91L92L93L94L95L96L97L98L99L100DirectionN12°00'51"WN19°15'03"WS78°29'00"WS87°20'35"WN67°17'58"WN58°48'58"WN44°25'54"ES50°21'03"ES31°09'57"ES19°05'08"ES16°02'13"ES17°29'29"ES59°43'57"ES44°57'50"ES78°33'33"EN84°04'34"ES83°57'49"EN07°00'55"EN22°51'25"EN36°27'33"ELength176.45'175.51'173.54'106.34'183.95'208.56'219.41'142.88'146.21'233.59'209.04'227.30'161.60'152.29'63.17'115.72'121.00'74.47'124.02'232.68'Line TableLine #L101L102L103L104L105L106L107L108L109L110L111L112L113L114L115L116L117L118L119L120DirectionN54°53'24"EN64°07'04"EN00°52'43"WN88°54'48"EN88°54'48"EN00°48'36"WN68°23'03"WN54°59'17"WN54°59'17"WS75°46'20"WN88°35'50"WN45°29'35"WN45°32'03"WN31°54'09"WN22°17'55"WN17°37'56"WN48°46'26"EN54°12'46"EN58°31'38"EN85°48'47"ELength274.99'153.09'403.18'115.19'183.21'759.02'64.52'149.10'480.61'374.76'166.43'222.14'351.59'209.90'323.94'138.86'377.70'240.92'134.18'59.56'Line TableLine #L121L122L123L124L125L126L127L128L129L130L131L132L133L134L135L136L137L138L139L140DirectionS83°16'43"EN01°28'07"WN41°08'30"WN02°52'53"WN35°32'28"WN44°57'52"WN85°22'41"WN81°24'25"WN70°36'56"WN57°44'59"WS86°31'53"WS16°13'27"WS89°11'36"WS00°31'26"ES00°38'16"ES00°38'16"ES00°38'16"ES00°38'16"ES79°08'44"ES74°48'48"ELength576.57'734.95'620.76'524.65'248.76'70.03'129.08'85.32'123.88'249.10'262.02'244.98'465.18'761.64'2734.95'2734.05'2738.75'1008.74'207.57'113.82'Line TableLine #L141L142DirectionS07°03'21"WS75°20'01"ELength137.12'2333.17'Curve TableCurve #C1C2C3C4C5C6C7C8C9C10C11C12C13C14C15Length188.36315.47352.52360.46345.44237.80539.57142.73118.01398.28325.71405.5074.90313.10358.50Radius180.15334.58337.03287.61346.99226.62292.21135.93112.22380.90310.99386.0172.07298.99159.87Delta059° 54' 32"054° 01' 23"059° 55' 46"071° 48' 29"057° 02' 26"060° 07' 16"105° 47' 48"060° 09' 32"060° 15' 25"059° 54' 38"060° 00' 27"060° 11' 16"059° 32' 26"060° 00' 00"128° 28' 53"Chord DirectionN03° 11' 40"WN42° 10' 17"WN85° 02' 20"WN04° 19' 28"WS87° 47' 38"ES81° 47' 06"EN65° 09' 57"WN22° 37' 15"WN83° 31' 49"WN62° 32' 13"WN06° 27' 09"WS89° 30' 14"EN57° 25' 32"EN12° 37' 33"EN86° 03' 03"WChord Length179.90303.91336.67337.33331.35227.04466.11136.26112.65380.39311.03387.1171.57298.99287.97of RevisionProject Title: 6of Sheet No. Prepared for: Dwg. Date:County:Collier County, Florida Photo Date:Field Books: 1356 Drawn by:Office No.: 6374191196 Checked by:Dwg. Name: 6374191196.DWG 09/29/2019 BJG RMJ 2017 Collier County, Florida Located in ALTA/NSPS Land Title Survey DatePrepared by:Revision Date 5 Altamonte Springs, FL 32701 USAWood Environment & Infrastructure Solutions, Inc.www.woodplc.comPhone: (407) 522-7570Certificate of Authorization Number LB-0007932550 Northlake Boulevard, Suite 1000FLORIDA POWER & LIGHT 700 UNIVERSE BOULEVARD JUNO BEACH, FL 33408 BARRON COLLIER - NAPLESSOLAR ENERGY SITE C:\Wood Jobs\FPL State Road 29\AutoCAD Civil 3D\Boundary v2.dwg, 8/7/2020 3:58:25 PM 3.A.2.cPacket Pg. 332Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) ofRevisionProject Title:6ofSheet No.Prepared for:Dwg. Date:County:Collier County, FloridaPhoto Date:Field Books: 1356 Drawn by:Office No.: 6374191196Checked by:Dwg. Name: 6374191196.DWG09/29/2019BJGRMJ2017Collier County, FloridaLocated inALTA/NSPS Land Title SurveyDatePrepared by:RevisionDate6Altamonte Springs, FL 32701 USA Wood Environment & Infrastructure Solutions, Inc. www.woodplc.com Phone: (407) 522-7570 Certificate of Authorization Number LB-0007932 550 Northlake Boulevard, Suite 1000 FLORIDA POWER & LIGHT700 UNIVERSE BOULEVARDJUNO BEACH, FL 33408BARRON COLLIER - NAPLESSOLAR ENERGY SITEGRAPHIC SCALE1 inch = 400 ft.(IN FEET)NORTH0200400800Legend:ACRES GROSS ACREAGE =613.98± ACRES GROSS ACREAGE (PER THIS SURVEY)=577.93± ACRES LESS OUT ACREAGE =29.59± ACRES NET ACREAGE =548.34± ACRES = LESS OUT ACREAGE SECTION 4 SECTION 9 SECTION 16 LIMITS OF BOUNDARY SURVEY STATE ROAD 29 STATE ROAD 82SURVEYED BOUNDARY GROSS AREA BOUNDARY (APPROXIMATE TOP OF BANK AS SCALED FROM AERIAL IMAGERY) EAST R/W LINE (SURVEYED BOUNDARY)C:\Wood Jobs\FPL State Road 29\AutoCAD Civil 3D\Boundary v2.dwg, 8/7/2020 3:58:38 PM3.A.2.c Packet Pg. 333 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) VARIANCE SITE PLAN 3.A.2.c Packet Pg. 334 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) SR 29SR 82 ZONING: A-MHO RLSAO EXISTING LAND USE: AGRICULTURAL / WETLANDS ZONING: A-MHO RLSAO EXISTING LAND USE: AGRICULTURAL / WETLANDS ZONING: A-MHO RLSAO EXISTING LAND USE: AGRICULTURAL / WETLANDS 1 1 1 1 1 ZONING: A-MHO RLSAO EXISTING LAND USE: AGRICULTURAL NO BUFFER REQUIRED PROJECT BOUNDARY PROPOSED ACCESS PATH NO BUFFER REQUIRED NO BUFFER REQUIREDSTATE ROAD 29 (SR 29)NO BUFFER REQUIRED NO BUFFER REQUIREDNO BUFFER REQUIRED 1 PROJECT BOUNDARY PROPOSED GATE PROJECT BOUNDARY 25' PRESERVE SETBACK PRESERVE PROJECT BOUNDARY 25' PRESERVE SETBACK PRESERVE PROPOSED 8' PERIMETER FENCE PROPOSED GATE PROPOSED ACCESS PATH PROJECT BOUNDARY ±88' WIDE EXISTING VEGETATION PROPOSED GATE 25' PRESERVE SETBACK PRESERVE 200' WIDE FDOT SR 29 ROW 25' PRESERVE SETBACK PRESERVE PROPOSED GATE PROPOSED ACCESS PATH 1 NO BUFFER REQUIRED 1 NO BUFFER REQUIRED 1 NO BUFFER REQUIRED ZONING: A-MHO RLSAO EXISTING LAND USE: AGRICULTURAL PREPARED FOR: IMMOKALEE SOLAR VARIANCE SITE PLAN SHEET: FILE NAME:B:\Projects\1053-001 (SR29 Solar Field) Due Diligence\Drawings-Exhibits\1053-001-E01 Buffer Variance Site Plan\Current Plans\1053001E0101.dwgWALDROP ENGINEERING CIVIL ENGINEERING FLORIDA CERTIFICATE OF AUTHORIZATION #8636 28100 BONITA GRANDE DRIVE - SUITE 305 BONITA SPRINGS, FL 34135 P: 239-405-7777 F: 239-405-7899 EMAIL: info@waldropengineering.com PL 20200002126 PLAN REVISIONS REV00 <<SUBMITTED>> 11/20/20 PLANNING LANDSCAPE ARCHITECTURE 1053001E0101.dwg 1 OF 1 NORTH SCALE: 1" = 1500' FLORIDA POWER & LIGHT COMPANY (FPL) 700 UNIVERSE BOULEVARD JUNO BEACH, FL 33408 (561)691-7001 DEVELOPMENT AREA EXISTING VEGETATION RIGHT-OF-WAY (ROW) PROJECT BOUNDARY NON-DEVELOPED AREAS PRESERVE PROPOSED COLLECTOR YARD PROPOSED FENCE LINE INGRESS/EGRESS PROPOSED GATE LOCATION PROPOSED ACCESS PATH LEGEND SITE DATA TOTAL SITE AREA EXISTING ZONING EXISTING LAND USE FUTURE LAND USE PROPOSED LAND USE 578 ± A-MHO RLSAO AGRICULTURAL (CITRUS CROPS) AGRICULTURE / RURAL MIXED USE DISTRICT / RURAL LANDS STEWARDSHIP OVERLAY AREA (RLSA) SOLAR ENERGY CENTER / ESSENTIAL SERVICE (ELECTRIC GENERATING PLANT) VARIANCE REQUEST #VARIANCE LOCATION 1 PERIMETER BUFFER VARIANCE FROM LDC SECTION 4.06.02.C TABLE 2.4 TABLE OF BUFFER REQUIREMENTS BY LAND USE CLASSIFICATIONS. 3.A.2.c Packet Pg. 335 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) CROSS SECTIONS 3.A.2.c Packet Pg. 336 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) W W W W W O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HX X X XXXXXXXX XXXXX X XXXX X X XXX X X X XXX XX XX X XX X XXX X X XXXXXXXXXXX X X X XXXXXXXX X X XXXXXXX X XX X X X XXXX X XXX XX X XXX X X XXXXXXXXXXXXX X XX XXXXX X X XX X XXXXX XXXX XXXXXXXXX X XXXXXXXXXXXXXXXXXXXX XX X X X X X X X X X X X XO/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H PROJECT NO: DATE: SHEET TITLE SHEET THIS LINE IS ONE INCH LONG WHEN PLOTTED FULL SCALE THIS DRAWING MUST BE USED IN CONJUNCTION WITH THE APPLICABLE OR GOVERNING TECHNICAL SPECIFICATIONS AND OTHER CONTRACT DOCUMENTS. DISC. LEAD:DESIGNER:CHECKER:REVDATEREVISION DESCRIPTION1 A B C D E F 2 3 4 5 6 7 8 3300 PGA BLVD, SUITE 780 PALM BEACH GARDENS, FL 33410PHONE: 561.799.3855FLORIDA C.O.A. #2822DRAWING NO. OFDESIGN ENGINEER:DAVID O. SCOTT, PE.FLORIDA REGISTRATION NO. 58166EEXJ0411 DECEMBER 2020 FLORIDA POWER & LIGHT COMPANYSOLAR ENERGY CENTERFPL IMMOKALEE DOS JCH WESTERN BOUNDARY CROSS SECTION KEY SHEET C-10013 JANUARY 2021 PRELIMINARY DESIGN FOR PERMITTING ONLY AGI AGI LOCATION OF NORTHERN SECTION LOCATION OF SOUTHERN SECTION SR 8 2 SR 29SR 29PROPOSED SOLAR SITE SITE PICTURE LOOKING NORTH N.T.S. SITE PICTURE LOOKING NORTH N.T.S. 3.A.2.c Packet Pg. 337 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) Elevation (ft NAVD)Station 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 -0+50 0+00 0+50 1+00 1+50 2+00 2+50 3+00 3+50 44 45 O/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HXXXXXXXXXXXXXXXXXPROJECT NO: DATE: SHEET TITLE SHEET THIS LINE IS ONE INCH LONG WHEN PLOTTED FULL SCALE THIS DRAWING MUST BE USED IN CONJUNCTION WITH THE APPLICABLE OR GOVERNING TECHNICAL SPECIFICATIONS AND OTHER CONTRACT DOCUMENTS. DISC. LEAD:DESIGNER:CHECKER:REVDATEREVISION DESCRIPTION1 A B C D E F 2 3 4 5 6 7 8 3300 PGA BLVD, SUITE 780 PALM BEACH GARDENS, FL 33410PHONE: 561.799.3855FLORIDA C.O.A. #2822DRAWING NO. OFDESIGN ENGINEER:DAVID O. SCOTT, PE.FLORIDA REGISTRATION NO. 58166EEXJ0411 DECEMBER 2020 FLORIDA POWER & LIGHT COMPANYSOLAR ENERGY CENTERFPL IMMOKALEE ------------ DOS JCH NORTH SECTION C-10123 WESTERN SITE BOUNDARY NORTHERN CROSS SECTION 1H:5V STREET VIEW AT CROSS SECTION LOCATION N.T.S. PLAN VIEW AT CROSS SECTION LOCATION 1" = 80' HEIGHT OF CAMERA = 8.2 FT AVERAGE HEIGHT OF DRIVER'S LINE OF SIGHT = 4 FT ESTIMATED BRAZILIAN PEPPER HEIGHT = 8 FT STATE ROAD 29 LOCATION OF CROSS SECTION PROPOSED SOLAR SITE EXISTING STATE ROAD 29 DRAINAGE DITCH PERIMETER BERM & EXISTING ACCESS ROAD EXISTING GROVE DRAINAGE DITCH EXISTING GROVE GRADE CROSS SECTION LOCATION SR 29EXISTING STATE ROAD 29 DRAINAGE DITCH PERIMETER BERM EXISTING GROVE DRAINAGE DITCH EXISTING GROVE AREA BRAZILIAN PEPPER SOLAR PANEL PROPERTY LINE OVERHEAD ELECTRICAL (ESTIMATED FROM SURVEY AND AERIALS) 10' OHE EASEMENT - NO PLANTINGS ALLOWED PROPERTY LINE OVERHEAD ELECTRICAL 10' OHE EASEMENT - NO PLANTINGS ALLOWED 163' PROPOSED SOLAR GRADE SOLAR ACCESS PATH +/- 38.5' +/- 33.4' +/- 40.0' +/- 31.8' +/- 39.6' 3.A.2.c Packet Pg. 338 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) Elevation (ft NAVD)Station 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 -0+50 0+00 0+50 1+00 1+50 2+00 2+50 3+00 3+50 4+00 45 46 47 48 O/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HXXXXXXXXXXXXXXXXXXPROJECT NO: DATE: SHEET TITLE SHEET THIS LINE IS ONE INCH LONG WHEN PLOTTED FULL SCALE THIS DRAWING MUST BE USED IN CONJUNCTION WITH THE APPLICABLE OR GOVERNING TECHNICAL SPECIFICATIONS AND OTHER CONTRACT DOCUMENTS. DISC. LEAD:DESIGNER:CHECKER:REVDATEREVISION DESCRIPTION1 A B C D E F 2 3 4 5 6 7 8 3300 PGA BLVD, SUITE 780 PALM BEACH GARDENS, FL 33410PHONE: 561.799.3855FLORIDA C.O.A. #2822DRAWING NO. OFDESIGN ENGINEER:DAVID O. SCOTT, PE.FLORIDA REGISTRATION NO. 58166EEXJ0411 DECEMBER 2020 FLORIDA POWER & LIGHT COMPANYSOLAR ENERGY CENTERFPL IMMOKALEE ------------ DOS JCH SOUTH SECTION C-10233 WESTERN SITE BOUNDARY SOUTHERN CROSS SECTION 1H:5V STREET VIEW AT CROSS SECTION LOCATION N.T.S. PLAN VIEW AT CROSS SECTION LOCATION 1" = 80' HEIGHT OF CAMERA = 8.2 FT AVERAGE HEIGHT OF DRIVER'S LINE OF SIGHT = 4 FT ESTIMATED HEIGHT OF BRAZILIAN PEPPER = 8 FT STATE ROAD 29 LOCATION OF CROSS SECTION PROPOSED SOLAR SITE EXISTING STATE ROAD 29 DRAINAGE DITCH PERIMETER BERM & EXISTING ACCESS PATH EXISTING GROVE DRAINAGE DITCH EXISTING GROVE GRADE CROSS SECTION LOCATION SR 29EXISTING STATE ROAD 29 DRAINAGE DITCH PERIMETER BERM EXISTING GROVE DRAINAGE DITCH EXISTING GROVE AREA BRAZILIAN PEPPER SOLAR PANEL BRAZILIAN PEPPER (HEIGHT ESTIMATED FROM GOOGLE MAPS TREET VIEW) PROPERTY LINE OVERHEAD ELECTRICAL 10' OHE EASEMENT - NO PLANTINGS ALLOWED PROPERTY LINE OVERHEAD ELECTRICAL 10' OHE EASEMENT - NO PLANTINGS ALLOWED 158' 5' SOLAR ACCESS PATH PROPOSED SOLAR GRADE +/- 39.6' +/- 35.6' +/- 41.0' +/- 32.6' +/- 36.4' 3.A.2.c Packet Pg. 339 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) SUPPLEMENTARY PLANTING EXHIBIT 3.A.2.c Packet Pg. 340 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) W W W W W O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HXX X XX X X X X X X X X XX XXXXX XXXXX XXXXX X X XXX X X XXXX X X XXX X X X X X X XXXXXX XXXX X X XXXXXXXX X X XXXXXXXX XXX X X XXXX X X XX X XX XXXX X X XXX XXXX X XXX X XX XX XXXXX X X XX X XXXXXXXXXXXXXX XXXX XXXXXXXXXXXXXXXXXXXX X XX X X X X X X X XXXXO/H O/H O/H O/H O/H O/H O/H O/H GATE TYPICAL HEDGE 10' 4'2'ALTERNATING 500 FOOT HEDGE SECTIONS HEDGE SPECIES #1 QTY: 750 6 HEDGE SECTIONS @ 500' LONG CHRYSOBALANUS ICACO 'RED TIP' RED TIP COCOPLUM 10 G - 36" HEIGHT X 24" WIDTH, 48" ON CENTER HEDGE SPECIES #2 QTY: 750 6 HEDGE SECTIONS @ 500' LONG VIBURNUM OBOVATUM WALTER'S VIBURNUM 10 G - 36" HEIGHT X 24" WIDTH, 48" ON CENTER EXISTING GROUND EXISTING ACCESS PATH 10' SOLAR ACCESS PATH20'6' TALL PANTHER FENCE BY OTHERS MULCH LINE MULCH AREA 6' TALL PANTHER FENCE BY OTHERS HEDGE MULCH LINE 10' 4'2'EXISTING GROUND EXISTING DITCH TOB EXISTING DITCH TOE MULCH AREA 20'ALTERNATING 500 FOOT HEDGE SECTIONS HEDGE SPECIES #1 QTY: 750 6 HEDGE SECTIONS @ 500' LONG CHRYSOBALANUS ICACO 'RED TIP' RED TIP COCOPLUM 10 G - 36" HEIGHT X 24" WIDTH, 48" ON CENTER HEDGE SPECIES #2 QTY: 750 6 HEDGE SECTIONS @ 500' LONG VIBURNUM OBOVATUM WALTER'S VIBURNUM 10 G - 36" HEIGHT X 24" WIDTH, 48" ON CENTER PROJECT NO: DATE: SHEET TITLE SHEET THIS LINE IS ONE INCH LONG WHEN PLOTTED FULL SCALE THIS DRAWING MUST BE USED IN CONJUNCTION WITH THE APPLICABLE OR GOVERNING TECHNICAL SPECIFICATIONS AND OTHER CONTRACT DOCUMENTS. DISC. LEAD:DESIGNER:CHECKER:REVDATEREVISION DESCRIPTION1 A B C D E F 2 3 4 5 6 7 8 3300 PGA BLVD, SUITE 780 PALM BEACH GARDENS, FL 33410PHONE: 561.799.3855FLORIDA C.O.A. #2822DRAWING NO. OFDESIGN ENGINEER:DAVID O. SCOTT, PE.FLORIDA REGISTRATION NO. 58166EEXJ0411 MARCH 2021 FLORIDA POWER & LIGHT COMPANYSOLAR ENERGY CENTERFPL IMMOKALEE DOS JCH SUPPLEMENTARY PLANTING EXHIBIT C-10012 MARCH 2021 AGI AGISR 8 2 SR 29SR 29PROPOSED SOLAR SITE PROPOSED BUFFER VARIANCE PLANTINGS 6 FT SITE PANTHER FENCE PROPOSED BUFFER VARIANCE PLANTINGS PROPOSED BUFFER VARIANCE PLANTINGS 6 FT PANTHER SITE FENCE APPROXIMATE LENGTH OF BUFFER PLANTINGS = 6000 FEET PERIMETER HEDGE GATE BREAK DETAIL N.T.S. PERIMETER HEDGE DITCH BREAK DETAIL N.T.S. NO BUFFER REQUIRED NO BUFFER REQUIRED NO BUFFER REQUIRED 3.A.2.c Packet Pg. 341 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) Elevation (ft NAVD)Station 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 -0+50 0+00 0+50 1+00 1+50 2+00 2+50 3+00 3+50 44 45 1 1 Elevation (ft NAVD)Station 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 -0+50 0+00 0+50 1+00 1+50 2+00 2+50 3+00 3+50 4+00 45 46 47 48 1 1 45° SCARIFY WALLS AND BOTTOM OF PLANT PIT DEPTH VARIES DEPENDING ON ROOTBALL HEIGHT. PLANT SHRUB w/ROOT CROWN AT SOIL SURFACE LIGHTLY TAMP PIT BOTTOM TO PREVENT SETTLING MULCH - 3" DEPTH SHREDDED HARDWOOD. KEEP 2"-3" AWAY FROM STEM. DO NOT CYPRESS. FINISH GRADE EXISTING ADJACENT GRASS AREA 3X BALL DIAMETER 6' TALL PANTHER FENCE BY OTHERS HEDGE 2'2' 10' CAN BE BACKFILLED WITH NATIVE SOIL AS LONG AS THE NATIVE SOIL MEETS FDOT SPEC 987-2.4. OTHERWISE MUST USE PREPARED TOPSOIL: BACKFILL WITH A MIX OF 70/30 CLEAN SAND AND MUCK. WATER THOROUGHLY DURING INSTALLATION. DO NOT FERTILIZE.PROJECT NO: DATE: SHEET TITLE SHEET THIS LINE IS ONE INCH LONG WHEN PLOTTED FULL SCALE THIS DRAWING MUST BE USED IN CONJUNCTION WITH THE APPLICABLE OR GOVERNING TECHNICAL SPECIFICATIONS AND OTHER CONTRACT DOCUMENTS. DISC. LEAD:DESIGNER:CHECKER:REVDATEREVISION DESCRIPTION1 A B C D E F 2 3 4 5 6 7 8 3300 PGA BLVD, SUITE 780 PALM BEACH GARDENS, FL 33410PHONE: 561.799.3855FLORIDA C.O.A. #2822DRAWING NO. OFDESIGN ENGINEER:DAVID O. SCOTT, PE.FLORIDA REGISTRATION NO. 58166EEXJ0411 FEBRUARY 2021 FLORIDA POWER & LIGHT COMPANYSOLAR ENERGY CENTERFPL IMMOKALEE ------------ DOS JCH SUPPLEMENTARY PLANTING EXHIBIT SECTIONS C-10122 STATE ROAD 29 EXISTING STATE ROAD 29 DRAINAGE DITCH PERIMETER BERM & EXISTING ACCESS ROAD EXISTING GROVE DRAINAGE DITCH SOLAR PANEL PROPERTY LINE OVERHEAD ELECTRICAL (ESTIMATED FROM SURVEY AND AERIALS) 10' OHE EASEMENT - NO PLANTINGS ALLOWED PROPOSED SOLAR GRADE SOLAR ACCESS PATH +/- 38.5' +/- 33.4' +/- 40.0' +/- 31.8' +/- 33.9' PROPOSED BUFFER VARIANCE PLANTINGS AT FULL HEIGHT 10' FROM EXISTING PATH TO PLANTINGS 10' PROPOSED SOLAR GRADE NO BUFFER LOCATION TYPICAL CROSS-SECTION 1H:5V STATE ROAD 29 EXISTING STATE ROAD 29 DRAINAGE DITCH PERIMETER BERM & EXISTING ACCESS PATH EXISTING GROVE DRAINAGE DITCH SOLAR PANEL EXISTING VEGETATION OUTSIDE PROPERTY PROPERTY LINE OVERHEAD ELECTRICAL 10' OHE EASEMENT - NO PLANTINGS ALLOWED 158' 5' SOLAR ACCESS PATH PROPOSED SOLAR GRADE +/- 39.6' +/- 35.6' +/- 41.0' +/- 32.6' +/- 36.9' SOLAR PANEL BUFFER LOCATION TYPICAL CROSS-SECTION 1H:5V TYPICAL PLANTING DETAIL N.T.S. TASK AMOUNT MINIMUM FREQUENCY WATERING MAINTAIN ADEQUATE SOIL MOISTURE TO KEEP PLANTS IN FLORIDA #1 CONDITION. CONTRACTOR TO SUPPLY WATER. WEEDING ALL MULCH AREAS.MONTHLY DURING THE WARRANTY PERIOD EDGING ALL SHRUB MULCHED BEDS MONTHLY DURING THE WARRANTY PERIOD WATERING AND MAINTENANCE SCHEDULE HAND WATER DAILY FOR THE FIRST MONTH WITH 2.5 GALLONS, PER SHRUB (EXCLUDING RAIN DAYS), THEN THREE TIMES A A WEEK FOR THE 2ND AND 3RD MONTHS, THEN AS NEEDED TO KEEP PLANTS HEALTHY DURING THE WARRANTY PERIOD. *IN ADDITION TO THE ROOT BALL, THE BACKFILLED SOIL MUST ALSO BE ADEQUATELY WATERED TO ENSURE THE SUCCESSFUL GROWTH OF THE NEW PLANTINGS 3.A.2.c Packet Pg. 342 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) LINE OF SIGHT 3.A.2.c Packet Pg. 343 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) Solar PanelSolar Panel Existing Grove Area Existing Grove Area Solar PanelSolar Panel Perimeter Berm Perimeter Berm 10 foot Electrical Easement (No Plantings Allowed) 10 foot Electrical Easement (No Plantings Allowed) Property LineProperty Line Property LineProperty Line Existing Grove Drainage Ditch Existing Grove Drainage Ditch Existing Grove Drainage Ditch Existing Grove Drainage Ditch Perimeter Berm Perimeter Berm State Road 29State Road 29 State Road 29State Road 29 Line of SightLine of Sight WESTWEST EASTEAST WESTWEST EASTEAST WESTERN SITE BOUNDARY NORTHERN CROSS SECTION PL IMMOKALEE SOLAR ENERGY CENTER WESTERN SITE BOUNDARY SOUTHERN CROSS SECTION Overhead Electrical Overhead Electrical Overhead Electrical Overhead Electrical Existing Grove Area Existing Grove Area 38.5'38.5' 33.4'33.4'33.9'33.9'31.8'31.8' 40.0'40.0' 39.6'39.6'35.6'35.6'36.4'36.4'32.3'32.3' 41.0'41.0' 40.0'40.0' Line of SightLine of Sight30 20 10 0 40 50 60 70 80 90 100 Approximate Elevation (in feet)Approximate Horizontal Distance (in feet) 30 20 10 0 40 50 60 70 80 90 100 Approximate Elevation (in feet)0 100 200 Approximate Horizontal Distance (in feet) 0 100 200 10 foot Electrical Easement (No Plantings Allowed) 10 foot Electrical Easement (No Plantings Allowed) Existing SR29 Drainage Ditch Existing SR29 Drainage Ditch Existing Access Path Existing Access Path Existing Access Path Existing Access Path Existing SR29 Drainage Ditch Existing SR29 Drainage Ditch W W W W W O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HO/HX X X XXXXXXXX XXXXX X X XXX X X X XX X X X XXX XX XX X XX X XXX X X XXXXXXXXXXX X X X XXX XXXXX X X XXXXXXX X XX X X X XXXX X XXXXX X XXX X X XXXXXXXXXXXXX X XXXXXXXXXXXXXXXXXX XXX XXXXX X XXX XXXXXXXXXXXXXXXXXXXXX XX X X X X X X X X X X X XO/H O/H O/H O/H O/H O/H O/H O/H O/H O/H O/H PROJECT NO: DATE: SHEET TITLE SHEET THIS LINE IS ONE INCH LONG WHEN PLOTTED FULL SCALE THIS DRAWING MUST BE USED IN CONJUNCTION WITH THE APPLICABLE OR GOVERNING TECHNICAL SPECIFICATIONS AND OTHER CONTRACT DOCUMENTS. DISC. LEAD:DESIGNER:CHECKER:REVDATEREVISION DESCRIPTION1 A B C D E F 2 3 4 5 6 7 8 3300 PGA BLVD, SUITE 780 PALM BEACH GARDENS, FL 33410PHONE: 561.799.3855FLORIDA C.O.A. #2822DRAWING NO.OFDESIGN ENGINEER:DAVID O. SCOTT, PE.FLORIDA REGISTRATION NO. 58166EEXJ0411 DECEMBER 2020 DOS JCH WESTERN BOUNDARY CROSS SECTION KEY SHEET JANUARY 2021 PRELIMINARY DESIGN FOR PERMITTING ONLY AGI AGI LOCATION OF NORTHERN SECTION LOCATION OF SOUTHERN SECTION SR 82 SR 29SR 29PROPOSED SOLAR SITE SITE PICTURE LOOKING NORTH N.T.S. SITE PICTURE LOOKING NORTH N.T.S. 3.A.2.c Packet Pg. 344 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) RENDERING 3.A.2.c Packet Pg. 345 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) 3.A.2.c Packet Pg. 346 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) 2 3.A.2.c Packet Pg. 347 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) AERIAL LOCATION MAP 3.A.2.c Packet Pg. 348 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) AERIAL MAP PROJECT BOUNDARY 3300 PGA BLVD, SUITE 780 PALM BEACH GARDENS, FL 33410 PHONE: 561.799.3855 FLORIDA C.O.A. #2822 FLORIDA POWER & LIGHT COMPANY (FPL) 700 UNIVERSE BOULEVARD JUNO BEACH, FL 33408 (561) 691-7001 COLLIER COUNTY HENDRY COUNTYSR-29SR-29SR-8 2 846 S R - 2 9 IMMOKALEE REGIONAL AIRPOR T Immokalee Felda S R - 2 9 PARCEL BOUNDARY IMMOKALEE SOLAR CONDITIONAL USE REV DATE: OCT 30, 2020 3.A.2.c Packet Pg. 349 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) SIGN POST AFFIDAVIT & PHOTOS 3.A.2.c Packet Pg. 350 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) 3.A.2.c Packet Pg. 351 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) SIGN POST IMMOKALEE SOLAR CU-PL2020-1865 & VA-PL2020-2161 3.A.2.c Packet Pg. 352 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) SIGN POST IMMOKALEE SOLAR CU-PL2020-1865 & VA-PL2020-2161 3.A.2.c Packet Pg. 353 Attachment: Attachment B - Backup Materials (15587 : PL20200002161 Immokalee Solar VA) 3.A.2.dPacket Pg. 354Attachment: Attachment C - Hybrid Meeting Waiver (15587 : PL20200002161 Immokalee Solar VA)