The URL can be used to link to this page

CCPC Agenda 11/19/2020 Collier County Planning Commission Page 1 Printed 11/12/2020 COLLIER COUNTY Collier County Planning Commission AGENDA Board of County Commission Chambers Collier County Government Center 3299 Tamiami Trail East, 3rd Floor Naples, FL 34112 November 19, 2020 9: 00 AM Edwin Fryer- Chairman Karen Homiak - Vice-Chair Karl Fry- Secretary Christopher Vernon Paul Shea, Environmental Joseph Schmitt, Environmental Robert Klucik, Jr. Thomas Eastman, Collier County School Board Note: Individual speakers will be limited to 5 minutes on any item. Individuals selec ted to speak on behalf of an organization or group are encouraged and may be allotted 10 minutes to speak on an item if so recognized by the chairman. Persons wishing to have written or graphic materials included in the CCPC agenda packets must submit said material a minimum of 10 days prior to the respective public hearing. In any case, written materials intended to be considered by the CCPC shall be submitted to the appropriate county staff a minimum of seven days prior to the public hearing. All material used in presentations before the CCPC will become a permanent part of the record and will be available for presentation to the Board of County Commissioners if applicable. Any person who decides to appeal a decision of the CCPC will need a record of the proceedings pertaining thereto, and therefore may need to ensure that a verbatim record of the proceedings is made, which record includes the testimony and evidence upon which the appeal is to be based. November 2020 Collier County Planning Commission Page 2 Printed 11/12/2020 1. Pledge of Allegiance 2. Roll Call by Secretary 3. Addenda to the Agenda 4. Planning Commission Absences 5. Approval of Minutes 6. BCC Report - Recaps 7. Chairman's Report 8. Consent Agenda 9. Public Hearings A. Advertised 1. ***Note: This item was continued from the October 15, 2020 CCPC meeting to th e November 5, CCPC meeting and further continued to the November 19, 2020 CCPC meeting*** PL20180002233 GMPA A Resolution of the Board of County Commissioners proposing amendment to the Collier County Growth Management Plan, Ordinance 89-05, as amended, specifically amending the Future Land Use Element and Map Series to create the NC Square Mixed-Use Overlay on land in the Agricultural/Rural designation and Rural Fringe Mixed Use District -Receiving Lands Overlay to allow up to 44,400 square feet of commercial uses, a 12,000 square foot daycare limited to 250 students, and a maximum of 129 residential dwelling units and furthermore providing for transmittal of the amendment to the Florida Department of Economic Opportunity. The subject property is 24.4 acres and located at the northwest corner of Immokalee Road and Catawba Street approximately 1.6 miles west of Wilson Boulevard in Section 29, Township 49 South, Range 27 East, Collier County, Florida. [Coordinator: Corby Schmidt, Principal Planner] November 2020 Collier County Planning Commission Page 3 Printed 11/12/2020 2. ***Note: This item was continued from the October 15, 2020 CCPC meeting to the November 5, CCPC meeting and further continued to the November 19, 2020 CCPC meeting*** PL20190002305 - MPUD (PUDR) Sabal Bay- Fleischmann Parcel An Ordinance of the Board of County Commissioners of Collier County, Florida amending Ordinance No. 05-59, as amended, the Sabal Bay Mixed Use Planned Unit Development, and amending Ordinance No. 2004-41, the Collier County Land Development Code, by amending the appropriate zoning atlas map or maps by changing the zoning classification of an additional 102.49± acres of land zoned Rural Agricultural (A), Rural Agricultural with a Special Treatment overlay (A - ST), Residential Single Family-Three (RSF-3) and Residential Single Family-Three with a Special Treatment overlay (RSF-3-ST) to the Sabal Bay Mixed Use Planned Unit Development (MPUD); by amending the PUD document and master plan to add 102.49± acres designated as Tract R9 for residential development; to add 230 dwelling units for a total of 2,229 dwelling units in the MPUD; to revise the master plan and conceptual water management plan; and to add a master site plan for the R9 Tract. The subject property is located south of Thomasson Drive, south and west of U. S. 41, north and west of the Wentworth PUD, and east of the Naples Bay Intercoastal Waterway in Sections 23, 24, 25, 26 and 36, Township 50 South, Range 25 East, and Section 19, Township 50 South, Range 26 East, Collier County, Florida, consisting of 2,518.98+/- acres; and providing an effective date. [Coordinator: Ray Bellows, Zoning Manager] 3. ***Note: This item was continued from the November 5, 2020 CCPC meeting.*** PL20190002105 CU: A Resolution of the Board of Zoning Appeals of Collier County, Florida providing for the establishment of a conditional use to allow a horticultural waste facility for the collection, transfer, processing, and reduction of solid waste with the accessory use of incidental retail sale of processed horticultural material within an Agricultural (A) zoning district in the Rural Fringe Mixed Use District (RFMUD), Receiving Lands, pursuant to Section 2.03.08.A.2.a.3.c.iv of the Collier County Land Development Code for a ±16.43-acre property located on the northeast corner of the intersection of Tamiami Trail East (U.S. 41) and Riggs Road, approximately five miles east of Collier Boulevard (C.R. 951), in Section 20, Township 51 South, Range 27 East, Collier County, Florida. [Coordinator: Timothy Finn, AICP, Principal Planner] 4. **Note: This item was continued from the November 5, 2020 CCPC meeting.*** PL20190000808 CU - A Resolution of the Board of Zoning Appeals of Collier County, Florida amending Resolution No. 03-332, which established a conditional use for earthmining, to expand the conditional use for earthmining pursuant to Section 2.03.01.A.1.c.1 of the Collier County Land Development Code by adding 231.73± acres and revising the conditions of approval for the property located in the Agricultural (A) zoning district within the Mobile Home Overlay (M HO) and the Rural Lands Stewardship Area Overlay (RLSAO), for a total of 450.7± acres. The property is located on the west side of SR 29 North, south of SR 82 in the Immokalee Planning Area in Sections 18 And 19, Township 46 South Range 29 East, Collier County, Florida. [Coordinator: Timothy Finn, AICP, Principal Planner] November 2020 Collier County Planning Commission Page 4 Printed 11/12/2020 5. **Note: This item was continued from the November 5, 2020 CCPC meeting.*** PL20200000564 PUDA - An Ordinance of the Board of County Commissioners of Collier County, Florida amending Ordinance Number 05-46, the Bembridge Emergency Services Complex Community Facility Planned Unit Development (CFPUD) and Residential Planned Unit Development (RPUD), to redesignate 5.11± acres of land from Tract A to Tract A-1; to increase the residential density from 6 to 16 units/acre for a maximum of 82 residential units on Tract A-1, using the affordable housing density bonus and to amend the master plan; and providing an effective date. The subject property consists of 39.82± acres and is located east of Santa Barbara Boulevard, north of Davis Boulevard (SR 84) in Section 4, Township 50 South, Range 26 East, Collier County, Florida. [Coordinator: Timothy Finn, AICP, Principal Planner] 6. PL20190002680 - Safety Service Facility Golden Gate and DeSoto Blvd (CU) - A Resolution of the Board of Zoning Appeals of Collier County, Flo rida providing for the establishment of a conditional use to allow a government safety service facility for fire and emergency medical services within the Estates (E) Zoning Dist rict with a Wellfield Risk Management Special Treatment Overlay Zone W-4 (ST/W-4), pursuant to Sections 2.03.01.B.1.c.8 and 2.01.03.G.1.e of the Collier County Land Development Code for a 5.46+/- acre property located at the southwest corner of the intersection of Golden Gate Blvd. East and DeSoto Blvd. in Section 9, Township 49 South, Range 28 East, Collier County, Florida. [Coordinator: Ray Bellows, Zoning Manager] 7. ***Note: This Item will not be heard before 5:05 pm*** An Ordinance of the Board of County Commissioners of Collier County, Florida, Amending Ordinance Number 04-41, as amended, the Collier County Land Development Code, which includes the comprehensive land regulations for the unincorporated area of Collier County, Florida, to allow Communication Towers as a Conditional Use in the Estates (E) Zoning District, to clarify that Cluster Development for Affordable Housing does not require Conditional Use approval in the RMF-6 Zoning District and to create Alternative Design Standards for Housing that is Affordable, to modify setback requirements for Public Utility Ancillary Systems enclosures, and to Correct Citations and Update Text, by providing for: Section One, Recitals; Section Two, Findings Of Fact; Section Three, Adoption Of Amendments To The Land Development Code, more specifically amending the following: Chapter One-General Provisions, Including Section 1.08.02 Definitions; Chapter Two – Zoning Districts And Uses, Including Section 2.03.01 Agricultural Districts, Section 2.03.02 Residential Zoning Districts, Section 2.03.03 Commercial Zoning Districts, Section 2.03.05 Civic and Institutional Zoning Districts, Section 2.03.07 Overlay Zoning Districts, Section 2.03.08 Rural Fringe Zoning Districts; Chapter Four – Site Design And Development Standards, Including Section 4.02.04 Standards For Cluster Residential Design, Section 4.02.06 Standards For Development Within The Airport Overlay (APO), Adding New Section 4.02.39 Design Deviations For Housing That Is Affordable; Chapter Five – Supplemental Standards, Including Section 5.05.09 Communication Towers, Section 5.05.12 Specific Standards For Public Utility Ancillary Systems In Collier County; Chapter Ten – Application, Review, And Decision-Making Procedures, Including Section 10.02.03 Requirements For Site Development, Site Improvement Plans And Amendments Thereof, Section 10.02.05 Construction, Approval, And Acceptance, Section 10.02.13 Planned Unit Development (PUD) Procedures; and Appendix A Standard Performance Security Documents For Required Improvements; Section Four, Conflict And Severability; Section Five, Inclusion In The Collier County Land Development Code; And Section Six, Effective Date. (Coordinator: Jeremy Frantz, LDC Manager) November 2020 Collier County Planning Commission Page 5 Printed 11/12/2020 B. Noticed 10. New Business 11. Old Business 12. Public Comment 13. Adjourn 11/19/2020 COLLIER COUNTY Collier County Planning Commission Item Number: 9.A.1 Item Summary: ***Note: This item was continued from the October 15, 2020 CCPC meeting to the November 5, CCPC meeting and further continued to the November 19, 2020 CCPC meeting*** PL20180002233 GMPA A Resolution of the Board of County Commissioners proposing amendment to the Collier County Growth Management Plan, Ordinance 89-05, as amended, specifically amending the Future Land Use Element and Map Series to create the NC Square Mixed-Use Overlay on land in the Agricultural/Rural designation and Rural Fringe Mixed Use District-Receiving Lands Overlay to allow up to 44,400 square feet of commercial uses, a 12,000 square foot daycare limited to 250 students, and a maximum of 129 residential dwelling units and furthermore providing for transmittal of the amendment to the Florida Department of Economic Opportunity. The subject property is 24.4 acres and located at the northwest corner of Immokalee Road and Catawba Street approximately 1.6 miles west of Wilson Boulevard in Section 29, Township 49 South, Range 27 East, Collier County, Florida. [Coordinator: Corby Schmidt, Principal Planner] Meeting Date: 11/19/2020 Prepared by: Title: Planner, Principal – Zoning Name: Corby Schmidt 11/06/2020 2:22 PM Submitted by: Title: Manager - Planning – Zoning Name: Ray Bellows 11/06/2020 2:22 PM Approved By: Review: Planning Commission Corby Schmidt Review item Skipped 11/02/2020 9:59 AM Zoning Corby Schmidt Review Item Skipped 11/02/2020 9:59 AM Growth Management Operations & Regulatory Management Corby Schmidt Review Item Skipped 11/02/2020 9:59 AM Zoning Anita Jenkins Additional Reviewer Completed 11/09/2020 12:58 PM Growth Management Department Corby Schmidt Review Item Skipped 11/02/2020 9:59 AM Zoning Ray Bellows Review Item Completed 11/09/2020 3:07 PM Planning Commission Edwin Fryer Meeting Pending 11/19/2020 9:00 AM 9.A.1 Packet Pg. 6 Agenda Item 9. ‒ 1 ‒ PL20180002233 / CP-2019-1 NC Square Mixed Use Overlay in the Rural Fringe Mixed Use District - FLUE STAFF REPORT COLLIER COUNTY PLANNING COMMISSION FROM: GROWTH MANAGEMENT DEPARTMENT, ZONING DIVISION COMPREHENSIVE PLANNING SECTION HEARING DATE: Updated for November 19, 2020 SUBJECT: PETITION PL20180002233/CP-2019-1 GROWTH MANAGEMENT PLAN AMENDMENT, NC SQUARE MIXED-USE OVERLAY [TRANSMITTAL HEARING] ELEMENT: FUTURE LAND USE APPLICANT/AGENTS Applicant: Antonio Brown, Manager Owner: Immokalee Square, LLC Immokalee Square, LLC 2055 Trade Center Way 2055 Trade Center Way Naples, FL 34109 Naples, FL 34109 Agents: Jessica Harrelson, AICP Noel Davis, Esq. Davidson Engineering, Inc. Quarles & Brady, LLP 4365 Radio Road, Suite 201 1395 Panther Lane, Suite 300 Naples, FL 34104 Naples, FL 34109 GEOGRAPHIC LOCATION The subject property, consisting of ±24.4 acres, is located at the southwest corner of Immokalee Road and Catawba Street, ±3.4 miles east of Collier Boulevard (CR 951), ±1.6 miles west of Wilson Blvd., opposite Twin Eagles, in Section 29, Township 48 South, Range 27 East. REQUESTED ACTION This petition seeks to establish an Overlay designation in the Future Land Use Element (FLUE) by amending: 1) Policy 1.9, to add the new NC Square Mixed-Use Overlay; 2) Overlays and Special Features, to add the new Overlay provisions; 3) Future Land Use Map Series list, to add the title of the new Mixed-Use Overlay inset map; 4) Countywide Future Land Use Map to depict the Overlay; and, 5) Future Land Use Map Series to add an inset map depicting the Overlay site. 9.A.1.a Packet Pg. 7 Attachment: CP-19-1 NC Sq Overlay trnsmttl stff rprt_04Nov2020 FNL (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) Agenda Item 9. ‒ 2 ‒ PL20180002233 / CP-2019-1 NC Square Mixed Use Overlay in the Rural Fringe Mixed Use District - FLUE The Overlay text, Countywide Future Land Use Map, and FLU Map Series inset map proposed by this amendment are found in Resolution Exhibit “A”. PURPOSE AND DESCRIPTION OF PROJECT The petition proposes the new NC Square Mixed-Use Overlay in the Rural Fringe Mixed Use District (RFMUD) Receiving Lands that would allow a maximum of 129 residential units (gross density of 5.29 dwelling units per acre (DU/A); utilize a [nonstandard] Affordable Housing Density Bonus Agreement to achieve all density in excess of the base density of 1 DU/5A or 4 total DUs, to be adopted with the companion Planned Unit Development (PUD); and, introduce and allow a maximum of 44,400 sq. ft. of general commercial uses. This request also recognizes a daycare use with maximums of 250 children and 12,000 square feet (sq. ft.) of floor space. The use of Transfer of Development Rights credits (TDRs) are not incorporated into this proposal, and the Subdistrict is not eligible to add residential density with TDRs at the PUD stage. FUTURE LAND USE DESIGNATIONS, ZONING AND LAND USES: Existing Conditions: Subject Property: The subject property, which comprises ±24.4 acres, is designated Rural Fringe Mixed Use District (RFMUD) Receiving Lands, which generally provides for an increase in residential density up to a maximum of 1 DU/A with use of Transfer of Development Rights credits (TDRs) in an area with fewer natural resource constraints (than Sending Lands) and where existing and planned public facilities are concentrated. Provisions of the Receiving Lands Wildfire Mitigation requirements found in the FLUE also require that applicants for new developments proposed in Receiving Lands work with the Florida Forest Service and the Managers of any adjacent or nearby public lands, to develop a Wildfire Prevention and Mitigation Plan that will reduce the likelihood of threat to life and property from wildfires. This plan will address, at a minimum: project structural design; the use of materials and location of structures so as to reduce wildfire threat; firebreaks and buffers; water features; and, the impacts of prescribed burning on adjacent or nearby lands. This plan is required to be submitted and reviewed with the companion PUD rezone petition. Applicable elements will need to be incorporated into the PUD for regulatory effect. The subject property is zoned A-MHO-RFMUO, Rural Agriculture with Mobile Home Overlay and Rural Fringe Mixed Use Overlay Receiving Lands, and is undeveloped and wooded. The site is denoted with arrow and purple color on Future Land Use Map excerpt below. 9.A.1.a Packet Pg. 8 Attachment: CP-19-1 NC Sq Overlay trnsmttl stff rprt_04Nov2020 FNL (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) Agenda Item 9. ‒ 3 ‒ PL20180002233 / CP-2019-1 NC Square Mixed Use Overlay in the Rural Fringe Mixed Use District - FLUE Surrounding Lands: North: To the north, across Immokalee Road and the Cocohatchee Canal, lands are designated RFMUD Receiving Lands and the zoning is A-MHO-RFMUO Receiving Lands. These lands contain preserve area, golf course and single family dwellings (part of Twin Eagles), approved for approximately 1 DU/A via TDR credits. East: To the east, across Catawba Street, lands are designated RFMUD Receiving Lands and zoned A-MHO-RFMUO Receiving Lands. There is an undeveloped and wooded parcel abutting Immokalee Road and a portion of a plant nursery business south of that. South: To the south, lands are designated RFMUD Receiving Lands. They are zoned A-MHO- RFMUO Receiving Lands and contain a portion of the plant nursery business to the east. West: To the west, lands are designated RFMUD Receiving Lands and zoned A-MHO-RFMUO Receiving Lands. These lands contain a preserve area and the larger area to the west and southwest is undergoing infrastructure installation for the Brentwood Lakes development (f/k/a Twin Eagles South), approved for approximately 1 DU/A via TDR credits. In summary, the existing and planned land uses, and zoning, in the area surrounding the subject property are primarily single-family residences and agricultural uses. STAFF ANALYSIS Along this segment of Immokalee Road, a six-lane divided arterial, the RFMUD Receiving Lands comprise a 3-mile corridor. It begins one mile east of Collier Blvd. and extends east to Golden Gate Estates. Land uses along this corridor, running west to east, are generally identified below. North Side of Immokalee Road • 1st Mile: A portion of the 2,562-acre Heritage Bay PUD/DRI approved for 3,450 DUs (gross density of 1.35 DU/A), 66 acres/230,000 sq. ft. of commercial development, 200 ALF units, golf courses, 863+ acres of wetlands, and 677 acres of lakes (487 acres are former quarry). The entire PUD/DRI comprises four Sections (+4 square miles); three Sections are designated RFMUD Receiving Lands and one Section is Urban Residential Subdistrict and Mixed-Use Activity Center Subdistrict. The entire PUD/DRI is also within the Urban-Rural Fringe Transition Area Overlay, established in 2003 by a private sector GMP amendment, which allows the density from the Urban Section to be distributed throughout the Overlay. • 2nd Mile: Bonita Bay East Golf Course, which includes a significant amount of conservation lands, zoned A-RFMUO Receiving Lands. • 3rd Mile: Twin Eagles Golf & Country Club, a residential golf course development, a portion of which utilizes TDR credits; the gross density is <1 DU/A. The development is zoned A-RFMUO Receiving Lands. South Side of Immokalee Road • 1st Mile: Portion of La Morada residential and golf course development; utilizes TDR credits; gross density is < 1 DU/A. Church on 9.35-acre parcel. Two undeveloped, wooded parcels, +8 acres and 17.25 acres. Portion of La Morada. Plant nursery on +17.5 acres. An undeveloped, wooded parcel, +17.25 acres. Site of now-approved GMP amendment and PUD rezone (37 9.A.1.a Packet Pg. 9 Attachment: CP-19-1 NC Sq Overlay trnsmttl stff rprt_04Nov2020 FNL (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) Agenda Item 9. ‒ 4 ‒ PL20180002233 / CP-2019-1 NC Square Mixed Use Overlay in the Rural Fringe Mixed Use District - FLUE acres, Ventana Pointe, 2.05 DU/A). All of these properties are zoned A-RFMUO Receiving Lands. • 2nd Mile: County stormwater management pond on +7.7 acres. Four undeveloped, wooded parcels, +18.3 acres, 8.6 acres, +0.5 acres, +0.9 acres. Two parcels containing one single family dwelling and a horse training facility (7.25 acres total), and an undeveloped parcel (+18.4 acres), all three of which comprise a portion of a site for which a 2019 pre-application meeting was held for a church conditional use. A church on +9.1 acres. Three undeveloped, wooded parcels, 3.6 acres, +2.2 acres, +1.4 acres. A church on land zoned MPUD (+35 acres), approved for church, school, child care and ALF-assisted living facility. Two undeveloped, wooded, 0.5-acre parcels. A 22-acre public school site, frontage portion recently cleared. Three undeveloped parcels, each between +1.1 and +1.2 acres. Except for the one MPUD, all of these lands are zoned A-RFMUO Receiving Lands. • 3rd Mile: Brentwood Lakes (f/k/a Twin Eagles South) platted residential subdivision, cleared and infrastructure work underway; utilizes TDR credits. Subject site. (Not fronting Immokalee Road is a landscape maintenance business on +15.7 acres.) Nine parcels varying in size from +0.75 to 13 acres – four are undeveloped and wooded, three are in agricultural use, two contain a single-family dwelling unit each. County stormwater management pond on +5.1 acres. Two parcels are in agricultural use, 1.1 and +1.4 acres. All of these lands are zoned A-RFMUO Receiving Lands. • In summary, nearly all property on south side of Immokalee Road in this 3-mile corridor of RFMUD Receiving Lands is developed or approved with residential density <1 DU/A or agricultural uses or institutional uses allowed by the RFMUO Receiving Lands zoning overlay. It is acknowledged the site fronts on a six-lane divided road, and has central utilities available. Appropriateness of the Site and the Change: The subject site is located on a 6-lane divided arterial and public utilities are available to serve the project. The RFMUD supports mixed-use development, however to date, new development within the subject Receiving Area has been single family gated communities. The closest commercial zoning is approximately 2 ½ miles east of the site (Randall Blvd./Immokalee Rd. intersection). The RFMUD requires a Wildfire Prevention and Mitigation Plan. This important requirement should apply to the petition and be submitted as part of the companion PUDZ request. RFMUD Restudy White Paper The RFMUD White Paper presents data, analysis and a compilation of public comments. Recommendations include to consider allowing a density up to two DU/A on Receiving Lands outside of a Rural Village using TDRs; allow higher density for affordable housing projects outside of a Rural Village; and, eliminate the TDR requirement for affordable housing. Board direction for RFMUD GMP amendments includes for staff to take into account housing affordability, mobility, economic vitality and environmental protection. This petition addresses some of these considerations and specifically proposes affordable/workforce housing. 9.A.1.a Packet Pg. 10 Attachment: CP-19-1 NC Sq Overlay trnsmttl stff rprt_04Nov2020 FNL (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) Agenda Item 9. ‒ 5 ‒ PL20180002233 / CP-2019-1 NC Square Mixed Use Overlay in the Rural Fringe Mixed Use District - FLUE Criteria for GMP Amendments in Florida Statutes Data and analysis requirements for comprehensive plans and plan amendments are noted in Chapter 163, F.S., specifically as listed below. Section 163.3177(1)(f), Florida Statutes: (f) All mandatory and optional elements of the comprehensive plan and plan amendments shall be based upon relevant and appropriate data and an analysis by the local government that may include, but not be limited to, surveys, studies, community goals and vision, and other data available at the time of adoption of the comprehensive plan or plan amendment. To be based on data means to react to it in an appropriate way and to the extent necessary indicated by the data available on that particular subject at the time of adoption of the plan or plan amendment at issue. 1. Surveys, studies, and data utilized in the preparation of the comprehensive plan may not be deemed a part of the comprehensive plan unless adopted as a part of it. Copies of such studies, surveys, data, and supporting documents for proposed plans and plan amendments shall be made available for public inspection, and copies of such plans shall be made available to the public upon payment of reasonable charges for reproduction. Support data or summaries are not subject to the compliance review process, but the comprehensive plan must be clearly based on appropriate data. Support data or summaries may be used to aid in the determination of compliance and consistency. 2. Data must be taken from professionally accepted sources. The application of a methodology utilized in data collection or whether a particular methodology is professionally accepted may be evaluated. However, the evaluation may not include whether one accepted methodology is better than another. Original data collection by local governments is not required. However, local governments may use original data so long as methodologies are professionally accepted. 3. The comprehensive plan shall be based upon permanent and seasonal population estimates and projections, which shall either be those published by the Office of Economic and Demographic Research or generated by the local government based upon a professionally acceptable methodology. The plan must be based on at least the minimum amount of land required to accommodate the medium projections as published by the Office of Economic and Demographic Research for at least a 10-year planning period unless otherwise limited under s. 380.05, including related rules of the Administration Commission. Absent physical limitations on population growth, population projections for each municipality, and the unincorporated area within a county must, at a minimum, be reflective of each area’s proportional share of the total county population and the total county population growth. Section 163.3177(6)(a)2. Florida Statutes: 2. The future land use plan and plan amendments shall be based upon surveys, studies, and data regarding the area, as applicable, including: a. The amount of land required to accommodate anticipated growth. b. The projected permanent and seasonal population of the area. 9.A.1.a Packet Pg. 11 Attachment: CP-19-1 NC Sq Overlay trnsmttl stff rprt_04Nov2020 FNL (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) Agenda Item 9. ‒ 6 ‒ PL20180002233 / CP-2019-1 NC Square Mixed Use Overlay in the Rural Fringe Mixed Use District - FLUE c. The character of undeveloped land. d. The availability of water supplies, public facilities, and services. e. The need for redevelopment, including the renewal of blighted areas and the elimination of nonconforming uses which are inconsistent with the character of the community. f. The compatibility of uses on lands adjacent to or closely proximate to military installations. g. The compatibility of uses on lands adjacent to an airport as defined in s. 330.35 and consistent with s. 333.02. h. The discouragement of urban sprawl. i. The need for job creation, capital investment, and economic development that will strengthen and diversify the community’s economy. j. The need to modify land uses and development patterns within antiquated subdivisions. Section 163.3177(6)(a)8., Florida Statutes: (a) A future land use plan element designating proposed future general distribution, location, and extent of the uses of land for residential uses, commercial uses, industry, agriculture, recreation, conservation, education, public facilities, and other categories of the public and private uses of land. The approximate acreage and the general range of density or intensity of use shall be provided for the gross land area included in each existing land use category. The element shall establish the long-term end toward which land use programs and activities are ultimately directed. 8. Future land use map amendments shall be based upon the following analyses: a. An analysis of the availability of facilities and services. b. An analysis of the suitability of the plan amendment for its proposed use considering the character of the undeveloped land, soils, topography, natural resources, and historic resources on site. c. An analysis of the minimum amount of land needed to achieve the goals and requirements of this section. It is incumbent upon the petitioner to provide appropriate and relevant data and analysis to address the statutory requirements for a Plan amendment, then present and defend, as necessary, that data and analysis. Commercial Analysis Commercial Development: Characteristics of the area immediately surrounding the subject property do not reveal a trend toward commercial development. Existing and planned land uses in the area are primarily suburban- and estate-type residences or residential lots in all directions. Generally, commercial development can be categorized as neighborhood commercial, community commercial, regional commercial, or commercial other, based upon size, uses, and population/area served. Based on specific studies and/or demographic data for an area, such as population, income, 9.A.1.a Packet Pg. 12 Attachment: CP-19-1 NC Sq Overlay trnsmttl stff rprt_04Nov2020 FNL (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) Agenda Item 9. ‒ 7 ‒ PL20180002233 / CP-2019-1 NC Square Mixed Use Overlay in the Rural Fringe Mixed Use District - FLUE household size, percentage of income spent on retail goods, etc., an analyst is able to estimate supportable commercial square feet for different commercial intensities for that geography by shopping center type. Petitioner’s Retail Market Analysis: The firm of Maxwell Hendry Simmons, conducted a Market Study / Needs Analysis, updated to July 08, 2019 independently analyzing market conditions for this petition (Exhibit V.D). This analysis provides context for assessing a specific selection of goods and services’ requirements of the emerging population within the market area identified. The petitioner’s Analysis provided the following data and analysis: Demographics The Analysis’ Demographics section provided an overview of population growth and applied a multiplier to estimate and forecast populations on which to base the remainder of the Analysis. The Analysis identified a 3-mile radial area as its market area for this smaller-size community shopping center. This 3-mile radial area is delineated in this figure, copied from the petitioner’s Analysis. The figures are given, estimating an 12,207 population for the market area in 2020, and projecting 14,231 people in 2023. Market Area Demand Countywide population figures were then apportioned to the 3-mile market area to represent any additional commercial demand for this location. Market Area Supply The applicant’s Needs Analysis inventoried 730,057 sq. ft. of existing commercial development (on 146.65 ac.) of developed “competing commercial parcels” located in the market area. The Needs Analysis inventoried approximately 1,016,215 sq. ft. of undeveloped commercial) on 110.70 acres of undeveloped “competing parcels” located in the market area. The CIGM identifies a supply of 1,746,272 sq. ft. developed and undeveloped commercial space available in the market area. Supply – Demand Analysis 9.A.1.a Packet Pg. 13 Attachment: CP-19-1 NC Sq Overlay trnsmttl stff rprt_04Nov2020 FNL (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) Agenda Item 9. ‒ 8 ‒ PL20180002233 / CP-2019-1 NC Square Mixed Use Overlay in the Rural Fringe Mixed Use District - FLUE This section applied a diminishing allocation ratio, allowing the market to properly function in the sale, usage and allocation of land over time. This suggests the growing market area can support the additional commercial uses in this market by 2040. Staff Assessment of Petitioner’s Retail Market Analysis The analysis provided in the Needs Analysis is an objective population-based demand methodology and suspends our reliance on evaluating certain types of businesses to demonstrate need. Not all commercial uses allowed in the General Commercial zoning district – by right and by Conditional Use – were analyzed however, and not all uses analyzed were demonstrated to have supportable demand. The County’s CIGM identifies the appropriate commercial floor space in a neighborhood commercial center for an estimated 15,200 population – about the same as projected by the petitioner’s Analysis. Additionally, the intensities of the commercial uses themselves, where shown to be appropriately suited to neighborhood commercial centers, and approval of these by the companion Planned Unit Development rezone could be supported. The original commercial intensity proposed is too high; the demand is shared, or nearly duplicated, with two other requests. This reduction in commercial intensity was presented to the petitioner, and they took the opportunity to identify only the uses of neighborhood commercial intensity. The uses proposed by the petitioner to be appropriately suited to “neighborhood commercial” center are: apparel and accessory stores, auto and home supply stores (5K), food stores, hardware stores (5K), home furniture and furnishings stores (5K), household appliance stores (5K), musical instrument stores (5K), paint stores (5K), personal services, miscellaneous (5K), radio, television and consumer electronics stores (5K), veterinary services, excluding outside kenneling, and other uses of limited intensity. (“5K” denotes that each user is limited to 5,000 sq. ft. of the principle structure.) Traffic Capacity/Traffic Circulation Impact Analysis, Including Transportation Element Consistency Determination: A Traffic Impact Statement, updated to July 2020, prepared by Trebilcock Consulting Solutions, Inc., was submitted with this petition (Exhibit “V.E.3”). It notes that all traffic accessing the property comes from Immokalee Road (35% to/from the east; 65% to/from the west). Collier County Transportation Planning staff reviewed this petition and had no objection to its approval, finding it consistent with Transportation Element Policy 5.1. Environmental Impacts: An Environmental Data Report, updated to March 2019, prepared by Passarella & Associates, Inc., was submitted with this petition (Exhibit V.C.1). Environmental specialists with County Development Review Division, Environmental Planning Section, reviewed these documents and provided the following comments: The 24.4-acre subject property identified no listed species or their sign. A search of wildlife agencies databases found no occurrences for listed species. The site is located within the USFWS Panther Secondary Zone and Focus Area. It is located within the core foraging area of two wood stork colonies, but is not located in the vicinity of any active Red cockaded woodpecker (RCW) colonies or bald eagle nests. There is potential for Big Cypress fox squirrels to utilize the site. 9.A.1.a Packet Pg. 14 Attachment: CP-19-1 NC Sq Overlay trnsmttl stff rprt_04Nov2020 FNL (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) Agenda Item 9. ‒ 9 ‒ PL20180002233 / CP-2019-1 NC Square Mixed Use Overlay in the Rural Fringe Mixed Use District - FLUE The levels of protections granted to these animals, along with their habitat found on property, affects the potential for development. The habitats within the two on-site preserve areas will be enhanced through exotic removal and protected by placement under a recorded conservation easement. There is also potential for Black Bear to utilize the site. Commitments must be made part of the companion PUD to distribute the “A Guide to Living in Bear Country” to future commercial business owners and residential homeowners, as well as to construction/maintenance personnel, and utilize bear-proof dumpsters. The 6.10-acre native vegetation preservation areas on site will be retained in accordance with the requirements of Section 3.04.00 of the LDC. Public Facilities Impacts: A Public Facilities Report, updated to April 4, 2020 (Exhibit V.E.1), was submitted with this petition and concluded there is adequate capacity of public infrastructure to serve the proposed project – potable water, wastewater collection and treatment, solid waste collection and disposal, stormwater management, parks and recreational facilities, public schools, and emergency medical (EMS) and fire rescue services. Appropriate staff reviewed this petition and identified no issues or concerns regarding impacts upon public infrastructure. NEIGHBORHOOD INFORMATION MEETING (NIM) SYNOPSIS The application team held a Neighborhood Information Meeting (NIM) in the New Hope Ministries – Lecture Hall, 7675 Davis Blvd. Naples on August 6, 2020, at 5:30 p.m. as required by Section 10.03.05 F. of the LDC. This NIM was advertised, noticed and held jointly for this GMP amendment petition and companion PUD rezone petition [which is not under formal consideration with this GMPA transmittal hearing]; the companion PUD is expected to be heard at the GMPA adoption hearing. Two representatives from the application team were present, along with 2 County staff representatives by remote, Zoom connection. No one from the public attended, ether in-person or using the virtual connection offered. The NIM was ended at approximately 5:45 p.m. [Synopsis prepared by C. Schmidt, AICP, Principal Planner] FINDINGS AND CONCLUSIONS • The subject site and surrounding lands are designated Rural Fringe Mixed Use District (RFMUD) Receiving Lands; the Urban designated area is ±2.4 miles to the west. • The RFMUD promotes mixed-uses and housing affordability. • This petition proposes to allow 129 dwelling units (5.29 DU/A) with the net effect being an increase of 125 DUs and is subject to approval of an affordable workforce housing agreement, companion to the rezone petition. • This petition proposes 44,400 sq. ft. of neighborhood commercial uses. • The RFMUD White Paper recommends higher density for affordable housing projects outside of a Rural Village. 9.A.1.a Packet Pg. 15 Attachment: CP-19-1 NC Sq Overlay trnsmttl stff rprt_04Nov2020 FNL (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) Agenda Item 9. ‒ 10 ‒ PL20180002233 / CP-2019-1 NC Square Mixed Use Overlay in the Rural Fringe Mixed Use District - FLUE • This petition also recognizes a daycare use with maximums of 250 children and 12,000 square feet (sq. ft.) of floor space, which is allowed under the existing FLUM designation and zoning by conditional use. • Surrounding properties, and properties within the 3-mile Immokalee Road corridor in the Rural Fringe Mixed Use District Receiving Lands in which this site is located, are limited to a maximum density of 1 DU/5 Acres (0.2 DU/A) - or up to 1 DU/A via use of TDRs if >40 acres in size; agricultural uses; essential services; institutional uses by conditional use (e.g. day care center, ALF, church). • The subject site fronts Immokalee Road (CR 846), a 6-lane divided arterial road, and County water and wastewater service is available to the site. • There are no issues or concerns regarding levels of service impacts upon public infrastructure, • The applicant is required to work with the Florida Forest Service and the Managers of any adjacent or nearby public lands to develop a Wildfire Prevention and Mitigation Plan that will reduce the likelihood of threat to life and property from wildfires. Applicable elements of this plan must be incorporated into the companion PUD. • Commitments must be made part of the companion PUD to distribute the “A Guide to Living in Bear Country” to future commercial business owners and residential homeowners, as well as to construction/maintenance personnel, and utilize bear-proof dumpsters. • Community and Human Services staff are supportive of the affordable housing component of this petition, as it is generally consistent with Board direction to implement the Community Housing Plan. • This petition does not propose the use of TDRs for the density increase, and therefore does not further the RFMUD goal of protecting natural resources in Sending Lands. The RFMUD White Paper recommendations include the elimination of TDRs for affordable housing. LEGAL CONSIDERATIONS: This Staff Report was reviewed by the County Attorney’s Office on November 4, 2020. The criteria for GMP amendments to the Future Land Use Element and map series are in Sections 163.3177(1)(f) and 163.3177(6)(a)2. and 163.3177(6)(a)8., Florida Statutes. [HFAC] STAFF RECOMMENDATION TO THE COLLIER COUNTY PLANNING COMMISSION: Based on the analyses provided within this report, staff recommends that the County Planning Commission forward Petition CP-2019-1 /PL20180002233, to the Board of County Commissioners with a recommendation to approve as follows for transmittal to the Florida Department of Economic Opportunity and other statutorily required agencies. 9.A.1.a Packet Pg. 16 Attachment: CP-19-1 NC Sq Overlay trnsmttl stff rprt_04Nov2020 FNL (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) Agenda Item 9. ‒ 11 ‒ PL20180002233 / CP-2019-1 NC Square Mixed Use Overlay in the Rural Fringe Mixed Use District - FLUE Note: Words underlined are added, words struck through are deleted – as proposed by petitioner; words double underlined are added, words double struck through are deleted – as proposed by staff. Italicized text within brackets is explanatory only – not to be adopted. I. IMPLEMENTATION STRATEGY [Page 9] GOALS, OBJECTIVES AND POLICIES *** *** *** *** text break *** *** *** *** Policy 1.9: Overlays and Special Features shall include: A. Area of Critical State Concern Overlay B. North Belle Meade Overlay C. NC Square Mixed-Use Overlay C. D. Natural Resource Protection Area Overlays D. E. Rural Lands Stewardship Area Overlay E. F. Airport Noise Area Overlay F. G. Bayshore/Gateway Triangle Redevelopment Overlay G. H. Urban-Rural Fringe Transition Zone Overlay H. I. Coastal High Hazard Area Boundary I. J. Incorporated Areas *** *** *** *** text break *** *** *** *** V. OVERLAYS AND SPECIAL FEATURES [Page 97] A. Area of Critical State Concern *** *** *** *** text break *** *** *** *** B. North Belle Meade Overlay *** *** *** *** text break *** *** *** *** C. NC Square Mixed-Use Overlay This Overlay, comprising approximately 24.4 acres, is located at the southwest corner of Immokalee Road and Catawba Street, in Section 29, Township 48 South, Range 27 East. The purpose of this Overlay is to allow a maximum of 129 residential units, a daycare center and allow general neighborhood commercial uses to serve surrounding residential areas and passerby-traffic. This Overlay shall be subject to all Rural Fringe Mixed Use District Receiving Lands provisions, except as provided for herein. Development in this Overlay shall comply with the following requirements and limitations: 9.A.1.a Packet Pg. 17 Attachment: CP-19-1 NC Sq Overlay trnsmttl stff rprt_04Nov2020 FNL (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) Agenda Item 9. ‒ 12 ‒ PL20180002233 / CP-2019-1 NC Square Mixed Use Overlay in the Rural Fringe Mixed Use District - FLUE a. Rezoning shall be in the form of a PUD, Planned Unit Development. b. This Overlay shall be limited to a maximum gross leasable floor area of 44,400 square feet for commercial uses provided in the implementing PUD ordinance, and a maximum 12,000 square feet daycare center limited to 250 students. c. This Overlay shall be limited to a maximum of 129 residential units through an Affordable Housing Density Bonus Agreement between the Owner and Collier County. The implementing PUD shall include provisions to: 1. Establish a minimum number of dwelling units to be built. 2. Establish a minimum square foot of commercial uses to be built. 3. Address compatibility with surrounding properties. 4. Establish a common theme for architecture, signage and landscaping. 5. Provide pedestrian connectivity throughout the project. 6. Establish permitted and accessory uses, and development standards to those C-1, Commercial Professional and General Office District, through C-3, Commercial Intermediate District, uses appropriately suited to “neighborhood commercial” center, including Accounting (8721); Advertising agencies (7311); Amusement and recreation services, indoor (7999 martial arts, yoga and gymnastics instruction, gymnastic schools, and recreation involving physical fitness exercise only); Animal specialty services, except veterinary (0752, excluding outside kenneling); Apparel and accessory stores (5611—5699) with 5,000 square feet or less of gross floor area in the principal structure; Auditing (8721); Auto and home supply stores (5531) with 5,000 square feet or less of gross floor area in the principal structure; Banks, credit unions and trusts (6011—6099); Barber shops (7241, except for barber schools); Beauty shops (7231, except for beauty schools); Bookkeeping services (8721); Business associations (8611); Business consulting services (8748); Business credit institutions (6153—6159); Business services — miscellaneous (7389, except auctioneering service, automobile recovery, automobile repossession, batik work, bottle exchanges, bronzing, cloth cutting, contractors' disbursement, cosmetic kits, cotton inspection, cotton sampler, directories-telephone, drive-away automobile, exhibits-building, filling pressure containers, field warehousing, fire extinguisher, floats-decoration, folding and refolding, gas systems, bottle labeling, liquidation services, metal slitting and shearing, packaging and labeling, patrol of electric transmission or gas lines, pipeline or powerline inspection, press clipping service, recording studios, repossession service, rug binding, salvaging of damaged merchandise, scrap steel cutting and slitting, shrinking textiles, solvent recovery, sponging textiles, swimming pool cleaning, tape slitting, texture designers, textile folding, tobacco sheeting, window trimming, and yacht brokers); Child day care services (8351); Credit reporting services (7323); Direct mail advertising services (7331); Drug stores (5912); Eating places (5812 only) with 6,000 square feet or less in gross floor area in the principal structure. All establishments engaged in the retail sale of alcoholic beverages for on-premise consumption are subject to locational requirements of section 5.05.01; Essential services, subject to section 2.01.03; Food stores with greater than 5,000 square feet of gross floor area in the principal structure (groups 5411—5499); Health services (8071, 8092, and 8099); Garment pressing, and agents for laundries and drycleaners (7212); General merchandise stores (5331—5399) with 5,000 square feet or less of gross floor area in the principal 9.A.1.a Packet Pg. 18 Attachment: CP-19-1 NC Sq Overlay trnsmttl stff rprt_04Nov2020 FNL (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) Agenda Item 9. ‒ 13 ‒ PL20180002233 / CP-2019-1 NC Square Mixed Use Overlay in the Rural Fringe Mixed Use District - FLUE structure; Hardware stores (5251) with 1,800 square feet or less of gross floor area in the principal structure; Health services, offices and clinics (8011—8049); Home furniture and furnishings stores (5712—5719) with 5,000 square feet or less of gross floor area in the principal structure; Home health care services (8082); Household appliance stores (5722) with 5,000 square feet or less of gross floor area in the principal structure; Insurance carriers, agents and brokers (6311—6399, 6411); Laundries and drycleaning, coin operated ‒ self service (7215); Laundries, family and commercial (7211); Loan brokers (6163); Management services (8741 and 8742); Membership organizations, miscellaneous (8699); Mortgage bankers and loan correspondents (6162); Musical instrument stores (5736) with 5,000 square feet or less of gross floor area in the principal structure; Paint stores (5231) with 5,000 square feet or less of gross floor area in the principal structure; Personal credit institutions (6141); Personal services, miscellaneous (7299 - babysitting bureaus, clothing rental, costume rental, dating service, debt counseling, depilatory salons, diet workshops, dress suit rental, electrolysis, genealogical investigation service, and hair removal only) with 5,000 square feet or less of gross floor area in the principal structure; Personnel supply services (7361 and 7363); Photographic studios, portrait (7221); Physical fitness facilities (7991; 7911, except discotheques); Political organizations (8651); Public relations services (8743); Radio, television and consumer electronics stores (5731) with 5,000 square feet or less of gross floor area in the principal structure; Real Estate (6531—6552); Repair services - miscellaneous (7629—7631, 7699 - bicycle repair, binocular repair, camera repair, key duplicating, lawnmower repair, leather goods repair, locksmith shop, picture framing, and pocketbook repair only); Retail nurseries, lawn and garden supply stores (5261) with 5,000 square feet or less of gross floor area in the principal structure; Retail services - miscellaneous (5921—5963 except pawnshops and building materials, 5992-5999 except auction rooms, awning shops, gravestones, hot tubs, monuments, swimming pools, tombstones and whirlpool baths) with 5,000 square feet or less of gross floor area in the principal structure; Shoe repair shops and shoeshine parlors (7251); Social services, individual and family (8322 activity centers, elderly or handicapped only; day care centers, adult and handicapped only); Tax return preparation services (7291); Veterinary services (0742, excluding outdoor kenneling); Permitted use with less than 700 square feet gross floor area in the principal structure; and, Vocational schools (8243—8299). and, Any other intermediate commercial use which is comparable in nature with the foregoing list of permitted uses and consistent with the permitted uses and purpose and intent statement of the district, as determined by the board of zoning appeals. Any other commercial use or professional services which is comparable in nature with the foregoing uses including those that exclusively serve the administrative as opposed to the operational functions of a business and are associated purely with activities conducted in an office. Any other commercial or professional use which is comparable in nature with the (C-1) list of permitted uses and consistent with the purpose and intent statement of the district as determined by the board of zoning appeals pursuant to section 10.08.00. Any use which was permissible under the prior General Retail Commercial (GRC) zoning district, as identified by Zoning Ordinance adopted October 8, 1974, and which was lawfully existing prior to the adoption of this Code. 9.A.1.a Packet Pg. 19 Attachment: CP-19-1 NC Sq Overlay trnsmttl stff rprt_04Nov2020 FNL (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) Agenda Item 9. ‒ 14 ‒ PL20180002233 / CP-2019-1 NC Square Mixed Use Overlay in the Rural Fringe Mixed Use District - FLUE Any of the foregoing uses that are subject to a gross floor area limitation shall be permitted by right without the maximum floor area limitation if the use is developed as a component of a shopping center. An existing lawful structure over 5,000 sq. ft. as of July 14, 2014 may be occupied by any C- 3 permitted use with a 5,000 sq. ft. or greater limitation. [These were discussed at previous CCPC hearing. Comparable use language goes in the PUD, not the GMP, and some provisions will not be applicable.] Accessory Uses, including uses and structures that are accessory and incidental to the uses permitted as of right in the C-3 district; Caretaker's residence, subject to (LDC) section 5.03.05; Outside storage or display of merchandise when specifically permitted for a use, otherwise prohibited, subject to (LDC) section 4.02.12., and subject to gross floor area limitations without exceptions. The rezone Ordinance shall further refine the permitted uses to insure compatibility with surrounding properties. 7. Prohibit stand-alone drive-through restaurants. 8. Develop a Wildfire Prevention and Mitigation Plan that will reduce the likelihood of threat to life and property from wildfires and incorporate the applicable elements of this plan into the companion PUD. 9. Distribute the “A Guide to Living in Bear Country” to future commercial business owners and residential homeowners, as well as to construction/maintenance personnel, and utilize bear- proof dumpsters. *** *** *** *** text break *** *** *** *** FUTURE LAND USE MAP SERIES [Page 147] Future Land Use Map Activity Center Index Map Mixed Use & Interchange Activity Center Maps *** *** *** *** text break *** *** *** *** East Tamiami Trail Commercial Infill Subdistrict Map Seed to Table Commercial Subdistrict Map NC Square Mixed-Use Overlay Map 9.A.1.a Packet Pg. 20 Attachment: CP-19-1 NC Sq Overlay trnsmttl stff rprt_04Nov2020 FNL (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) Agenda Item 9. ‒ 15 ‒ PL20180002233 / CP-2019-1 NC Square Mixed Use Overlay in the Rural Fringe Mixed Use District - FLUE Staff provides the following reminder: This GMP amendment follows the Expedited State Review process. Chapter 163.3184 (3)(c)1, Florida Statutes, provides that the County Board (local governing body) shall hold its Adoption (second public) hearing within 180 days after receipt of agency comments, unless extended by agreement with notice to the DEO (state land planning agency) and any affected person that provided comments on the amendment. Petition Number: PL20180002233/CP-2019-1 Staff Report for the November 19, 2020 CCPC meeting NOTE: This petition has been tentatively scheduled for the January 12, 2021 BCC meeting. \\Bcc.colliergov.net\data\GMD-LDS\Development Review\CDES Planning Services\Comprehensive\Comp Planning GMP DATA\Comp Plan Amendments\2019 Cycles and Smalls\2019 Cycle 1 - Feb\CP-2019-1 ImmNCSquare\CP-19-1 NC Sq Overlay trnsmttl stff rprt_04Nov2020 FNL.docx 9.A.1.a Packet Pg. 21 Attachment: CP-19-1 NC Sq Overlay trnsmttl stff rprt_04Nov2020 FNL (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) 9.A.1.b Packet Pg. 22 Attachment: 19-1 NC Square Resolution - 091520 (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) 9.A.1.b Packet Pg. 23 Attachment: 19-1 NC Square Resolution - 091520 (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) 9.A.1.b Packet Pg. 24 Attachment: 19-1 NC Square Resolution - 091520 (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) 9.A.1.b Packet Pg. 25 Attachment: 19-1 NC Square Resolution - 091520 (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) 9.A.1.b Packet Pg. 26 Attachment: 19-1 NC Square Resolution - 091520 (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) 9.A.1.bPacket Pg. 27Attachment: 19-1 NC Square Resolution - 091520 (14090 : PL20180002233 - GMPA - NC Square Mixed-Use C. Commercial Intermediate District (C-3). The purpose and intent of the commercial intermediate district (C-3) is to provide for a wider variety of goods and services intended for areas expected to receive a higher degree of automobile traffic. The type and variety of goods and services are those that provide an opportunity for comparison shopping, have a trade area consisting of several neighborhoods, and are preferably located at the intersection of two-arterial level streets. Most activity centers meet this standard. This district is also intended to allow all of the uses permitted in the C-1 and C-2 zoning districts typically aggregated in planned shopping centers. This district is not intended to permit wholesaling type of uses, or land uses that have associated with them the need for outdoor storage of equipment and merchandise. A mixed-use project containing a residential component is permitted in this district subject to the criteria established herein. The C -3 district is permitted in accordance with the locational criteria for commercial and the goals, objectives, and policies as identified in the future land use element of the Collier County GMP. The maximum density permissible in the C-3 district and the urban mixed use land use designation shall be guided, in part, by the density rating system contained in the future land use element of the Collier County GMP. The maximum density permissible or permitted in the C-3 district shall not exceed the density permissible under the density rating system. 1. The following uses, as identified with a number from the Standard Industrial Classification Manual (1987), or as otherwise provided for within this section are permissible by right, or as accessory or conditional uses within the commercial intermediate district (C-3). a. Permitted uses. 1. Accounting (8721). 2. Adjustment and collection services (7322). 3. Advertising agencies (7311). 4. Amusement and recreation services, indoor (7999 martial arts, yoga and gymnastics instruction, gymnastic schools, and recreation involving physical fitness exercise only). 5. Animal specialty services, except veterinary (0752, excluding outside kenneling). 6. Apparel and accessory stores (5611—5699) with 5,000 square feet or less of gross floor area in the principal structure. 7. Architectural services (8712). 8. Auditing (8721). 9. Auto and home supply stores (5531) with 5,000 square feet or less of gross floor area in the principal structure. 10. Automobile Parking, automobile parking garages and parking structures (7521 — shall not be construed to permit the activity of "tow-in parking lots"). 11. Automotive services (7549) except that this shall not be construed to permit the activity of "wrecker service (towing) automobiles, road and towing service." 12. Banks, credit unions and trusts (6011 —6099). 13. Barber shops (7241, except for barber schools). 14. Beauty shops (7231, except for beauty schools). 15. Bookkeeping services (8721). 16. Business associations (8611). 17. Business consulting services (8748). 18. Business credit institutions (6153—6159). 9.A.1.c Packet Pg. 28 Attachment: PETITIONERS CP-19-1, NC Square Revised Use List (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) 19. Business services — miscellaneous (7389, except auctioneering service, automobile recovery, automobile repossession, batik work, bottle exchanges, bronzing, cloth cutting, contractors' disbursement, cosmetic kits, cotton inspection, cotton sampler, directories-telephone, drive-away automobile, exhibits-building, filling pressure containers, field warehousing, fire extinguisher, floats-decoration, folding and refolding, gas systems, bottle labeling, liquidation services, metal slitting and shearing, packaging and labeling, patrol of electric transmission or gas lines, pipeline or powerline inspection, press clipping service, recording studios, repossession service, rug binding, salvaging of damaged merchandise, scrap steel cutting and slitting, shrinking textiles, solvent recovery, sponging textiles, swimming pool cleaning, tape slitting, texture designers, textile folding, tobacco sheeting, window trimming, and yacht brokers). 20. Child day care services (8351). 21. Churches. 22. Civic, social and fraternal associations (8641). 23. Commercial art and graphic design (7336). 24. Commercial photography (7335). 25. Computer and computer software stores (5734) with 5,000 squar e feet or less of gross floor area in the principal structure. 26. Computer programming, data processing and other services (7371—7379). 27. Credit reporting services (7323). 28. Direct mail advertising services (7331). 29. Drycleaning plants (7216, nonindustrial drycleaning only). 30. Drug stores (5912). 31. Eating places (5812 only) with 6,000 square feet or less in gross floor area in the principal structure. All establishments engaged in the retail sale of alcoholic beverages for on-premise consumption are subject to locational requirements of section 5.05.01. 32. Educational plants and public schools subject to LDC section 5.05.14. 33. Engineering services (8711). 34. Essential services, subject to section 2.01.03. 35. Federal and federally-sponsored credit agencies (6111). 36. Food stores (groups 5411—5499) with 5,000 square feet or less of gross floor area in the principal structure. 37. Funeral services (7261, except crematories). 38. Garment pressing, and agents for laundries and drycleaners (7212). 39. Gasoline service stations (5541, subject to section 5.05.05). 40. General merchandise stores (5331—5399) with 5,000 square feet or less of gross floor area in the principal structure. 41. Glass stores (5231) with 5,000 square feet or less of gross floor area in the principal structure. 42. Group care facilities (category I and II, except for homeless shelters); care units, except for homeless shelters; nursing homes; assisted living facilities pursuant to 9.A.1.c Packet Pg. 29 Attachment: PETITIONERS CP-19-1, NC Square Revised Use List (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) F.S. § 400.402 and ch. 58A-5 F.A.C.; and continuing care retirement communities pursuant to F.S. § 651 and ch. 4-193 F.A.C.; all subject to section 5.05.04. 43. Hardware stores (5251) with 1,800 square feet or less of gross floor area in the principal structure. 44. Health services, offices and clinics (8011—8049). 45. Home furniture and furnishings stores (5712—5719) with 5,000 square feet or less of gross floor area in the principal structure. 46. Home health care services (8082). 47. Household appliance stores (5722) with 5,000 square feet or less of gross floor area in the principal structure. 48. Insurance carriers, agents and brokers (6311—6399, 6411). 49. Labor unions (8631). 50. Landscape architects, consulting and planning (0781). 51. Laundries and drycleaning, coin operated — self service (7215). 52. Laundries, family and commercial (7211). 53. Legal services (8111). 54. Libraries (8231). 55. Loan brokers (6163). 56. Management services (8741 and 8742). 57. Marinas (4493), subject to section 5.05.02. 58. Membership organizations, miscellaneous (8699). 59. Mortgage bankers and loan correspondents (6162). 60. Museums and art galleries (8412). 61. Musical instrument stores (5736) with 5,000 square feet or less of gross floor area in the principal structure. 62. Paint stores (5231) with 5,000 square feet or less of gross floor area in the principal structure. 63. Personal credit institutions (6141). 64. Personal services, miscellaneous (7299 - babysitting bureaus, clothing rental, costume rental, dating service, debt counseling, depilatory salons, diet workshops, dress suit rental, electrolysis, genealogical investigation service, and hair removal only) with 5,000 square feet or less of gross floor area in the principal structure. 65. Personnel supply services (7361 and 7363). 66. Photocopying and duplicating services (7334). 67. Photofinishing laboratories (7384). 68. Photographic studios, portrait (7221). 69. Physical fitness facilities (7991; 7911, except discotheques). 70. Political organizations (8651). 71. Professional membership organizations (8621). 9.A.1.c Packet Pg. 30 Attachment: PETITIONERS CP-19-1, NC Square Revised Use List (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) 72. Public administration (groups 9111—9199, 9229, 9311, 9411—9451, 9511—9532, 9611—9661). 73. Public relations services (8743). 74. Radio, television and consumer electronics stores (5731) with 5,000 square feet or less of gross floor area in the principal structure. 75. Radio, television and publishers advertising representatives (7313). 76. Real Estate (6531—6552). 77. Record and prerecorded tape stores (5735) with 5,000 square feet or less of gross floor area in the principal structure. 78. Religious organizations (8661). 79. Repair services - miscellaneous (7629—7631, 7699 - bicycle repair, binocular repair, camera repair, key duplicating, lawnmower repair, leather goods repair, locksmith shop, picture framing, and pocketbook repair only). 80. Retail nurseries, lawn and garden supply stores (5261) with 5,000 square feet or less of gross floor area in the principal structure. 81. Retail services - miscellaneous (5921—5963 except pawnshops and building materials, 5992-5999 except auction rooms, awning shops, gravestones, hot tubs, monuments, swimming pools, tombstones and whirlpool baths) with 5,000 square feet or less of gross floor area in the principal structure. 82. Secretarial and court reporting services (7338). 83. Security and commodity brokers, dealer, exchanges and services (6211—6289). 84. Shoe repair shops and shoeshine parlors (7251). 85. Social services, individual and family (8322 activity centers, elderly or handicapped only; day care centers, adult and handicapped only). 86. Surveying services (8713). 87. Tax return preparation services (7291). 88. Travel agencies (4724, no other transportation services). 89. United State Postal Service (4311, except major distribution center). 90. Veterinary services (0742, excluding outdoor kenneling). 91. Videotape rental (7841) with 5,000 square feet or less of gross floor area in the principal structure. 92. Wallpaper stores (5231) with 5,000 square feet or less of gross floor area in the principal structure. 93. Any use which was permissible under the prior General Retail Commercial (GRC) zoning district, as identified by Zoning Ordinance adopted October 8, 1974, and which was lawfully existing prior to the adoption of this Code. 94. Any of the foregoing uses that are subject to a gross floor area limitation shall be permitted by right without the maximum floor area limitation if the use is developed as a component of a shopping center. 95. Any other commercial use or professional services which is comparable in nature with the foregoing uses including those that exclusively serve the administrative as opposed to the operational functions of a business and are associated purely with activities conducted in an office. 9.A.1.c Packet Pg. 31 Attachment: PETITIONERS CP-19-1, NC Square Revised Use List (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) 96. Any other commercial or professional use which is comparable in nature with the (C - 1) list of permitted uses and consistent with the purpose and intent statement of the district as determined by the board of zoning appeals pursuant to section 10.08.00. 97. An existing lawful structure over 5,000 sq. ft. as of July 14, 2014 may be occupied by any C-3 permitted use with a 5,000 sq. ft. or greater limitation. b. Accessory Uses. 1. Uses and structures that are accessory and incidental to the uses permitted as of right in the C-3 district. 2. Caretaker's residence, subject to section 5.03.05. 3. Outside storage or display of merchandise when specifically permitted for a use, otherwise prohibited, subject to section 4.02.12. c. Conditional uses. The following uses are permissible as conditional uses in the commercial intermediate district (C-3), subject to the standards and procedures established in sections 4.02.02 and 10.08.00. 1. Amusements and recreation services, outdoor (7999 - boat rental, miniature golf course, bicycle and moped rental, rental of beach chairs and accessories only). 2. Ancillary plants. 3. Automotive vehicle dealers (5511, limited to automobile agencies (dealers)-retail and only new vehicles). In addition to the Planning Commission's Findings, its recommendation shall include, but not be limited to, the following considerations for the conditional use request: a. Controls on outdoor paging or amplified systems used as part of the daily operations. b. Location of enclosed service areas, with exception for entry/exit doors. c. The number of service bays. d. Operation hours. e. Adequacy of buffer(s). f. Location of gasoline storage and/or fueling tanks. g. Means of delivery of automobiles. 4. Bowling centers (7933). 5. Coin operated amusement devices (7993). 6. Courts (9211). 7. Drinking places (5813) excluding bottle clubs. All establishments engaged in the retail sale of alcoholic beverages for on-premise consumption are subject to the locational requirements of section 5.05.01. 8. Educational services (8221 and 8222). 9. Fire protection (9224). 10. Food stores with greater than 5,000 square feet of gross floor area in the principal structure (groups 5411—5499). 11. Health services (8071, 8092, and 8099). 12. Homeless shelters. 13. Hospitals (groups 8062—8069). 9.A.1.c Packet Pg. 32 Attachment: PETITIONERS CP-19-1, NC Square Revised Use List (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) 14. Legal counsel and prosecution (9222). 15. Medical equipment rental and leasing (7352). 16. Membership sports and recreational clubs indoor only (7997). 17. Mixed residential and commercial uses, subject to design criteria contained in section 4.02.38 except where superseded by the following criteria: i. A site development plan is approved pursuant to section 10.02.03 that is designed to protect the character of the residential uses and neighboring lands; ii. The commercial uses in the development may be limited in hours of operation, size of delivery trucks, and type of equipment; iii. The residential uses are designed so that they are compatible with the commercial uses; iv. Residential dwellings units are located above principal uses; v. Residential and commercial uses do not occupy the same floor of a building; vi. The number of residential dwellings units shall be controlled by the dimensional standards of the C-3 district, together with the specific requirement that in no instance shall the residential uses exceed 50 percent of the gross floor area of the building or the density permitted under the growth management plan; vii. Building height may not exceed two stories; viii. Each residential dwelling unit shall contain the following minimum floor areas: efficiency and one-bedroom, 450 square feet; two-bedroom, 650 square feet; three-bedroom, 900 square feet; ix. The residential dwellings units shall be restricted to occupancy by the owners or lessees of the commercial units below; x. A minimum of thirty (30) percent of the mixed use development shall be maintained as open space. The following may be used to satisfy the open space requirements; areas used to satisfy water management requirements; landscaped areas; recreation areas; or setback areas not covered with impervious surface or used for parking (parking lot islands may not be used unless existing native vegetation is maintained); xi. The mixed commercial/residential structure shall be designed to enhance compatibility of the commercial and residential uses through such measures as, but not limited to, minimizing noise associated with commercial uses; directing commercial lighting away from residential units; and separating pedestrian and vehicular accessways and parking areas from residential units, to the greatest extent possible. 18. Motion picture theaters, (7832 - except drive-in). 19. Permitted food service (5812, eating places) uses with more than 6,000 square feet of gross floor area in the principal structure. 20. Permitted personal services, video rental or retail uses (excluding drug stores - 5912) with more than 5,000 square feet of gross floor area in the principal structure. 21. Permitted use with less than 700 square feet gross floor area in the principal structure. 22. Public order and safety (9229). 23. Social services (8322 - other than those permitted, 8331-8399) 24. Soup kitchens. 9.A.1.c Packet Pg. 33 Attachment: PETITIONERS CP-19-1, NC Square Revised Use List (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) 25. Theatrical producers and miscellaneous theatrical services (7922 - community theaters only). 26. Vocational schools (8243—8299). 27. Any other intermediate commercial use which is comparable in nature with the foregoing list of permitted uses and consistent with the permitted uses and purpose and intent statement of the district, as determined by the board of zoning appeals 9.A.1.c Packet Pg. 34 Attachment: PETITIONERS CP-19-1, NC Square Revised Use List (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) NC Square Mixed Use Overlay GMPA (PL20180002233/CP-2019-1) NC Square Mixed Use MPUD (PL20180002234) AFFIDAVIT OF COMPLIANCE I hereby certify that pursuant to Ordinance 2004-41, of the Collier County Land Development Code, I did cause the attached newspaper advertisement to appear and I did give notice by mail to the following property owners and/or condominium and civic associations whose members may be affected by the proposed land use changes of an application request for a Planned Unit Development Rezone and Growth Management Plan Amendment, at least 15 days prior to the scheduled Neighborhood Information Meeting. For the purposes of this requirement, the names and addresses of property owners shall be deemed those appearing on the latest tax rolls of Collier County and any other persons or entities who have made a formal request of the county to be notified. The said notice contained the laymen’s description of the site property of proposed change and the date, time, and place of a Neighborhood Information Meeting. Per the attached letters, property owner’s list, and copy of newspaper advertisement which are hereby made a part of this Affidavit of Compliance _________________________________________________ Jessica Harrelson, AICP State of Florida County of Collier The foregoing Affidavit of compliance was acknowledged before me this _17th_ day of _July_______, 2020 by Jessica Harrelson, AICP, who is personally known to me. _____________________________________________ (Signature of Notary Public) (Notary Seal) Tocia Hamlin__________________________________ Printed Name of Notary 9.A.1.d Packet Pg. 35 Attachment: 2020-09-10 NC SQUARE- AFFIDAVIT OF COMPLIANCE (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) 9.A.1.e Packet Pg. 36 Attachment: 2020-09-10 NC SQUARE- AFFIDAVIT OF PUBLICATION (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) 9.A.1.e Packet Pg. 37 Attachment: 2020-09-10 NC SQUARE- AFFIDAVIT OF PUBLICATION (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) 2430 CATAWBA STREET LLC 2360 CATAWBA ST NAPLES, FL 34120---3821 BARBARA L WENDELL TRUST 5444 STOW RD HUDSON, OH 44236---4136 BELL RI HOLDINGS LLC 2271 ROCK RD NAPLES, FL 34120---0 CURCIO, JOHN A 8561 GLENLYON CT FT MYERS, FL 33912---0 DAHL, THEO & MADELIENE 11514 PEREGRINE CT NAPLES, FL 34120---4332 DORIA, REY & MARY PO BOX 8539 NAPLES, FL 34101---8539 GONZALEZ, SALVADOR & CANDIDA 761 91ST AVE N NAPLES, FL 34108---2424 GROSS, GLEN S & RHONDA L 11515 PEREGRINE CT NAPLES, FL 34120---4332 HADLEY, JOHN M & MARIE E 11507 PEREGRINE CT NAPLES, FL 34120---0 HILBERG, ROY DAVID 4570 BENFIELD RD NAPLES, FL 34114---1211 IMMOKALEE SQUARE LLC 2055 TRADE CENTER WAY NAPLES, FL 34109---0 IVANOV, FRANCES 11430 GOLDEN EAGLE CT NAPLES, FL 34120---4330 JONES, ALAN R & DIANE M 11503 PEREGRINE CT NAPLES, FL 34120---4332 MARK S BELL REVOCABLE TRUST 8757 HIDEAWAY HARBOR CT NAPLES, FL 34120---4327 NAPLES ASSOCIATES IV LLLP 1600 SAWGRASS CORPORATE PKWY # 400 SUNRISE, FL 33323---0 OZENDO, PIERRE L JOYCE Z PERE 11511 PEREGRINE COURT NAPLES, FL 34120---0 RODRIGUEZ, ROBERTO 63 MADISON DR NAPLES, FL 34110---1322 SD TWIN EAGLES LLC 2639 PROFESSIONAL CIRCLE #101 NAPLES, FL 34119---0 SHADOW CREEK INVESTMENTS LLC PO BOX 8262 NAPLES, FL 34101---8262 SHANAHAN JR, PATRICK J MARGARET F SHANAHAN 11426 GOLDEN EAGLE CT NAPLES, FL 34120---4330 SHARPE, ROGER A COLEEN R SHARPE 8051 FRIENDSHIP LN NAPLES, FL 34120---4854 SHAUGHNESSY JR, BERNARD J MELISSA J SHAUGHNESSY JAMES W JACKSON 11418 GOLDEN EAGLE CT NAPLES, FL 34120---0 SWIGERT, ESTHER E 11680 IMMOKALEE RD NAPLES, FL 34120---3867 TRACY, TIMOTHY P & SHAILEEN M 11422 GOLDEN EAGLE CT NAPLES, FL 34120---4330 TWINEAGLES HOMEOWNERS ASSOCIATION INC 11100 BONITA BEACH ROAD SUITE 101 BONITA SPRINGS, FL 34135---0 UIHLEIN TR, RICHARD A LAURALEE A UIHLEIN TR R A & L A UIHLEIN REV RES TR11414 GOLDEN EAGLE CT NAPLES, FL 34120---4330 GOLDEN GATE ESTATES AREA CIVIC ASSOCIATION INC. PO BOX 990596 NAPLES, FL 34116 9.A.1.f Packet Pg. 38 Attachment: 2020-09-10 NC SQUARE- MAILING LABELS (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) 1 NAME1 NAME2 NAME3 NAME4 NAME5 NAME6 FOLIO 2430 CATAWBA STREET LLC 2360 CATAWBA ST NAPLES, FL 34120---3821 00212240001 2430 CATAWBA STREET LLC 2360 CATAWBA ST NAPLES, FL 34120---3821 00211040008 2430 CATAWBA STREET LLC 2360 CATAWBA ST NAPLES, FL 34120---3821 00211000006 2430 CATAWBA STREET LLC 2360 CATAWBA ST NAPLES, FL 34120---3821 00213960005 BARBARA L WENDELL TRUST 5444 STOW RD HUDSON, OH 44236---4136 78542001227 BELL RI HOLDINGS LLC 2271 ROCK RD NAPLES, FL 34120---0 00211960007 CURCIO, JOHN A 8561 GLENLYON CT FT MYERS, FL 33912---0 78542000406 DAHL, THEO & MADELIENE 11514 PEREGRINE CT NAPLES, FL 34120---4332 78542000422 DORIA, REY & MARY PO BOX 8539 NAPLES, FL 34101---8539 00213240000 GONZALEZ, SALVADOR & CANDID 761 91ST AVE N NAPLES, FL 34108---2424 00211840004 GROSS, GLEN S & RHONDA L 11515 PEREGRINE CT NAPLES, FL 34120---4332 78542000325 HADLEY, JOHN M & MARIE E 11507 PEREGRINE CT NAPLES, FL 34120---0 78542000367 HILBERG, ROY DAVID 4570 BENFIELD RD NAPLES, FL 34114---1211 00211080000 IMMOKALEE SQUARE LLC 2055 TRADE CENTER WAY NAPLES, FL 34109---0 00214000003 IMMOKALEE SQUARE LLC 2055 TRADE CENTER WAY NAPLES, FL 34109---0 00214160008 IVANOV, FRANCES 11430 GOLDEN EAGLE CT NAPLES, FL 34120---4330 78542000040 JONES, ALAN R & DIANE M 11503 PEREGRINE CT NAPLES, FL 34120---4332 78542000383 MARK S BELL REVOCABLE TRUST 8757 HIDEAWAY HARBOR CT NAPLES, FL 34120---4327 00212160000 MARK S BELL REVOCABLE TRUST 8757 HIDEAWAY HARBOR CT NAPLES, FL 34120---4327 00212120008 NAPLES ASSOCIATES IV LLLP 1600 SAWGRASS CORPORATE PK # 400 SUNRISE, FL 33323---0 00210920006 OZENDO, PIERRE L JOYCE Z PERE 11511 PEREGRINE COURT NAPLES, FL 34120---0 78542000341 RODRIGUEZ, ROBERTO 63 MADISON DR NAPLES, FL 34110---1322 00213720009 SD TWIN EAGLES LLC 2639 PROFESSIONAL CIRCLE #101 NAPLES, FL 34119---0 78542000147 SHADOW CREEK INVESTMENTS L PO BOX 8262 NAPLES, FL 34101---8262 00212640009 SHANAHAN JR, PATRICK J MARGARET F SHANAHAN 11426 GOLDEN EAGLE CT NAPLES, FL 34120---4330 78542000066 SHARPE, ROGER A COLEEN R SHARPE 8051 FRIENDSHIP LN NAPLES, FL 34120---4854 00212560008 SHAUGHNESSY JR, BERNARD J MELISSA J SHAUGHNESSY JAMES W JACKSON 11418 GOLDEN EAGLE CT NAPLES, FL 34120---0 78542000105 SWIGERT, ESTHER E 11680 IMMOKALEE RD NAPLES, FL 34120---3867 00211240002 TRACY, TIMOTHY P & SHAILEEN M11422 GOLDEN EAGLE CT NAPLES, FL 34120---4330 78542000082 TWINEAGLES HOMEOWNERS ASSOCIATION INC 11100 BONITA BEACH ROAD SUITE 101 BONITA SPRINGS, FL 34135---0 78542001340 UIHLEIN TR, RICHARD A LAURALEE A UIHLEIN TR R A & L A UIHLEIN REV RES TR 11414 GOLDEN EAGLE CT NAPLES, FL 34120---4330 78542000121 GOLDEN GATE ESTATES AREA CIVIC ASSOCIATION INC.PO BOX 990596 NAPLES, FL 34116 Notice: This data belongs to the Collier County Property Appraiser's Office (CCPA). Therefore, the recipient agrees not to represent this data to anyone as other than CCPA provided data. The recipient may not transfer this data to others without consent from the CCPA. Petition:PL20180002234 & PL20180002233 | Buffer: 1000' | Date: 3/11/2020 | Site Location: Parcels 00214160008, 00214000003 2020-06-17 MAILING SPREADSHEET 9.A.1.g Packet Pg. 39 Attachment: 2020-09-10 NC SQUARE- MAILING SPREADSHEET (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) 4365 Radio Road • Suite 201 • Naples, FL 34104 • P: 239.434.6060 • www.davidsonengineering.com D esigningE xcellence Civil Engineering • Planning • Permitting July 17, 2020 Dear Property Owner, The public is invited to attend a Neighborhood Information Meeting, held by Davidson Engineering, Inc. on: Thursday, August 6th, 2020 at 5:30 p.m., in the Lecture Hall (Room 211) at New Hope Ministries located 7675 Davis Boulevard, Naples, FL 34104 The subject site is comprised of two separate parcels, collectively ±24.4-acres in size. The properties are located along Immokalee Road, at the southwest corner of Immokalee Road and Catawba Street, in Section 29, Township 48 South and Range 27 East, and are approximately ±1.6 miles west of the Wilson Boulevard/Immokalee Road intersection and ±3.4 miles east of the Collier Boulevard/ Immokalee Road intersection (see back for location map). Formal applications have been submitted to Collier County seeking approval for the following: NC Square Mixed-Use Planned Unit Development (PUDZ-PL20180002234): To rezone ±24.4-acres from Rural Agricultural-Mobile Home Overlay-Rural Fringe Mixed Use Overlay-Receiving Lands to the NC Square Mixed-Use Planned Unit Development to permit up to 44,400 square feet of commercial uses, a 12,000 square feet day care and 129 residential units. NC Square Mixed-Use Overlay (GMPA-PL20180002233): To establish the NC Square Mixed-Use Overlay to allow mixed-use development on the subject site, permitting up to 44,400 square feet of commercial uses, a 12,000 square feet day care and 129 residential units. Business and property owners, residents and visitors are welcome to attend the presentation to discuss the project. If you are unable to attend the meeting in-person and would like the opportunity to participate virtually, an on-line Zoom meeting will be available. Reservations for in-person meeting attendance is required to ensure that the CDC guidelines for social distancing can be achieved and details related to joining the meeting via Zoom can be obtained by contacting the individual listed below. If you are unable to attend the meeting in-person or participate virtually, and have questions or comments, they can also be directed by mail, phone or e-mail to the individual below: Jessica Harrelson, AICP Davidson Engineering, Inc. 4365 Radio Road, Suite 201 Naples, FL 34104 Phone: 239-434-6060 Email: jessica@davidsonengineering.com 9.A.1.h Packet Pg. 40 Attachment: 2020-09-10 NC SQUARE- NIM LETTER (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) 9.A.1.h Packet Pg. 41 Attachment: 2020-09-10 NC SQUARE- NIM LETTER (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) 4365 Radio Road · Suite 201 · Naples, FL 34104 · P: (239) 434.6060 Civil Engineering • Planning • Permitting D esigningE xcellence M E M O R A N D U M September 10, 2020 To: Nancy Gundlach, AICP, PLA, Principal Planner/Corby Schmidt, AICP, Principal Planner From: Jessica Harrelson, AICP Subject: NC Square Mixed Use Overlay GMPA (PL20180002233/CP-2019-1) NC Square Mixed Use MPUD (PL20180002234) Neighborhood Information Meeting The Neighborhood Information Meeting was advertised and notices were mailed to those who may be affected by the subject applications, as required. Virtual participation to the meeting was offered to the public as an alternative to in-person attendance. The meeting was held on August 6, 2020 and there were no attendees (virtual or in-person). Jessica Harrelson, AICP Senior Planner 9.A.1.i Packet Pg. 42 Attachment: 2020-09-10 NC SQUARE- NIM MEMO (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) ND-GCI0493591-01 NOTICE OF PUBLIC HEARING Notice is hereby given that the Collier County Planning Commission will hold a public meeting on October 15,2020 commencing at 9:00 A.M.in the Board of County Commissioners Chamber,Third Floor,County Government Center,3299 East Ta miami Tr ail, Naples,FL. The purpose of the hearing is to consider: A RESOLUTION OF THE BOARD OF COUNTY COMMISSIONERS PROPOSING AMENDMENT TO THE COLLIER COUNTY GROWTH MANAGEMENT PLAN, ORDINANCE 89-05,AS AMENDED,SPECIFICALLY AMENDING THE FUTURE LAND USE ELEMENT AND MAP SERIES TO CREATE THE NC SQUARE MIXED-USE OV ERLAY ON LAND IN THE AG RICULTURAL/RURAL DESIGNATION AND RURAL FRINGE MIXED USE DISTRICT-RECEIVING LANDS OVERLAY TO ALLOW UP TO 44,400 SQUARE FEET OF COMMERCIAL USES,A 12,000 SQUARE FOOT DAYC ARE LIMITED TO 250 STUDENTS,AND A MAXIMUM OF 129 RESIDENTIAL DWELLING UNITS AND FURTHERMORE DIRECTING TRANSMITTA L OF THE AMENDMENT TO THE FLORIDA DEPARTMENT OF ECONOMIC OPPORTUNITY.THE SUBJECT PROPERTY IS 24.4± ACRES AND LOCATED AT THE SOUTHWEST CORNER OF IMMOKALEE ROAD AND CATAWBA STREET APPROXIMATELY 1.6 MILES WEST OF WILSON BOULEVARD IN SECTION 29,TOWNSHIP 49 SOUTH,RANGE 27 EAST,COLLIER COUNTY,FLORIDA. [PL20180002233] All interested parties are invited to appear and be heard.Copies of the proposed RESOLUTION will be made available for inspection at the GMD Zoning Division, Comprehensive Planning Section,2800 N.Horseshoe Dr.,Naples,between the hours of 8:00 A.M.and 5:00 P.M.,Monday through Friday.Furthermore,the materials will be made available for inspection at the Collier County Clerk’s Offi ce,Fourth Floor,Collier County Government Center,3299 East Ta miami Trail,Suite 401 Naples,one week prior to the scheduled hearing.Any questions pertaining to the documents should be directed to the GMD Zoning Division,Comprehensive Planning Section.Wr itten comments fi led with the Clerk to the Board’s Offi ce prior to October 15,2020,will be read and considered at the public hearing. As part of an ongoing initiative to promote social distancing during the COVID-19 pandemic, the public will have the opportunity to provide public comments remotely,as well as in person,during this proceeding.Individuals who would like to participate remotely, should register any time after the agenda is posted on the County website which is 6 days before the meeting through the link provided on the front page of the County website at www.colliercountyfl.gov.Individuals who register will receive an email in advance of the public hearing detailing how they can participate remotely in this meeting.For additional information about the meeting,please call Thomas Clarke at (239)252-2526 or email to CCPCRemoteParticipation@CollierCountyFL.gov. Any person who decides to appeal any decision of the Collier County Board of County Commissioners will need a record of the proceedings pertaining thereto and therefore,may need to ensure that a verbatim record of the proceedings is made,which record includes the testimony and evidence upon which the appeal is based. If you are a person with a disability who needs any accommodation in order to participate in this proceeding,you are entitled,at no cost to you,to the provision of certain assistance. Please contact the Collier County Facilities Management Division,located at 3335 Ta miami Tr ail East,Suite 101,Naples,FL 34112-5356,(239)252-8380,at least two days prior to the meeting.Assisted listening devices for the hearing impaired are available in the Board of County Commissioners Offi ce. Collier County Planning Commission Edwin Fryer,Chairman Im mo kale eRD WilsonBLVDN!I Project Location 9.A.1.j Packet Pg. 43 Attachment: NC Square NDN ad Publication from paper (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) NC Square Mixed Use Overlay GMPA-PL20180002233/ CP-2019-1 SIGN POSTING INSTRUCTIONS (CHAPTER 8, COLLIER COUNTY ADMINISTRATIVE CODE FOR LAND DEVELOPMENT) A zoning sign(s) must be posted by the petitioner or the petitioner’s agent on the parcel for a minimum of fifteen (15) calendar days in advance of the first public hearing and said sign(s) must be maintained by the petitioner or the petitioner’s agent through the Board of County Commissioners Hearing. Below are general guidelines for signs, however these guidelines should not be construed to supersede any requirement of the LDC. For specific sign requirements, please refer to the Administrative Code, Chapter 8 E. 1.The sign(s) must be erected in full view of the public, not more than five (5) feet from the nearest street right-of-way or easement. 2.The sign(s) must be securely affixed by nails, staples, or other means to a wood frame or to a wood panel and then fastened securely to a post, or other structure. The sign may not be affixed to a tree or other foliage. 3.The petitioner or the petitioner’s agent must maintain the sign(s) in place, and readable condition until the requested action has been heard and a final decision rendered. If the sign(s) is destroyed, lost, or rendered unreadable, the petitioner or the petitioner’s agent must replace the sign(s) - - - - - - - - - - - - - - - - - - - - - - - - --- - - - - -- AFFIDAVIT OF POSTING NOTICE STATE OF FLORIDA COUNTY OF COLLIER BEFORE THE UNDERSIGNED AUTHORITY, PERSONALLY APPEARED JESSICA HARRELSON, AICP WHO ON OATH SAYS THAT HE/SHE HAS POSTED PROPER NOTICE AS REQUIRED BY SECTION 10.03.00 OF THE COLLIER COUNTY LAND DEVELOPMENT CODE ON THE PARCEL COVERED IN PETITION NUMBER GMPA- PL20180002233/ CP-2019-1. 4365 Radio Road, Suite 201 SIGNATURE OF APPLICANT OR AGENT STREET OR P.O. BOX Jessica Harrelson, AICP, Senior Planner, Davidson Engineering, Inc. Naples, FL 34104 NAME (TYPED OR PRINTED) CITY, STATE ZIP STATE OF FLORIDA COUNTY OF COLLIER The foregoing instrument was sworn to and subscribed before me this 21st day of September , 2020, by Jessica Harrelson, AICP, who is personally known to me and who did take an oath. Signature of Notary Public Tocia Hamlin Rosa Printed Name of Notary Public My Commission Expires: (Stamp with serial number) NOTE: AFTER THE SIGN HAS BEEN POSTED, THIS AFFIDAVIT OF POSTING NOTICE SHOULD BE RETURNED NO LATER THAN TEN (10) WORKING DAYS BEFORE THE FIRST HEARING DATE TO THE ASSIGNED PLANNER. 9.A.1.k Packet Pg. 44 Attachment: 22. POSTING AFFIDAVIT (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) 9.A.1.l Packet Pg. 45 Attachment: 23. SIGN PHOTOS (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) 9.A.1.l Packet Pg. 46 Attachment: 23. SIGN PHOTOS (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) COLLIER COUNTY GOVERNMENT GROWTH MANAGEMENT DEPARTMENT www.colliercountyfl.gov rCounty ........-, - 2800 NORTH HORSESHOE DRIVE NAPLES, FLORIDA 34104 (239)252-2400 FAX: (239) 252-6358 Hybrid Virtual Quasi-Judicial Public Hearing Waiver Emergency/Executive Order 2020-04 Hearing of the Collier County Planning Commission and Board of County Commissioners F P t·t· N b ( ) GMPA-PL20180002233/CP-2019-1 (NC Square Mixed Use Overlay) or e 1 10n um er s : __________________________ _ . . lmmokalee Square, LLC Regarding the above subJect petition number(s), _____________ (Name of Applicant) elects to proceed during the declared emergency with hybrid virtual public hearings of the Collier County Planning Commission and Board of County Commissioners, and waives the right to contest any procedural irregularity due to the hybrid virtual nature of the public hearing. N Antonio Brown, Manager ame: _____________ _ Signature*: •• ��--- IZJ Applicant D Legal Counsel to Applicant Date: _ __,9;'-#-/_3_o_7,,_/_e-_·..,_u_-_Z_<.J __ _ * This form must be signed by either the Applicant (if the applicant is a corporate entity, this must be an officer of the corporate entity) or the legal counsel to the Applicant. , Immokalee Square, LLC 9.A.1.m Packet Pg. 47 Attachment: CP-19-1 0-01 SIGNED HYBRID WAIVER (14090 : PL20180002233 - GMPA - NC Square Mixed-Use Overlay) 11/19/2020 COLLIER COUNTY Collier County Planning Commission Item Number: 9.A.2 Item Summary: ***Note: This item was continued from the October 15, 2020 CCPC meeting to the November 5, CCPC meeting and further continued to the November 19, 2020 CCPC meeting*** PL20190002305 - MPUD (PUDR) Sabal Bay- Fleischmann Parcel An Ordinance of the Board of County Commissioners of Collier County, Florida amending Ordinance No. 05-59, as amended, the Sabal Bay Mixed Use Planned Unit Development, and amending Ordinance No. 2004-41, the Collier County Land Development Code, by amending the appropriate zoning atlas map or maps by changing the zoning classification of an additional 102.49± acres of land zoned Rural Agricultural (A), Rural Agricultural with a Special Treatment overlay (A-ST), Residential Single Family-Three (RSF-3) and Residential Single Family-Three with a Special Treatment overlay (RSF-3-ST) to the Sabal Bay Mixed Use Planned Unit Development (MPUD); by amending the PUD document and master plan to add 102.49± acres designated as Tract R9 for residential development; to add 230 dwelling units for a total of 2,229 dwelling units in the MPUD; to revise the master plan and conceptual water management plan; and to add a master site plan for the R9 Tract. The subject property is located south of Thomasson Drive, south and west of U. S. 41, north and west of the Wentworth PUD, and east of the Naples Bay Intercoastal Waterway in Sections 23, 24, 25, 26 and 36, Township 50 South, Range 25 East, and Section 19, Township 50 South, Range 26 East, Collier County, Florida, consisting of 2,518.98+/- acres; and providing an effective date. [Coordinator: Ray Bellows, Zoning Manager] Meeting Date: 11/19/2020 Prepared by: Title: Operations Analyst – Planning Commission Name: Diane Lynch 11/06/2020 2:21 PM Submitted by: Title: Manager - Planning – Zoning Name: Ray Bellows 11/06/2020 2:21 PM Approved By: Review: Planning Commission Diane Lynch Review item Skipped 11/06/2020 2:21 PM Zoning Diane Lynch Review Item Skipped 11/06/2020 2:21 PM Growth Management Operations & Regulatory Management Diane Lynch Review Item Skipped 11/06/2020 2:21 PM Growth Management Department Diane Lynch Review Item Skipped 11/06/2020 2:21 PM Zoning Diane Lynch Review Item Skipped 11/06/2020 2:21 PM Planning Commission Edwin Fryer Meeting Pending 11/19/2020 9:00 AM 9.A.2 Packet Pg. 48 PUDR-PL20190002305; Sabal Bay MPUD Rezone (PUDR) – Fleischmann Parcel October 27, 2020 Page 1 of 16 STAFF REPORT TO: COLLIER COUNTY PLANNING COMMISSION FROM: ZONING DIVISION – ZONING SERVICES SECTION GROWTH MANAGEMENT DEPARTMENT HEARING DATE: NOVEMBER 5, 2020 (continued from October 15, 2020) SUBJECT: PUDR-PL20190002305; SABAL BAY MIXED USE PLANNED UNIT DEVELOPMENT REZONE (PUDR) – FLEISCHMANN PARCEL OWNER/APPLICANT/AGENTS: Owner: Agents: Bayshore Parcel, LLC Jennifer Sapen, Barraco & Assoc., Inc. 255 13th Ave S, Suite 202 2271 McGregor Blvd., Suite 100 Naples, FL 34102 Applicant/Contract Purchaser: Fort Myers, FL 33901 Rich Yovanovich, Esq. Minto Sabal Bay, LLC/Minto Communities, LLC 4001 Tamiami Trail North, Suite 300 4400 W. Sample Rd., Suite 200 Naples, FL 34103 Coconut Creek, FL 33073 REQUESTED ACTION: The petitioner requests that the Collier County Planning Commission (CCPC) consider an application to rezone 102.49+ acres from the Rural Agricultural (A), Rural Agricultural with Special Treatment Overlay (A-ST), Residential Single Family (RSF-3), and Residential Single Family with Special Treatment Overlay (RSF-3-ST) Districts to the Sabal Bay Mixed Use Planned Unit Development (MPUD) District; and to amend the PUD Document and Master Plan to add Tract R9 for residential development; and to add 230 dwelling units for a total of 2,229 dwelling units; increasing total size of the MPUD to 2,518.98+ acres. GEOGRAPHIC LOCATION: The property subject to rezoning is 102.49+ acres located on the east side of Bayshore Drive, south of Woodside Avenue, and abutting the western edge of the Avalon Canal, which is within the Sabal Bay MPUD. The northern 40+ acres of the property is within the Bayshore Gateway Triangle Community Redevelopment Area (CRA) and the Bayshore Beautification Municipal Service Taxing Unit (MSTU). The Sabal Bay MPUD is located south of Thomasson Drive, south and west of U.S. 41, north and west of the Wentworth Estates PUD, and east of the Naples Bay Intercoastal Waterway in Sections 23, 24, 25, 26 and 36, Township 50 South, Range 25 East, and Section 19, Township 50 South, Range 26 East, Collier County, Florida (see location map on page 2). 9.A.2.a Packet Pg. 49 Attachment: 10-26-20 - Staff Report (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) PUDR-PL20190002305; Sabal Bay MPUD Rezone (PUDR) – Fleischmann Parcel October 27, 2020 Page 2 of 16 9.A.2.aPacket Pg. 50Attachment: 10-26-20 - Staff Report (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann PUDR-PL20190002305; Sabal Bay MPUD Rezone (PUDR) – Fleischmann Parcel October 27, 2020 Page 3 of 16 PURPOSE/DESCRIPTION OF PROJECT: This petition seeks to rezone 102.49+ acres to be designated as Tract R9 of the Sabal Bay MPUD to accommodate development of up to 230 additional residential dwelling units and a proposed preserve area of 29.97 acres. The Sabal Bay MPUD was originally established by Ordinance No. 05-59, approved on November 15, 2005. An amendment was approved by Ordinance No. 12-12 on March 13, 2012 which adjusted allowable non-residential uses and tracts. Currently, the MPUD allows for 1,999 residential dwelling units, 250 hotel rooms, 200,000 square feet of retail and 60,000 square feet of office. As approved, the residential density is 0.85 dwelling units per acre on 2,350 acres within the MPUD that are designated for residential use. The proposed rezoning will result in a residential density of 0.91 dwelling units per acre on 2,453 acres within the MPUD that are designated for residential use. SURROUNDING LAND USE AND ZONING: This section of the staff report identifies the land uses and zoning classifications for properties surrounding boundaries of the property subject to the rezoning request: North: Immediately north is Tract R5 of the Sabal Bay MPUD, where an east-west road connects from the Isles of Collier Preserve community on the east to Bayshore Road and Residential Tract R7 of the Sabal Bay MPUD to the west. This roadway is proposed to provide access to proposed Tract R9. Beyond Tract R5 to the north are residential homesites within the Bayshore Gateway Triangle CRA, zoned Residential Multifamily with Bayshore Mixed Use District – Residential Overlay (RMF-6-BMUD-R1). East: Immediately east is Avalon Canal, which is within the Sabal Bay MPUD. Beyond the canal are Antigua Way and Tracts R2-B, R2-A, and R4 of the Sabal Bay MPUD. These tracts are being developed as single family homesites in the Isles of Collier Preserve community. South: South of the subject site is a 10.3+ acre privately owned parcel that is undeveloped and zoned Agriculture (A) and Agriculture-Special Treatment Overlay (A-ST) and the 780+ Preserve area of the Sabal Bay MPUD designated for Rookery Bay National Estuarine Research Reserve. West: Immediately west is the 50 foot wide Bayshore Drive right-of-way; Bayshore Drive is adjacent to the northern 330+ feet of the subject site and then terminates. The right-of-way (currently unconstructed) continues along the entire westerly boundary of the subject site. Beyond the right-of-way is Holly Avenue developed with residential homesites and zoned Village Residential (VR), and approximately 30 undeveloped acres zoned Residential Single Family (RSF-3), all of which lie within the Bayshore Gateway Triangle CRA. Also to the west, roughly 40 acres are zoned Agricultural (A) and undeveloped. 9.A.2.a Packet Pg. 51 Attachment: 10-26-20 - Staff Report (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) PUDR-PL20190002305; Sabal Bay MPUD Rezone (PUDR) – Fleischmann Parcel October 27, 2020 Page 4 of 16 Aerial Image (submitted by petitioner) GROWTH MANAGEMENT PLAN (GMP) CONSISTENCY: Future Land Use Element (FLUE): The subject property is designated Urban Mixed Use District, Urban Coastal Fringe Subdistrict, as identified on the Future Land Use Map (FLUM) within the Growth Management Plan (GMP). This site is also located in the Coastal High Hazard Area (CHHA). CHHA provisions, for the most part, apply to residential development and affects the FLUE Density Rating System, as follows: The base residential density allowed by the Urban Mixed Use District is 4 dwelling units per acre (DU/A). Due to the property’s location in the CHHA, the maximum attainable density is reduced by 1 DU/A, for a maximum density of 3 DU/A. Therefore, the allowable number of units on proposed Tract R9 would be 102.49+ x 3 DU/A = maximum of 307 units. A total of 230 dwelling units are proposed for Tract R9, which equals a net density of 2.24 DU/A. As a result of the rezoning, the gross residential density for the PUD equates to 0.91 DU/A on Bayshore Dr 9.A.2.a Packet Pg. 52 Attachment: 10-26-20 - Staff Report (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) PUDR-PL20190002305; Sabal Bay MPUD Rezone (PUDR) – Fleischmann Parcel October 27, 2020 Page 5 of 16 2,453 acres designated for residential use. Both the net density and gross density are within the maximum density of 3 DU/A applicable within the CHHA. (see Attachment B – FLUE Consistency Review) Transportation Element: In evaluating this project, staff reviewed the applicant’s March 18, 2020 Traffic Impact Statement for consistency with Policy 5.1 of the Transportation Element of the Growth Management Plan (GMP) using the applicable 2019 Annual Update and Inventory Reports (AUIR). Policy 5.1 of the Transportation Element of the GMP states; “The County Commission shall review all rezone petitions, SRA designation applications, conditional use petitions, and proposed amendments to the Future Land Use Element (FLUE) affecting the overall countywide density or intensity of permissible development, with consideration of their impact on the overall County transportation system, and shall not approve any petition or application that would directly access a deficient roadway segment as identified in the current AUIR or if it impacts an adjacent roadway segment that is deficient as identified in the current AUIR, or which significantly impacts a roadway segment or adjacent roadway segment that is currently operating and/or is projected to operate below an adopted Level of Service Standard within the five year AUIR planning period, unless specific mitigating stipulations are also approved. A petition or application has significant impacts if the traffic impact statement reveals that any of the following occur: a. For links (roadway segments) directly accessed by the project where project traffic is equal to or exceeds 2% of the adopted LOS standard service volume; b. For links adjacent to links directly accessed by the project where project traffic is equal to or exceeds 2% of the adopted LOS standard service volume; and c. For all other links the project traffic is considered to be significant up to the point where it is equal to or exceeds 3% of the adopted LOS standard service volume. Mitigating stipulations shall be based upon a mitigation plan prepared by the applicant and submitted as part of the traffic impact statement that addresses the project’s significant impacts on all roadways.” Staff finding: According to the PUD provided with this proposed rezoning, the petitioner is requesting to add an additional 230 residential units for a proposed total of 2,229 residential units for this PUD. The TIS provided with this petition outlined a potential development scenario for Tract R9 that included a total of 90 single family residential units and 140 multi-family residential units for a total of 230 residential units. The proposed development will generate a projected total of +/- 172 PM peak hour, 2-way trips on the adjacent roadway segments of Tamiami Trail East (US 41), Bayshore Drive and Thomasson Drive. Staff reviewed the proposed TIS scenario and determined that it presented an accurate trip generation, a reasonable distribution and a reasonable development potential. The developer commitment trip cap in PUD Exhibit F, S ection 8.8.E. for Tract R9 represents a trip cap count of +/- 172 PM peak hour, 2-way trips. The applicant has since committed to prohibiting multifamily homes within Tract R9. Staff finds development of single family and two family (villa style) homes to be acceptable because the trip cap established in the PUD for Tract R9 will apply. Based on the current 2019 AUIR and the information provided, the 9.A.2.a Packet Pg. 53 Attachment: 10-26-20 - Staff Report (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) PUDR-PL20190002305; Sabal Bay MPUD Rezone (PUDR) – Fleischmann Parcel October 27, 2020 Page 6 of 16 subject roadway links have sufficient capacity to accommodate the project within the 5-year planning period. The trips generated by the Tract R9 development will occur on the following adjacent roadway links: Link/Roadway Link 2019 AUIR LOS Current Peak Hour Peak Direction Service Volume/Peak Direction 2019 Remaining Capacity 92.0/Tamiami Trail East (US 41) Airport Pulling Road to Rattlesnake Hammock Road D *expected background traffic deficient 2027 2,900/East 343 108.0/Thomasson Drive Bayshore Drive to Tamiami Trail East (US41) Bayshore Drive to Tamiami Trail East (US41 D 800/East 150 7.0/Bayshore Drive Thomasson Drive to Tamiami Trail East (US 41) B 1,800/South 1,011 *This road segment is located within the South US 41 TCEA (Transportation Concurrency Exception Area) and is exempt from transportation concurrency requirements. The TIS indicates that a total of +/- 13 trips will be exiting east on US 41 at PM peak hour peak direction; therefore, there remains adequate capacity on this segment. Based on the TIS and the 2019 AUIR, the subject PUD Rezone can be found consistent with Policy 5.1 of the Transportation Element of the Growth Management Plan, as the Traffic Impact Statement (TIS) indicates that the adjacent roadway network has sufficient capacity to accommodate this project within the 5-year planning period. Conservation and Coastal Management Element (CCME): Environmental review staff has found this project to be consistent with the Conservation & Coastal Management Element (CCME). The project site consists of 101.57 acres of native vegetation. A minimum of 25.39 acres (25%) preserve is required; however, the request includes 29.97 acres of preserve to be placed under preservation and dedicated to Collier County. GMP Conclusion: The GMP is the prevailing document to support land use decisions, such as this proposed rezoning. Staff is required to make a recommendation regarding a finding of consistency or inconsistency with the overall GMP as part of the recommendation for approval, approval with conditions, or denial of any rezoning petition. This petition is consistent with the GMP. 9.A.2.a Packet Pg. 54 Attachment: 10-26-20 - Staff Report (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) PUDR-PL20190002305; Sabal Bay MPUD Rezone (PUDR) – Fleischmann Parcel October 27, 2020 Page 7 of 16 STAFF ANALYSIS: Applications to rezone to or to amend RPUDs shall be in the form of a RPUD Master Plan of development, along with a list of permitted and accessory uses and a development standards table. The RPUD application shall also include a list of developer commitments and any proposed deviations from the LDC. Staff has completed a comprehensive evaluation of this land use petition, including the criteria upon which a recommendation must be based, specifically noted in LDC Section 10.02.13.B.5, Planning Commission Recommendation (commonly referred to as the “PUD Findings”), and Section 10.02.08.F, Nature of Requirements of Planning Commission Report (referred to as “Rezone Findings”), which establish the legal basis to support the CCPC’s recommendation. The CCPC uses the aforementioned criteria as the basis for its recommendation to the Board, who in turn use the criteria to support their action on the rezoning or amendment request. An evaluation relative to these subsections is discussed below, under the heading “Zoning Services Analysis.” In addition, staff offers the following analyses: Drainage: Stormwater Review staff has reviewed this request and finds that best management practices, treatment, and storage will be addressed through the environmental resource permitting process with the South Florida Water Management District. County staff will also evaluate the project’s stormwater management system, calculations, and design criteria at the time of site development plan (SDP) and/or platting (PPL). Environmental Review: Environmental Planning staff has reviewed the petition to address environmental concerns. The PUD preserve requirement is 25.39 acres (25% of 101.57 acres). The PUD Master Plan provides a total of 29.97 acres of preserve, which meets the minimum 25 percent native preservation requirement in accordance with LDC 3.05.07. The environmental data indicates the proposed project is in an area that has the potential to contain a variety of protected animal species. The listed species survey revealed sixty-eight gopher tortoise (Gopherus polyphemus) burrows were observed onsite. The burrows are in the central portion of the subject property (Figure 7 of the Environmental Data). A gopher tortoise relocation permit will need to be obtained from the Florida Fish & Wildlife Conservation Commission (FWC) prior to approval of the first SDP and/or PPL. The proposed project is located within the US Fish and Wildlife Service (FWS) consultation area for Bonneted Bat (Eumops floridanus). Bonneted bat acoustic survey was conducted on the subject property; however, no evidence was found indicating the trees were being utilized for nesting. The listed species survey for the subject property did not identify the presence of an eagle nest (Haliaeetus leucocephalus) on the property. Historically, the property located directly west of the subject property contained an active eagle nest (CO-009A); however, this nest was last confirmed to be active in 2006. Should the petition be approved, continued review for an active eagle nest will be required. Additionally, the existing development commitments for Sabal Bay have established guidelines for the protection of bald eagles and their nest in accordance with LDC section 3.04.02 D. 9.A.2.a Packet Pg. 55 Attachment: 10-26-20 - Staff Report (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) PUDR-PL20190002305; Sabal Bay MPUD Rezone (PUDR) – Fleischmann Parcel October 27, 2020 Page 8 of 16 Butterfly Orchid (Encyclia tampensis), Twisted airplant (Tillandsia flexuosa), and Stiff-leafed wild-pine (Tillandsia fasciculata), listed as less rare plants, have been observed on the property and will be protected in accordance with LDC 3.04.03. This project does not require Environmental Advisory Council (EAC) review, as thi s project did not meet the EAC scope of land development project reviews as identified in Section 2 -1193 of the Collier County Codes of Laws and Ordinances. Transportation Review: Transportation Planning staff has reviewed the petition for compliance with the GMP and the LDC and recommends approval with the following conditions of approval. Transportation Planning staff has the following conditions of approval for this petition: Stipulation for Approval 1: “Upon request of County, the developer of Tract R9, or its successors and assigns, shall pay its fair share payment and coordinate with Collier County on traffic calming improvements under the Neighborhood Traffic Management Program (NTMP) including but not limited to striping, signage and speed tables on Bayshore Drive from the project access to Thomasson Drive. This commitment will expire the earlier of: 2 years after buildout of Tract R9 or turnover to the HOA.” Stipulation for Approval 2: “The developer of Tract R9 and its successors and assigns consent to Collier County including the entirety of the Tract R9 property in the Bayshore Beautification Municipal Service Taxing Unit (MSTU). This commitment is specific to Tract R9 and will expire 2 years after buildout of Tract R9.” Utilities Review: The project lies predominantly within the regional potable water service area and the south wastewater service area of the Collier County Water-Sewer District (CCWSD). The PUD expansion area lies within the City of Naples’ water service area, but based upon preliminary discussion with the City, staff anticipates amending the CCWSD’s interlocal agreement with the City to allow the CCWSD to provide water service to the entire PUD. Water and wastewater services are readily available to the PUD expansion area via connections to existing infrastructure within the Bayshore Drive right-of-way and constructed along Antigua Way, in Phase 12 to the east. Sufficient water and wastewater treatment capacities are available. Adequate downstream wastewater system capacity must be confirmed at the time of development permit (SDP or PPL) review through a thorough engineering analysis, which will be discussed at a mandatory pre-submittal conference with representatives from the Public Utilities Engineering and Project Management Division and the Growth Management Development Review Division. Any improvements to the Collier County Water-Sewer District’s wastewater collection/ transmission system necessary to provide sufficient capacity to serve the project will be the responsibility of the owner/developer and will be conveyed to the Collier County Water -Sewer District at no cost to the County at the time of utilities acceptance. Landscape Review: The buffers labeled on the updated master plan are consistent with the LDC. Historic Preservation Review: Staff received phone calls from members of the public with 9.A.2.a Packet Pg. 56 Attachment: 10-26-20 - Staff Report (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) PUDR-PL20190002305; Sabal Bay MPUD Rezone (PUDR) – Fleischmann Parcel October 27, 2020 Page 9 of 16 inquiries and concerns about potential for historic or archeological artifacts associated with the site, however the subject 102.49+ acre property does not lie within an area of interest designated by Collier County’s “Map of Areas of Historical/Archaeological Probability.” In order to protect historical or archeological resources should they be discovered during construction, Land Development Code standards will apply to ensure protection. Specifically, Land Development Code Section 2.03.07.E.2.ii outlines that activity shall immediately stop and protective procedures must be followed if, during the course of site clearing, excavation or other construction activity, an historic or archaeological artifact, or other indicator is found. School District: School District staff has reviewed the proposed addition of residential units and finds at this time there is existing or planned capacity within the next 5 years for the purposed development at the elementary, middle, and high school levels. At the time of site plan or plat, the development will be reviewed for concurrency to ensure there is capacity either within the concurrency service area the development is located within, or adjacent concurrency service areas. Zoning Services Review: Zoning Division staff has evaluated the proposed uses and density for a determination of compatibility. Also, we reviewed the proposed development standards for the project. As noted within the GMP consistency portion of this staff report, the Sabal Bay PUD is within the Coastal High Hazard Area, which is designated as a low residential density category to minimize the loss of property due to increased flood risk. The maximum density prescribed by the Density Rating System in the GMP for this area is 3 units per acre. The proposed additional 102.49+ acres with 230 additional dwelling units yields a net density of 2.2 units per acre, and the overall density of the residential portion of the MPUD increases from 0.85 to 0.91 dwelling units per acre, both within the allowable density for the area. In proximity to the subject site are established residential neighborhoods along Bayshore Drive and the developing residential community of Isles of Collier Preserve. The context of this area’s development pattern is generally single family. The petitioner has limited the proposed unit types as stated in PUD Section 3.4.A.4, “Multi-family is prohibited in the R9 Tract.” This will be consistent with the development pattern in the vicinity, and the proposed density is compatible with the existing surrounding development. The proposed preserve area, open space and buffering will assist in establishing consistency and compatibility with the surrounding land use pattern. PUD FINDINGS: LDC Section 10.02.13.B.5 states that, “In support of its recommendation, the CCPC shall make findings as to the PUD Master Plan’s compliance with the following criteria in addition to the findings in LDC Section 10.02.08”: 1. The suitability of the area for the type and pattern of development proposed in relation to physical characteristics of the land, surrounding areas, traffic and access, drainage, sewer, water, and other utilities. The additional proposed dwelling units and proposed property development regulations are compatible with the low-density development approved in the area. The Public Utilities 9.A.2.a Packet Pg. 57 Attachment: 10-26-20 - Staff Report (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) PUDR-PL20190002305; Sabal Bay MPUD Rezone (PUDR) – Fleischmann Parcel October 27, 2020 Page 10 of 16 Division states that the PUD already receives potable water and wastewater services from the CCWSD, and there are adequate water and wastewater treatment capacities available to future development as proposed by this petition. The Transportation Planning staff has indicated there is available capacity within the roads anticipated to be impacted by the additional trips generated by the proposed addition to the Sabal Bay PUD. Drainage system design will be evaluated in connection with Water Management District permitting and development order (SDP or Plat) and construction permits. 2. Adequacy of evidence of unified control and suitability of any proposed agreements, contracts, or other instruments, or for amendments in those proposed, particularly as they may relate to arrangements or provisions to be made for the continuing operation and maintenance of such areas and facilities that are not to be provided or maintained at public expense. Documents submitted with the application, which were reviewed by the County Attorney’s Office, demonstrate unified control of the subject property, Tract R9. 3. Conformity of the proposed Planned Unit Development with the goals, objectives, and policies of the Growth Management Plan (GMP). County staff has reviewed this petition, analyzed conformity with the relevant goals, objectives, and policies of the GMP within the GMP Consistency portion of this staff report (and within Attachment B - FLUE Consistency Memo), and finds this petition is consistent with the GMP. 4. The internal and external compatibility of proposed uses, which conditions may include restrictions on location of improvements, restrictions on design, and buffering and screening requirements. As described in the Staff Analysis section of this staff report subsection Landscape Review, staff is of the opinion that the proposed project will be compatible with the surrounding area. The Master Plan proposes the appropriate perimeter landscape buffers. 5. The adequacy of usable open space areas in existence and as proposed to serve the development. The MPUD is required to provide at least 30% of the gross area for usable open space. No deviation from the open space requirement is being requested, and compliance would be demonstrated at the time of SDP or platting. 6. The timing or sequence of development for the purpose of ensuring the adequacy of available improvements and facilities, both public and private. The Public Utilities Division states that no public utility facility adequacy issues are anticipated at this time. Pursuant to Sec. 134-57(a) of the Collier County Code of Ordinances, availability of potable water and wastewater services must be verified in writing by the CCWSD prior to submittal of construction documents. 9.A.2.a Packet Pg. 58 Attachment: 10-26-20 - Staff Report (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) PUDR-PL20190002305; Sabal Bay MPUD Rezone (PUDR) – Fleischmann Parcel October 27, 2020 Page 11 of 16 The roadway infrastructure is sufficient to serve the proposed project, as noted in the Transportation Element consistency review. Operational impacts will be addressed at time of first development order (SDP or Plat), at which time a new TIS will be required to demonstrate turning movements for all site access points. Finally, the development must comply with all other applicable concurrency management regulations when development approvals, including but not limited to any plats and or site development plans, are sought. 7. The ability of the subject property and of surrounding areas to accommodate expansion. The area has adequate supporting infrastructure, including readily available County water and wastewater mains, to accommodate this project. The roadway infrastructure has adequate capacity to serve the proposed project at this time, as evaluated as part of the GMP Transportation Element consistency review above. Operational impacts will be addressed at time of first development order (SDP or Plat). Additionally, the development must comply with all other applicable concurrency management regulations when development approvals are sought. 8. Conformity with PUD regulations, or as to desirable modifications of such regulations in the particular case, based on determination that such modifications are justified as meeting public purposes to a degree at least equivalent to literal application of such regulations. There are no deviations proposed in this rezone request. Changes are proposed to the list of developer commitments, and those commitments are in conformity with the provisions of County regulations and the LDC. Rezone Findings: LDC Subsection 10.02.08.F states, “When pertaining to the rezoning of land, the report and recommendations to the planning commission to the Board of County Commissioners…shall show that the planning commission has studied and considered proposed change in relation to the following when applicable”: 1. Whether the proposed change will be consistent with the goals, objectives, and policies of the Future Land Use Map and the elements of the Growth Management Plan. Comprehensive Planning, Environmental and Transportation staff have reviewed the petition and analyzed it for consistency with the goals, objectives, and policies of the GMP. They have found the request to be consistent with the GMP. 2. The existing land use pattern. The existing land use pattern in vicinity of the subject site is described in the Surrounding Land Use and Zoning section of this report. The proposed 230 additional residential dwelling units are restricted to single family or two-family villa style development and thus will not change the existing land use patterns in the area. The proposed 102.49+ acre addition to the Sabal Bay MPUD is bordered by the existing Residential Tracts of the Sabal 9.A.2.a Packet Pg. 59 Attachment: 10-26-20 - Staff Report (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) PUDR-PL20190002305; Sabal Bay MPUD Rezone (PUDR) – Fleischmann Parcel October 27, 2020 Page 12 of 16 Bay MPUD to the north and east, existing preserve to the south, and single and multifamily residentially zoned and developed homesites further north and to the northwest. 3. The possible creation of an isolated district unrelated to adjacent and nearby districts. As described, the abutting land to the proposed addition is entitled for residential use or designated for preserve, which aligns with the proposed residential use and preservation area designated on the subject site. 4. Whether existing district boundaries are illogically drawn in relation to existing conditions on the property proposed for change. Existing zoning district boundaries are logically drawn consistent with the parcels subject to this rezone request (Tract R9). The existing Community Redevelopment Area and Bayshore Beautification MSTU boundary is not logically drawn, given that the site is split with the northern 40+ acres lying in the CRA and MSTU boundary, and the southern 62+ acres outside the CRA and MSTU boundary. The site is designed and proposed for development as a unified site, thus it would be appropriate to incorporate the entire Tract within the MSTU boundary considering that a consequence of rezoning will be that all units developed within the Tract will have the same point of access, and therefore will equally utilize Bayshore Drive. 5. Whether changed or changing conditions make the passage of the proposed rezoning necessary. The proposed rezone is not necessary, but it is being requested in compliance with the LDC provisions to seek such changes. The current zoning classifications are not suited to accommodate the proposed development plan, therefore the PUD rezoning is being sought. 6. Whether the proposed change will adversely influence living conditions in the neighborhood. Staff is of the opinion that the proposed PUD Rezone is consistent with the County’s land use policies that are reflected by the FLUE of the GMP. Development in compliance with the proposed PUD rezone should not adversely impact living conditions in the area. The surrounding neighborhoods are characterized by residential homesites and preserve areas, and the proposal is for the addition of single family or two-family villa style homes as well as a preserve area. 7. Whether the proposed change will create or excessively increase traffic congestion or create types of traffic deemed incompatible with surrounding land uses, because of peak volumes or projected types of vehicular traffic, including activity during construction phases of the development, or otherwise affect public safety. The roadway infrastructure has adequate capacity to serve the proposed project at this time; GMP consistency at the time of rezoning is evaluated as part of the GMP Transportation Element consistency review. Operational impacts will be addressed at time of first development order (SDP or Plat). Additionally, the project’s development must comply with all other applicable concurrency management regulations when development 9.A.2.a Packet Pg. 60 Attachment: 10-26-20 - Staff Report (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) PUDR-PL20190002305; Sabal Bay MPUD Rezone (PUDR) – Fleischmann Parcel October 27, 2020 Page 13 of 16 approvals are sought. 8. Whether the proposed change will create a drainage problem. The proposed RPUD request is not anticipated to create drainage problems in the area; provided an environmental resource permit that addresses stormwater best management practices, stormwater pollution prevention, urban stormwater management, on-site stormwater treatment, and attenuation storage is obtained from the South Florida Water Management District. County staff will evaluate the project’s stormwater management system, calculations, and design criteria at time of development order (SDP or Plat) and construction permits. 9. Whether the proposed change will seriously reduce light and air to adjacent areas. The proposed addition of residential units at a net density of 2.2 dwelling units per acre, with required setbacks and buffers, is not anticipated to reduce light or air to adjacent areas. 10. Whether the proposed change will adversely affect property values in the adjacent areas. This is a subjective determination based upon anticipated results, which may be internal or external to the subject property. Property valuation is affected by a host of factors including zoning; however, zoning by itself may or may not affect values, since value determination is driven by market value. 11. Whether the proposed change will be a deterrent to the improvement or development of adjacent property in accordance with existing regulations. Much of the developable adjacent property is already developed for residential use. The approval of the rezone is not likely to deter development activity of surrounding property. 12. Whether the proposed change will constitute a grant of special privilege to an individual owner as contrasting with the public welfare. Because the proposed development complies with the GMP, then that constitutes a public policy statement supporting zoning actions when they are consistent with said Comprehensive Plan. In light of this fact, the proposed change does not constitute a grant of special privilege. Consistency with the FLUE is further determined to be a public welfare relationship because actions consistent with plans are in the public interest. 13. Whether there are substantial reasons why the property cannot be used in accordance with existing zoning. While roughly 30 acres of the site has a designation of RSF-3 allowing single family home development, the overall 102.49 acre site is also designated RSF-3/ST, A, and A/ST, and the overall site could not be developed as a unified project as proposed. 9.A.2.a Packet Pg. 61 Attachment: 10-26-20 - Staff Report (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) PUDR-PL20190002305; Sabal Bay MPUD Rezone (PUDR) – Fleischmann Parcel October 27, 2020 Page 14 of 16 14. Whether the change suggested is out of scale with the needs of the neighborhood or the County. It is staff’s opinion the proposed uses and associated development standards and developer commitments will ensure that the project is not out of scale with the needs of the community. 15. Whether is it impossible to find other adequate sites in the County for the proposed use in districts already permitting such use. The petition was reviewed for compliance with the GMP and the LDC, and staff does not specifically review other sites in conjunction with a specific petition. 16. The physical characteristics of the property and the degree of site alteration, which would be required to make the property usable for any of the range of potential uses under the proposed zoning classification. Any development anticipated by the PUD Document would require considerable site alteration, and this project will undergo extensive evaluation relative to all federal, state, and local development regulations during the development order (SDP or Plat) and construction permits, and again later as part of the building permit process. 17. The impact of development on the availability of adequate public facilities and services consistent with the levels of service adopted in the Collier County Growth Management Plan and as defined and implemented through the Collier County Adequate Public Facilities Ordinance, as amended. The project will have to meet all applicable criteria set forth in LDC S ection 6.02.00 regarding Adequate Public Facilities (APF), and the project will need to be consistent with all applicable goals and objectives of the GMP regarding adequate public facilities, except as may be exempt by federal regulations. This petition has been reviewed by County staff responsible for jurisdictional elements of the GMP as part of the review process and it has been concluded that Level of Service will not be adversely impacted given the commitments made in the PUD Document. The concurrency review for APF is determined at the time of development order (SDP or Plat) and construction permits. 18. Such other factors, standards, or criteria that the Board of County Commissioners shall deem important in the protection of the public health, safety, and welfare. To be determined by the Board during its advertised public hearing. NEIGHBORHOOD INFORMATION MEETING (NIM): The NIM was held on July 16, 2020 at the Isles of Collier Preserve Clubhouse Multi-Purpose Room. The summary of the NIM and PowerPoint slides are included in the application back up 9.A.2.a Packet Pg. 62 Attachment: 10-26-20 - Staff Report (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) PUDR-PL20190002305; Sabal Bay MPUD Rezone (PUDR) – Fleischmann Parcel October 27, 2020 Page 15 of 16 material found in Attachment C. The sign-in logs indicate thirty-five attendees were present, and 109 attendees were remote via Zoom. The meeting was 2-1/2 hours long. The petitioner reviewed a series of questions received in advance of the meeting with prepared answers, as well as live questions and answers. Concerns were concentrated on the following issues: • Amenities: Isles of Collier Preserve residents voiced concern that existing common area amenities and recreation facilities within the community will be inadequate with the addition of more community members, and they pressed for some type of mitigation or compensation related to internal amenities. • Traffic: Isles of Collier Preserve residents questioned the impacts of construction traffic and impacts of increased vehicular traffic on their internal community streets. Impacts on the traffic volumes and character of Bayshore Drive, Thomasson Drive, and U.S. 41 were also a concern. • Environment: Some attendees voiced concern over environmental sensitivity of the property and the proposed development’s impact to habitats for protected species. • Drainage: A property owner to the south questioned how the development’s drainage will impact his property. The petitioner’s engineer subsequently met with the property owner and the Water Management District to address these questions. The following commitments were made by the applicant: 1. Unit types will be limited to single family and two family (villa style) units. PUD Section 3.4.A.4 addresses this commitment with the statement, “Multi-family is prohibited in the R9 Tract.” 2. The petitioner committed to evaluate capacity and function of existing and proposed amenities within Isles of Collier Preserve. 3. The petitioner committed to working with the County on road impacts of heavy trucks/construction vehicles. PUD Section 8.8.F addresses this commitment with the condition that “The developer shall obtain a right of way permit prior to commencing construction of Tract R9.” 4. Along with using internal accessways where feasible, the petitioner will consider a construction access management plan to regulate impacts to Bayshore Drive. 5. The petitioner’s project engineer committed to meet with the neighboring 10-acre property owner (Folio #61838040006) and the Water Management District. This commitment was fulfilled. 6. The petitioner will continue informational meetings with the Community Redevelopment Agency Advisory Board until the construction on Tract R9 is completed. PUD Section 8.9.C states this commitment. 7. Entry gates at Bayshore Drive will be similar to existing gates on Saba Drive at the Thomasson Drive entry including a gate, chain link, concrete wall, and landscaping. PUD Section 8.9.D states this commitment. 9.A.2.a Packet Pg. 63 Attachment: 10-26-20 - Staff Report (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) PUDR-PL20190002305; Sabal Bay MPUD Rezone (PUDR) – Fleischmann Parcel October 27, 2020 Page 16 of 16 ENVIRONMENTAL ADVISORY COUNCIL (EAC) REVIEW: This project does not require Environmental Advisory Council (EAC) review, as this project did not meet the EAC scope of land development project reviews as identified in Section 2 -1193 of the Collier County Codes of Laws and Ordinances. COUNTY ATTORNEY OFFICE REVIEW: The County Attorney’s Office reviewed this staff report on September 25, 2020. RECOMMENDATION: Staff recommends the CCPC forward this petition to the Board with a recommendation of approval with these stipulations incorporated in the PUD Document: 1. Upon request of County, the developer of Tract R9, or its successors and assigns, shall pay its fair share payment and coordinate with Collier County on traffic calming improvements under the Neighborhood Traffic Management Program (NTMP) including but not limited to striping, signage and speed tables on Bayshore Drive from the project access to Thomasson Drive. This commitment will expire the earlier of: 2 years after buildout of Tract R9 or turnover to the HOA. 2. The developer of Tract R9 and its successors and assigns consent to Collier County including the entirety of the Tract R9 property in the Bayshore Beautification Municipal Service Taxing Unit (MSTU). This commitment is specific to Tract R9 and will expire 2 years after buildout of Tract R9. Attachments: A) Proposed Ordinance B) FLUE Consistency Memo C) Application/Backup Materials D) Public comment letters received as of Oct. 26, 2020 9.A.2.a Packet Pg. 64 Attachment: 10-26-20 - Staff Report (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 65 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 66 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 67 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 68 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 69 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 70 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 71 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 72 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 73 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 74 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 75 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 76 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 77 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 78 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 79 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 80 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 81 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 82 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 83 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 84 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 85 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 86 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 87 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 88 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 89 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 90 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 91 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 92 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 93 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 94 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 95 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 96 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 97 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 98 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 99 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 100 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 101 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 102 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 103 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 104 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 105 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 106 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 107 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 108 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 109 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.bPacket Pg. 110Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay 9.A.2.bPacket Pg. 111Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay 9.A.2.bPacket Pg. 112Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay 9.A.2.bPacket Pg. 113Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay 9.A.2.b Packet Pg. 114 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 115 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 116 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 117 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 118 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 119 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.b Packet Pg. 120 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.bPacket Pg. 121Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay 9.A.2.b Packet Pg. 122 Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.bPacket Pg. 123Attachment: ATTACHMENT A - Ordinance CAO initialed - 091520 (14206 : PL20190002305 - Sabal Bay ‒ 1 ‒ PL20190002305, Sabal Bay Growth Management Department Zoning Division C O N S I S T E N C Y R E V I E W M E M O R A N D U M To: Timothy Finn, Principal Planner, Zoning Services Section From: Corby Schmidt, AICP, Principal Planner, Comprehensive Planning Section Date: March 5, 2020 Subject: Future Land Use Element Consistency Review of Proposed Planned Unit Development to Planned Unit Development Rezone PETITION NUMBER: PL20190002305 [REV: 3] PETITION NAME: Sabal Bay Mixed Use Planned Unit Development (PUD)-to-PUD Rezone (PUDR). REQUEST: This petition requests a rezone of property presently zoned RSF-3, Residential Single- Family, A, Rural Agricultural ‒ with ST, Special Treatment areas, and the Sabal Bay Mixed Use PUD to expand the size of the Sabal Bay Mixed Use PUD to develop another 230 residences. LOCATION: The subject property, consisting of ±102.49 acres, is located southeast of the intersection of Bayshore Drive and Holly Avenue, west of the Avalon Canal, in Sections 23 & 26, Township 50 South, Range 25 East. COMPREHENSIVE PLANNING COMMENTS: The subject property is designated Urban Mixed Use District, Urban Coastal Fringe Subdistrict, as identified on the Future Land Use Map (FLUM) within the Growth Management Plan (GMP). This site is also located in the Coastal High Hazard Area (CHHA). CHHA provisions, for the most part, apply to residential development and affects the FLUE Density Rating System, as follows: The base residential density allowed by the Urban Mixed Use District is 4 dwelling units per acre (DU/A). Due to the property’s location in the CHHA, the maximum attainable density is reduced by 1 DU/A, for a maximum density of 3 DU/A (307 units). A total of 230 dwelling units are proposed for this portion of the development, and provisions of the Density Rating System are met. Third submittal revisions did not affect consistency with the Future Land Use Element. Future Land Use Element (FLUE) Policy 5.6 requires new development to be compatible with, and complementary to, surrounding land uses, as set forth in the Land Development Code. Comprehensive Planning leaves this determination to the Zoning Services staff as part of their review of the petition in its entirety. However, the compatibility analysis is encouraged to be comprehensive and include a review of both the subject property and surrounding or nearby 9.A.2.c Packet Pg. 124 Attachment: ATTACHMENT B - PUDR-PL2019-2305 Sabal Bay R3 FNL - Consistency review (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - ‒ 2 ‒ PL20190002305, Sabal Bay properties regarding allowed use intensities and densities, development standards (building heights, setbacks, landscape buffers, etc.), building mass, building location and orientation, architectural features, amount and type of open space and location, traffic generation/attraction, etc. The County recognizes Smart Growth policies and practices in its consideration of future land use arrangements and choice-making options. FLUE Objective 7 and Policies 7.1 through 7.4 promote Smart Growth policies for new development and redevelopment projects pertaining to access, interconnections, open space, and walkable communities. Each Policy is followed by staff analysis [in bold italicized text]. Objective 7: Promote smart growth policies, reduce greenhouse gas emissions, and adhere to the existing development character of the Collier County, where applicable, and as follows: Policy 7.1: The County shall encourage developers and property owners to connect their properties to fronting collector and arterial roads, except where no such connection can be made without violating intersection spacing requirements of the Land Development Code. Policy 7.2: The County shall encourage internal accesses or loop roads in an effort to help reduce vehicle congestion on nearby collector and arterial roads and minimize the need for traffic signals. Policy 7.3: All new and existing developments shall be encouraged to connect their local streets and/or interconnection points with adjoining neighborhoods or other developments regardless of land use type. The interconnection of local streets between developments is also addressed in Policy 9.3 of the Transportation Element. [Combined responses for Policies 7.1 – 7.3: Access points to the Sabal Bay MPUD do not change as results of this proposal. Two points access US 4 1 (one existing, 1 potential), one accesses Thomasson Drive, one [to] access Bayshore Drive (planned), and one [to] access Hamilton Avenue (planned). The planned interconnections to Bayshore Drive and Hamilton Avenue will provide the connections to local streets and interconnection points with adjoining neighborhoods encouraged by these Policies. The expansion acreage provides additional utilization of the loop road (Antigua Way) – already part of the Sabal Bay MPUD.] Policy 7.4: The County shall encourage new developments to provide walkable communities with a blend of densities, common open spaces, civic facilities and a range of housing prices and types. [Application materials explain how the additional acreage and residential dens ity increases the range of housing prices and types within the Sabal Bay MPUD. Application materials explain how, as part of the Sabal Bay MPUD, expansion area development will have access to the Isles of Collier Preserve common open spaces and civic facilities including amenity centers, courts and pools). 9.A.2.c Packet Pg. 125 Attachment: ATTACHMENT B - PUDR-PL2019-2305 Sabal Bay R3 FNL - Consistency review (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - ‒ 3 ‒ PL20190002305, Sabal Bay No deviations are requested pertaining to sidewalks; therefore, the project will be subject to LDC requirements for provision of sidewalks.] CONCLUSIONS: Based upon the above analysis, this proposed PUDR may be deemed consistent with the FLUE. PETITION ON CITYVIEW cc: Ray Bellows, Zoning Manager, Zoning Services Section Anita Jenkins, AICP, Community Planning Manager, Comprehensive Planning Section G: Comp\Consistency Reviews\2020 \\bcc.colliergov.net\data\GMD-LDS\CDES Planning Services\Consistency Reviews\2020\PUDR\PUDR-PL2019-2305 Sabal Bay R3 FNL.docx 9.A.2.c Packet Pg. 126 Attachment: ATTACHMENT B - PUDR-PL2019-2305 Sabal Bay R3 FNL - Consistency review (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Post Office Drawer 2800 • Fort Myers, FL 33902 Phone (239) 461-3170 • Fax (239) 461-3169 Fleischmann Parcel Hearing Package Petition No. 20190002305 INDEX ¾Cover Letter & Narrative ¾Application & Exhibit A ¾Evaluation Criteria ¾Warranty Deed ¾Property Ownership ¾Property Ownership Disclosure ¾Pre-Application Meeting Notes ¾Affidavits of Authorization ¾Aerial with Project Boundary ¾NIM Information & Exhibits ¾Traffic Impact Statement ¾Environmental Data ¾Utility Statement ¾Boundary Survey ¾Addressing Checklist ¾School Impact Analysis ¾Architectural Renderings ¾STA and Preserve Exhibits ¾Ordinance No. 05-59 ¾Ordinance No. 12-12 ¾Exhibits B – F xExhibit B: Development Standards xExhibit C: Master Plan & Water Management Plan xExhibit D: Legal Description 9.A.2.d Packet Pg. 127 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Page 2 xExhibit F: List of Development Commitments ¾Exhibit G: Sabal Bay Boundary Survey MHW Lines ¾Additional Information Requested by Staff ¾Isles of Collier Preserve Eagle Nesting Summary Map & Table ¾Site Plan for Tract R-9 9.A.2.d Packet Pg. 128 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann KsZ>ddZΘEZZd/s 9.A.2.d Packet Pg. 129 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 2271 McGregor Boulevard • Fort Myers, Florida 33901 Phone (239) 461-3170 • Fax (239) 461-3169 November 1, 2019 Mr. Timothy Finn, AICP Collier County Community Development and Environmental Services Division 2800 North Horseshoe Drive Naples, FL 34104 Re: Fleischmann Parcel PL20190002305 Cover Letter and Project Narrative Dear Mr. Finn, Please find enclosed an application for a rezone of the subject property to be added to the Sabal Bay MPUD, Ordinance No. 12-12, amended March 13, 2012 and established by Ordinance No. 05-59 approved on November 15, 2005. The rezone request includes rezoning the subject property to be added to the Sabal Bay MPUD, increasing the MPUD’s size by ±102.49 acres and density by 230 dwelling units. The subject property and Sabal Bay MPUD are located in the Urban Coastal Fringe Sub- District on the Future Land Use Map. Therefore, through the Density Rating System of the FLUE, the subject property has a maximum density of 3 dwelling units per acres which totals 307 dwelling units permitted, which is above the proposed density requested. Should you have any questions or require additional information, please advise. Sincerely, Barraco and Associates, Inc. Jennifer Sapen, AICP Principle Planner File: 23780 9.A.2.d Packet Pg. 130 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann WW>/d/KEΘy,//d 9.A.2.d Packet Pg. 131 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 132 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 133 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 134 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 135 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 136 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 137 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 138 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 139 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 140 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 141 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 142 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Post Office Drawer 2800 • Fort Myers, FL 33902 Phone (239) 461-3170 • Fax (239) 461-3169 1 of 2 EXHIBIT A DESCRIPTION Lots 81 through 90, inclusive, Naples Groves and Truck Company's Little Farms No.2, according to the plat thereof as recorded in Plat Book 1, Page 27A, Public Records of Collier County, Florida. 9.A.2.d Packet Pg. 143 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann s>hd/KEZ/dZ/ 9.A.2.d Packet Pg. 144 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 2271 McGregor Boulevard • Fort Myers, Florida 33901 Phone (239) 461-3170 • Fax (239) 461-3169 Fleischmann Parcel Evaluation Criteria a)The suitability of the area for the type and pattern of development proposed in relation to physical characteristics of the land, surrounding areas, traffic and access, drainage, sewer, water, and other utilities. The residential uses proposed with this rezone are compatible with the abutting residential uses. The property’s location, surrounded by the Sabal Bay MPUD on three sides (north, south, and east), provides a suitable area for expansion of the Mixed Use Planned Development. Since the original approval of the Sabal Bay MPUD in November 2005, only two parcels are not under PPL permit review or constructed. The MPUD’s residential component has been constructed to date following the residential program prescribed by the MPUD. As such, the subject property’s proposed residential uses, which replicate Sabal Bay’s approved residential uses, will inherently be even more compatible to the current surrounding uses than when the MPUD was originally approved. Please see more information on suitability and compatibility within Section c) of this report. As shown within the enclosed Traffic Impact Statement, the increased density will not require modification to the existing roadway system or accesses. Drainage, sewer, water, and other utilities are connected to the site from the developed phases of Isles of Collier Preserve. b)Adequacy of evidence of unified control and suitability of any proposed agreements, contract, or other instruments, or for amendments in those proposed, particularly as they may relate to arrangements or provisions to be made for the continuing operation and maintenance of such areas and facilities that are not to be provided or maintained at public expense. Findings and recommendations of this type shall be made only after consultation with the county attorney. The notarized and completed Covenant of Unified Control form is included with this submittal. The proposed Schedule of Uses and General Developer Commitments sectionfrom the Sabal Bay MPUD, located in Exhibits A-F, also provide evidence of unified control and suitability of proposed agreements, contract, or other instruments, or for amendments as they relate to arrangements or provisions to be made for continuing operation and maintenance of areas and facilities that are not to be provided or maintained at public expense. The requested changes are to rezone the subject property’s ±102.49 acres of land into a PUD with 230 dwelling units to be added to the Sabal Bay MPUD. This would require Sabal Bay MPUD’s density to increase from 1,999 dwelling units to 2,229 dwelling units. The applicant submits no other requested changes from previously approved agreements, contracts, or other instruments. c)Conformity of the proposed PUD with the goals, objectives and policies of the Growth Management Plan. (This is to include identifying what Sub-district, policy or other provision allows the requested uses/density, and fully 9.A.2.d Packet Pg. 145 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 2271 McGregor Boulevard • Fort Myers, Florida 33901 Phone (239) 461-3170 • Fax (239) 461-3169 explaining/addressing all criteria or conditions of that Sub-district, policy or other provision.) The proposed PUD conforms with the goals, objectives and policies of the Growth Management Plan (GMP). The proposed development is located within the Urban Coastal Fringe Sub - District as identified on the Future Land Use Map of the Future Land Use Element (FLUE). The purpose of the Urban Coastal Fringe Sub - District is to provide transitional densities between the conservation designated area and the remainder of the urban designated area. The subject property, located between developed land and preservation, will provide an appropriate transitional density between the conservation and urban designated areas. Rezones within this Sub-district are recommended to be in the form of a Planned Unit Development, making the proposed request compliant with the GMP. FUTURE LAND USE ELEMENT The proposed residential density of the Sabal Bay MPUD, including the Fleischmann Parcel, would be .91 dwelling units (DU) per acre, 2,229 units/2,452 acres, which excludes 50 acres of commercial uses, and 16 acres of recreation/village center uses. This density is consistent with the maximum density permitted by the FLUE Density Rating System and is therefore consistent with FLUE Objective 5 and Policy 5.1. The base density allowed by the FLUE for the entire subject property is four (4) DUs per acre. Due to the project’s location within the Coastal High Hazard Area (CHHA), one (1) dwelling unit is subtracted from the base density permitting a maximum density of three (3) dwelling units per acres, which is well above the proposed density requested. The entire acreage of the property is located outside of tidal influenced water bodies, as shown by the location of the Mean High Water Line (MHWL) on the attached Sabal Bay Boundary Survey labeled Exhibit G, allowing all of the property’s acreage to be used for calculating density. The maximum number of dwelling units allowed on the subject property per the FLUE Density Rating System is 307 dwelling units (102.49ac x 3du/ac) compared to 230 dwelling units requested for the proposed development. Improvements will be in compliance with the LDC as set forth in Objective 3 of the FLUE. Future development will follow historic permitting patterns with all necessary agencies and will be permitted as a subsequent PPL phase with Collier County. The development of the Fleischmann Parcel as an expansion of the Sabal Bay MPUD will result in an efficient and economical extension of community facilities and services as required in Policy 3. 1 of the FLUE. In addition to the GMP policies the subject property is consistent with, Long Range Planning staff requested particular attention to Policies 5.3 and 5.6, Objective 7, and Policies 7.1-7.4: Policy 5.3: All rezonings must be consistent with this Growth Management Plan. For properties that are zoned inconsistent with the Future Land Use Designation Description Section but have nonetheless been determined to be consistent with the Future Land Use Element, as provided for in Policies 5.9 through 5.13, the following provisions apply: 9.A.2.d Packet Pg. 146 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 2271 McGregor Boulevard • Fort Myers, Florida 33901 Phone (239) 461-3170 • Fax (239) 461-3169 The subject property’s current zoning and proposed rezoning are both consistent with the Future Land Use Designation Urban Coastal Fringe Sub-District. The subject property is currently zoned Residential Single-Family (RSF-3), Rural Agriculture (A), and Special Treatment Overlay (ST). The proposed rezone to a Planned Unit Development (PUD) provides a density permissible by the subject property’s Future Land Use, compliant with the density rating system contained in the FLUE of the GMP. The proposed PUD density is equivalent to 2.2 dwelling units per acre, which will be further reduced to .91 dwelling units per acre upon integration of the subject property’s acreage and density into the Sabal Bay MPUD. Further consistency with the GMP is related to the PUD rezoning request itself. Pursuant to the Urban Coastal Fringe Sub-District, rezones are recommended to be in the form of a Planned Unit Development, therefore the subject property will be zoned consistent with the Future Land Use Designation. Policy 5.6: New developments shall be compatible with, and complementary to, the surrounding land uses, as set forth in the Land Development Code (Ordinance 04-41, adopted June 22, 2004 and effective October 18, 2004, as amended). Policy 5.7: Encourage the use of land presently designated for urban intensity uses before designating other areas for urban intensity uses. This shall occur by planning for the expansion of County owned and operated public facilities and services to existing lands designated for urban intensity uses, the Rural Settlement District (formerly known as North Golden Gate), and the Rural Fringe Mixed Use District, before servicing new areas. The uses proposed for this development are the same as the residential uses approved for the Sabal Bay MPUD, which will remain unchanged. The Sabal Bay MPUD uses were deemed as appropriate uses by Staff and Board of Collier County Commissioners (BOCC) on November 10, 2005. The Sabal Bay MPUD having been found compatible with and complementary to existing and future surrounding land uses ensures the compatibility of the subject parcel with the surrounding land uses as an expansion of the Sabal Bay MPUD, as required in Policy 5.6 of the FLUE. The proposed density is also compatible with the surrounding area, sharing most of its boundary lines with Sabal Bay MPUD. The Sabal Bay MPUD borders the proposed development on the north, south, and east property boundaries. Sabal Bay MPUD has an approved density of .85 dwelling units per acre, per Ordinance Number 12-12. The addition of the Fleischmann Parcel and corresponding density to the Sabal Bay MPUD would increase the density to .91 dwelling units per acre, far below the Urban Coastal Fringe Sub-District’s approved density of 4 dwelling units per acres. Also important to note, the Sabal Bay MPUD was originally approved for 1.26 dwelling units per acre in 2005, by Ordinance 05-59. The density was reduced to 0.85 du/ac in 2012 by ORD 12-12, which changed the acreage included for the residential density calculation from 1,585 acres to 2,350 acres, an increase of 765 acres that was not used to calculate 9.A.2.d Packet Pg. 147 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 2271 McGregor Boulevard • Fort Myers, Florida 33901 Phone (239) 461-3170 • Fax (239) 461-3169 residential density per acre in the original ordinance. The addition of the Fleischmann Parcel to the MPUD will only increase the currently approved density of 0.85 du/ac to 0.91 du/ac, an increase of 0.06 units per acre. This minimal increase in density will not go over the maximum density of 3 du/ac per the Density Rating System, nor will it top the MPUD’s originally approved density. To the west the subject property is adjacent to a mixed residential development and vacant undeveloped land zoned residential and agriculture. The adjacent mixed residential is composed of 45’ wide platted lots and the Sabal Bay MPUD east of the subject property has a variety of lot sizes including 35’, 50’, and 62’ wide lots. The proposed development will be constructed with similar lot widths and product types as the Sabal Bay MPUD, providing an appropriate residential use between the MPUD’s existing residential component and the abutting residential to the west, which includes a mix of single family and mobile homes. The uses and structures proposed for the subject property are the same as the permitted uses and structures for residential in the Sabal Bay MPUDwhichincludes; single family attached and detached dwellings, two-family and duplex dwellings, multi-family dwellings, and recreational facilities. They also provide many of the same regulations and development standards stipulated within the LDC and PUD documents such as sidewalks on both sides of the road, same size front and rear setbacks (excluding single family detached), same size floor area minimum, and similar lot sizes. Pursuant to Policy 5.7 of the FLUE, rezoning of the Fleischmann Parcel will help to encourage the use of land presently designated for urban intensity uses before designating other areas for urban intensity uses. This will allow expansion of County owned and operated public facilities and services to existing lands designated for urban intensity uses, before servicing new areas. In addition, the development of the Fleischmann Parcel will also help to confine urban intensity to areas designated as Urban on the Future Land Use Map, helping to discourage unacceptable levels of urban sprawl in order to minimize the cost of community facilities per Policy 5.5 of the FLUE. The proposed request will allow the Fleischmann Parcel to utilize Planned Unit Development techniques, such as clustered residential development, to promote conservation of open space and environmentally sensitive areas, in line with Policy 5.8 of the FLUE. As demonstrated on the enclosed site plan, 29% of the Fleischman Parcel will be under recorded conservation easements. The proposed request will implement land use policies as mentioned above that will promote sound planning, protect environmentally sensitive lands and habitat for listed species while protecting private property rights. In addition, it will improve compatibility with the adjacent land uses while further implementing the Future Land Use Element, pursuant to Objective 5 of the FLUE. Objective 7: Promote smart growth policies, reduce greenhouse gas emissions, and adhere to the existing development character of the Collier County, where applicable, and as follows: 9.A.2.d Packet Pg. 148 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 2271 McGregor Boulevard • Fort Myers, Florida 33901 Phone (239) 461-3170 • Fax (239) 461-3169 Policy 7.1: The County shall encourage developers and property owners to connect their properties to fronting collector and arterial roads, except where no such connection can be made without violating intersection spacing requirements of the Land Development Code. Policy 7.2: The County shall encourage internal accesses or loop roads in an effort to help reduce vehicle congestion on nearby collector and arterial roads and minimize the need for traffic signals. Policy 7.3: All new and existing developments shall be encouraged to connect their local streets and/or interconnection points with adjoining neighborhoods or other developments regardless of land use type. The interconnection of local streets between developments is also addressed in Policy 9.3 of the Transportation Element. (Combined response for Policies 7.1-7.3 below) The access points to the Sabal Bay MPUD are unchanged through this request. Five access points serve the residential development, two accesses onto U.S. 41 (one existing, one potential, pursuant to FDOT review), one access onto Thomasson Drive (existing), one access onto Bayshore Drive (planned), and one access onto Hamilton Avenue (planned). The planned connector roads to Bayshore Drive and Hamilton Avenue will help to reduce vehicular congestion on U.S. 41 by providing residents with another egress/ingress option, in line with Policy 7.2 of the FLUE. Sabal Bay MPUD is currently connected to Thomasson Drive and is planned to connect to Bayshore Drive and Hamilton Avenue, promoting interconnection of existing and proposed development with adjoining neighborhoods and other developments, pursuant to Policy 7.3 of the FLUE. Moreover, the inclusion of the Fleischmann Parcel into the Sabal Bay MPUD will connect the subject property to a means of egress/ingress on U.S. 41, an arterial road, and Thomasson Drive, a collector road, in line with Policy 7.1 of the FLUE. The development of the Fleischman Parcel as part of the Sabal Bay MPUD promotes smart growth policies by capitalizing on the MPUD’s existing internal accesses and loop road, by providing the Fleischmann Parcel’s future residents with the benefits of multiple access points leading to Arterial, Collector, and Local roads. Without the incorporation of the Fleishman Parcelinto the Sabal Bay MPUD, theproposed development would be limited to Bayshore Drive as the only point of access. The addition of the Fleischmann Parcel to the Sabal Bay MPUD will also promote adherence to the existing development character in this area of Collier County. As a planned Community, the Sabal Bay MPUD shall be developed under unified control with the owners establishing design guidelines and standards to ensure a high and consistent level of quality for residential units and related community features and facilities. As such, the proposed rezone and existing MPUD approvals are consistent with Policy 7.1, 7.2, and 7.3. A traffic impact statement is provided within this application for more information on traffic related issues. Policy 7.4: The County shall encourage new developments to provide walkable communities with a blend of densities, common open spaces, civic facilities and a range of housing prices and types. 9.A.2.d Packet Pg. 149 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 2271 McGregor Boulevard • Fort Myers, Florida 33901 Phone (239) 461-3170 • Fax (239) 461-3169 The proposed acreage/density increase will encourage a blend of densities by providing a range of housing prices and types within the Sabal Bay MPUD. The proposed development also provides a walkable community having sidewalks on both sides of the road. As part of the Sabal Bay MPUD, the proposed development will have access to the Isles of Collier Preserve common open spaces and civic facilities, many of which have already been constructed including amenity centers, pools, tennis courts, pickle ball courts, and bocci ball courts. TRANSPORTATION ELEMENT Objective 4: Provide for the safe and convenient movement of pedestrians and non-motorized vehicles through the implementation of the Collier County Comprehensive Pathways Plan. Objective 7: Develop and adopt standards for safe and efficient ingress and egress to adjoining properties, and encourage safe and convenient on-site traffic circulation through the development review process. Policy 7.1:Collier County shall apply the standards and criteria of the Access Management Policy as adopted by Resolution and as may be amended to ensure the protection of the arterial and collector system’s capacity and integrity. Policy 7.2: The County shall require the submission of a neighborhood traffic impact assessment as a part of all rezone and conditional use applications. This study will analyze the proposed project’s impact on surrounding neighborhood streets. The proposed project also shares similar objectives and complies with policies of the GMP Transportation Element. The development provides a network for the safe and convenient movement of pedestrian and non-motorized vehicles, as stated in Objective 4 of the Transportation Element, by providing sidewalks on both sides of the road throughout the development. The development will also encourage safe and convenient on-site traffic circulation through the development review process, per Objective 7 of the Transportation Element. The established standards and criteria set forth in the Access Management Policy shall be applied by Collier County and may be amended to ensure the protection of the arterial and collector system’s capacity and integrity per Policy 7.1. In accordance with Policy 7.2, the proposed rezoning application includes a traffic impact statement, analyzing the proposed project’s impact on surrounding streets. PUBLIC SCHOOL FACILITIES ELEMENT Objective 2: 9.A.2.d Packet Pg. 150 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 2271 McGregor Boulevard • Fort Myers, Florida 33901 Phone (239) 461-3170 • Fax (239) 461-3169 RESIDENTIAL DEVELOPMENT REVIEW. The County, in cooperation with the School District, shall ensure a school concurrency evaluation is performed on all non-exempt residential development to verify that new students can be accommodated within the adopted level of service standard established for each school type as measured within a CSA. Policy 2.1: The County shall not approve any non-exempt residential development application for a new residential preliminary plat, site plan or functional equivalent until the School District has issued a School Capacity Availability Determination Letter (SCADL) verifying available capacity to serve the development. In compliance with the Public Schools Facilities Element of the GMP, the proposed development is submitting to a school concurrency evaluation required by Objective 2 of this Element. The evaluation will verify that new students from the proposed development can be accommodated within the adopted level of service standard established for each school type as measured within School Concurrency Service Areas (CSAs). The proposed project will not be approved until the School District has issued a School Capacity Availability Determination Letter (SCADL) verifying available capacity to serve the additional density requested, per Policy 2.1 of the Public School Facilities Element. ECONOMIC ELEMENT Policy 1.8: Collier County will encourage the preservation of sensitive natural resources, including beaches, wetlands, estuaries, clean air and water, historic resources, scenic vistas and other unique natural resources. Policy 1.9: Collier County, in response to the current and projected needs of its residents, will encourage a diverse mix of housing types, sizes, prices, and rents. The proposed development also promotes Goals of the Economic Element of the GMP by encouraging wetland preservation and providing a diverse mix of housing types, sizes, and sales prices, in response to current and projected needs of Collier County’s residents. In line with Policy 1.8 of the GMP’s Economic Element, the proposed development provides more than the required amount of native vegetation as preserve, located in the southernmost portion of the subject property. The project’s designated preserve area abuts existing preserve that is to be deeded to Rookery Bay National Estuarine Research Reserve, therefore extending the existing preserve areas via connectivity and promoting preservation of the surrounding natural resources. The existing residential development in Isles of Collier Preserve has been successful and is indicative of a need for these types of residential products in Collier County. The requested expansion of the MPUD to increase acreage and density, if approved, will provide the public with a more diverse mix of housing types, sizes, and prices in line with Economic Element Policy 1.9 of the Growth Management Plan. CONSERVATION AND COASTAL MANAGMENT ELEMENT 9.A.2.d Packet Pg. 151 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 2271 McGregor Boulevard • Fort Myers, Florida 33901 Phone (239) 461-3170 • Fax (239) 461-3169 The proposed development complieswith Goal 6, Objectives 6.1, 7.1& 12.1, and Policies 6.1.1, 6.1.7, 6.1.8, 6.2.6, 7.1.1, 7.1.4, and 12.2.5 of the GMP’s Conservation and Coastal Management Element (CCME). GOAL 6: TO IDENTIFY, PROTECT, CONSERVE AND APPROPRIATELY USE NATIVE VEGETATIVE COMMUNITIES AND WILDLIFE HABITAT. Objective 6.1: Protect native vegetative communities through the application of minimum preservation requirements. (The Policies under this Objective apply to all of Collier County except for that portion of the County which is identified on the Countywide Future Land Use Map (FLUM) as the Rural Lands Stewardship Area Overlay.) Policy 6.1.1: For the County’s Urban Designated Area, Estates Designated Area, Conservation Designated Area, and Agricultural/Rural Mixed Use District, Rural-Industrial District and Rural-Settlement Area District as designated on the FLUM, native vegetation shall be preserved through the application of the following minimum preservation and vegetation retention standards and criteria, unless the development occurs within the Area of Critical State Concern (ACSC) where the ACSC standards referenced in the Future Land Use Element shall apply. Notwithstanding the ACSC requirements, this Policy shall apply to all non-agricultural development except for single-family dwelling units situated on individual parcels that are not located within a watershed management conservation area identified in a Watershed Management Plan developed pursuant to Policies supporting Objective 2.1 of this Element. For properties not previously within the Coastal High Hazard Area but now within the Coastal High Hazard Area due to adoption of a revised Coastal High Hazard Area boundary in 2013, the native vegetation preservation and retention standards of the Non-Coastal High Hazard Area shall continue to apply. (Reference the Coastal High Hazard Area Comparison Map in the Future Land Use Element.) Policy 6.1.7: The County shall require native vegetation to be incorporated into landscape designs in order to promote the preservation of native plant communities and to encourage water conservation. This shall be accomplished by: (1) Providing incentives for retaining existing native vegetation in landscaped areas; (2) Establishing minimum native vegetation requirements for new landscaping; and, (3) Wet detention ponds within the Urban Designated area shall have a littoral shelf with an area equal to 2.5% of the ponds surface area measured at the control elevation and be planted with native aquatic vegetation. Wet detention ponds within the Rural Fringe Mixed Use District, shall have a littoral shelf with an area equal to 30% of the ponds surface area measured at the control elevation and be planted with native aquatic vegetation. 4) Stormwater management systems within the Rural Lands Stewardship Area (RLSA) Overlay shall be designed pursuant to the RLSA policies found in the Future Land Use Element. Compliant with Goal 6 of the CCME, native vegetative communities and wildlife habitat will be identified, protected, conserved and appropriately used. The subject property’s native 9.A.2.d Packet Pg. 152 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 2271 McGregor Boulevard • Fort Myers, Florida 33901 Phone (239) 461-3170 • Fax (239) 461-3169 vegetation will be protected by application of minimum preservation requirements per Objective 6.1. A minimum of 25% native vegetation is required to be preserved, in accordance with Policy 6.1.1 and the standards and criteria required for Residential and Mixed Use Development within the Coastal High Hazard Area in the County’s Urban Designated Area. As shown on the enclosed Site Plan, the project will exceed the native vegetation preservation requirement in the CCME by providing 29.34 acres (29%) of preserved native vegetation, 3.72 acres over the required amount. Consistent with policy 6.1.7, the proposed development will incorporate native vegetation into its landscape design by allowing the preserve to serve as a buffer, after exotic vegetation removal in accordance with LDC Sections 4.06.02 and 4.06.05.E.1, as shown on the Proposed Master Site Plan included with this submittal. Every effort will be made to incorporate native vegetation and/or retain existing native vegetation to the maximum extent possible into the proposed development’s landscape design where required infrastructure or approved construction footprint does not necessitate its removal. Policy 6.1.8: An Environmental Impact Statement (EIS), or submittal of appropriate environmental data as specified in the County’s land development regulations, is required, to provide a method to objectively evaluate the impact of a proposed development, site alteration, or project upon the resources and environmental quality of the project area and the community and to insure that planning and zoning decisions are made with a complete understanding of the impact of such decisions upon the environment, to encourage projects and developments that will protect, conserve and enhance, but not degrade, the environmental quality and resources of the particular project or development site, the general area and the greater community. The County’s land development regulations shall establish the criteria for determining the type of proposed development requiring an EIS, including the size and nature of the proposed development, the location of the proposed development in relation to existing environmental characteristics, the degree of site alterations, and other pertinent information. Policy 6.2.6: Within the Urban Designation and the Rural Fringe Mixed Use District, required wetland preservation areas, buffer areas, and mitigation areas shall be dedicated as conservation and common areas in the form of conservation easements and shall be identified or platted as separate tracts; and, in the case of a Planned Unit Development (PUD), these areas shall also be depicted on the PUD Master Plan. These areas shall be maintained free from trash and debris and from Category I invasive exotic plants, as defined by the Florida Exotic Pest Plant Council. (XI) = Plan Amendment by Ordinance No. 2017-20 on June 13, 2017 Conservation and Coastal Management Element as of Ordinance No. 2017-20 adopted June 13, 2017 32 Land uses allowed in these areas shall be limited to those listed in Policy 6.2.5(5)d of this Element and shall not include any other activities that are detrimental to drainage, flood control, water conservation, erosion control or fish and wildlife habitat conservation and preservation. OBJECTIVE 7.1: Direct incompatible land uses away from listed animal species and their habitats. (The County relies on the listing process of State and Federal agencies to identify species that require special protection because of their endangered, threatened, or species of special concern status. Listed animal species are those species that the Florida Fish and Wildlife Conservation Commission has designated as endangered, threatened, or species of special concern, in accordance with Rules 9.A.2.d Packet Pg. 153 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 2271 McGregor Boulevard • Fort Myers, Florida 33901 Phone (239) 461-3170 • Fax (239) 461-3169 68A-27.003, 68A-27.004, and 68A-27.005, F.A.C. and those species designated by various federal agencies as Endangered and Threatened species published in 50 CFR 17.) Policy 7.1.1: Incompatible land uses are directed away from listed species and their habitats by the following mechanisms: (1) Conservation Designation on the Future Land Use Map The overall purpose of the Conservation Designation is to conserve and maintain the natural resources of Collier County and their associated environmental, recreational and economic benefits. These areas have been demonstrated to have high wildlife value. The allowed land uses specified in the FLUE’s Conservation Designation will accommodate limited residential development and future non-residential development. These limitations help direct many incompatible land uses away from listed species and their habitats contained in this Future Land Use Designation. (2) – (5) N/A (6) All other policies supporting Objective 7.1 of this Element. Policy 7.1.4: All development shall comply with applicable federal and state permitting requirements regarding listed species protection. Pursuant to Policy 6.1.8 of the CCME, an Environmental Study, with the appropriate environmental data as specified in the County’s land development regulations, is included with this submittal. All required preservation areas will be dedicated as conservation and common areas in the form of conservation easements and are depicted on the PUD Master Plan, compliant with Policy 6.2.6 of the CCME. The proposed conservation areas, as shown on the Master Site Plan, are located in the southernmost portions of the subject property, expanding the preserve around the property’s largest Special Treatment Overlay area and further separating development from listed species and their habitats located in the preserve areas to the south of the subject property. As such, the proposed development is consistent with Objective 7.1 and Policy 7.1.1 by directing incompatible land uses away from listed species and their habitats through the designation of preservation land on the subject property in the most appropriate area. The proposed conservation area also promotes connectivity to adjacent preserve areas in the Sabal Bay MPUD which will be deeded to Rookery Bay National Estuarine Research Reserve. Furthermore, the proposed development will comply with applicable federal and state permitting requirements regarding listed species protection as stated in Policy 7.1.4 of the GMP’s Conservation and Coastal Management Element. OBJECTIVE 12.1: Maintain hurricane evacuation clearance times as required by state law. An evacuation clearance time is defined as having residents and visitors in an appropriate refuge away from storm surge prior to the arrival of sustained Tropical Storm force winds, i.e., winds equal to or greater than 39 mph. To further this Objective, for future mobile home developments located outside of the storm surge zone, such development is to include on-site sheltering or retro-fitting of an adjacent facility. The Collier County Bureau of Emergency Services continues to seek 9.A.2.d Packet Pg. 154 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 2271 McGregor Boulevard • Fort Myers, Florida 33901 Phone (239) 461-3170 • Fax (239) 461-3169 opportunities to increase shelter facilities and associated capacities under the direction of the Florida Division of Emergency Management. Policy 12.2.5: The County shall consider the Coastal High Hazard Area as a geographical area lying below the elevation of the Category 1 storm surge line as presently defined in the 2011 Southwest Florida Regional Planning Council’s Hurricane Evacuation Study, or subsequently authorized storm surge or evacuation planning studies coordinated by the Collier County Bureau of Emergency Services and approved by the Board of County Commissioners. The proposed development will adhere to maintaining hurricane evacuation clearance times as required by state law. The subject property, being fully located within the Coastal High Hazard Area as described by Policy 12.2.5, will comply with all GMP policies related to the CCHA, such as the Density Rating System in the FLUE. In line with Goal 12 of the GMP, every effort will be made to ensure the public safety, health and welfare of people and property from the effects of hurricane storm damage. CAPITAL IMPROVEMENT ELEMENT Policy 1.5: The standards for levels of service of public facilities shall be as follows: C. County Stormwater Management Systems: 1. Future "private" developments - water quantity and quality standards as specified in Collier County Ordinances 74-50, 90-10, and 2001-27, and Land Development Code Ordinance 2004-41, as amended. D. County Potable Water Systems: County Water District = 150 gallons per capita per day (gpcd) E. County Sanitary Sewer ࣓ Wastewater Treatment Systems: North Wastewater Treatment Service Area = 100 gallons per capita per day (gpcd) South Wastewater Treatment Service Area = 100 gallons per capita per day (gpcd) The proposed development will comply with Policy 1.5 C, D, and E of the GMP’s Capital Improvement Element (CIE). Stormwater management and utility provisions will be designed to meet the required standards in order to obtain permits. d)The internal and external compatibility of proposed uses, which conditions may include restrictions on location of improvements, restrictions on design, and buffering and screening requirements. The proposed addition of the Fleischmann Parcel to the Sabal Bay MPUD requires no change to uses or buffers stipulated within the existing MPUD ordinance. As such, the proposed use of the subject property will be internally and externally compatible. Proposed buffers are shown on the enclosed Site Plan, in compliance with Section 10.02.13.A. of the LDC and the PUD Master Plan Contents established in Section G of Collier County’s Administrative Code for Land Development. 9.A.2.d Packet Pg. 155 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 2271 McGregor Boulevard • Fort Myers, Florida 33901 Phone (239) 461-3170 • Fax (239) 461-3169 e)The adequacy of usable open space areas in existence and as proposed to serve the development. The proposed development provides sufficient usable open space areas, both in existence and proposed to serve the development. f)The timing or sequence of development for the purpose of assuring the adequacy of available improvements and facilities, both public and private. Proposed development will commence in scheduled phases, assuring the adequacy of available improvements and facilities during development. g)The ability of the subject property and of surrounding areas to accommodate expansion. The subject property provides adequate land to accommodate the requested density increase. As shown within the enclosed Traffic Impact Statement, the increase density will not require modification to the existing roadway system or accesses. The existing utility infrastructure is adequately sized to accommodate the proposed density increase. h)Conformity with PUD regulations, or as to desirable modifications of such regulations in the particular case, based on determination that such modifications of justified as meeting public purposes to a degree at least equivalent to literal application of such regulations. The proposed project conforms with PUD regulations outlined in Sections 2.03.06 and 10.02.13 of the Land Development Code (LDC). There are no changes to the PUD development regulations, uses, and road details. The proposed development will be the same type of development that has received PPL approval from Collier County for other phases of Isles of Collier Preserve within the Sabal Bay MPUD. 9.A.2.d Packet Pg. 156 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann tZZEdz 9.A.2.d Packet Pg. 157 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 158 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 159 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 160 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 161 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 162 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 163 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 164 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann WZKWZdzKtEZ^,/W 9.A.2.d Packet Pg. 165 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann &ROOLHU&RXQW\3URSHUW\$SSUDLVHU3URSHUW\6XPPDU\ 3DUFHO1R 6LWH$GGUHVV 'LVFODLPHU 6LWH&LW\6LWH=RQH 1RWH 1DPH$GGUHVV%$<6+25(3$5&(///& 7+$9(667( &LW\1$3/(6 6WDWH )/=LS 0DS1R 6WUDS1R 6HFWLRQ 7RZQVKLS 5DQJH $FUHV£ (VWLPDWHG $ $ /HJDO 1*7&/)12/27 0LOODJH$UHD0LOODJH5DWHV£ &DOFXODWLRQV 6XE&RQGR 1* 7&/)81,76FKRRO 2WKHU 7RWDO 8VH&RGH9$&$175(6,'(17,$/ /DWHVW6DOHV+LVWRU\ 1RWDOO6DOHVDUHOLVWHGGXHWR&RQILGHQWLDOLW\ 'DWH %RRN3DJH $PRXQW £&HUWLILHG7D[5ROO 6XEMHFWWR&KDQJH /DQG9DOXH ſʫƀ,PSURYHG9DOXH ſʰƀ0DUNHW9DOXH ſŞƀ&DS ſʰƀ$VVHVVHG9DOXH ſʰƀ6FKRRO7D[DEOH9DOXH ſʰƀ7D[DEOH9DOXH ,IDOO9DOXHVVKRZQDERYHHTXDOWKLVSDUFHOZDVFUHDWHGDIWHUWKH)LQDO7D[5ROO £ 9.A.2.d Packet Pg. 166 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann &ROOLHU&RXQW\3URSHUW\$SSUDLVHU3URSHUW\6XPPDU\ 3DUFHO1R 6LWH$GGUHVV 'LVFODLPHU 6LWH&LW\6LWH=RQH 1RWH 1DPH$GGUHVV%$<6+25(3$5&(///& 7+$9(667( &LW\1$3/(6 6WDWH )/=LS 0DS1R 6WUDS1R 6HFWLRQ 7RZQVKLS 5DQJH $FUHV£ (VWLPDWHG $ $ /HJDO 1*7&/)12/276 0LOODJH$UHD0LOODJH5DWHV£ &DOFXODWLRQV 6XE&RQGR 1* 7&/)81,76FKRRO 2WKHU 7RWDO 8VH&RGH$&5($*(127=21('$*5,&8/785$/ /DWHVW6DOHV+LVWRU\ 1RWDOO6DOHVDUHOLVWHGGXHWR&RQILGHQWLDOLW\ 'DWH %RRN3DJH $PRXQW £&HUWLILHG7D[5ROO 6XEMHFWWR&KDQJH /DQG9DOXH ſʫƀ,PSURYHG9DOXH ſʰƀ0DUNHW9DOXH ſʰƀ$VVHVVHG9DOXH ſʰƀ6FKRRO7D[DEOH9DOXH ſʰƀ7D[DEOH9DOXH ,IDOO9DOXHVVKRZQDERYHHTXDOWKLVSDUFHOZDVFUHDWHGDIWHUWKH)LQDO7D[5ROO £ 9.A.2.d Packet Pg. 167 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann &ROOLHU&RXQW\3URSHUW\$SSUDLVHU3URSHUW\6XPPDU\ 3DUFHO1R 6LWH$GGUHVV 'LVFODLPHU 6LWH&LW\6LWH=RQH 1RWH 1DPH$GGUHVV%$<6+25(3$5&(///& 7+$9(667( &LW\1$3/(6 6WDWH )/=LS 0DS1R 6WUDS1R 6HFWLRQ 7RZQVKLS 5DQJH $FUHV£ (VWLPDWHG $ $ /HJDO 1*7&/)12/27$& 0LOODJH$UHD0LOODJH5DWHV£ &DOFXODWLRQV 6XE&RQGR 1* 7&/)81,76FKRRO 2WKHU 7RWDO 8VH&RGH9$&$175(6,'(17,$/ /DWHVW6DOHV+LVWRU\ 1RWDOO6DOHVDUHOLVWHGGXHWR&RQILGHQWLDOLW\ 'DWH %RRN3DJH $PRXQW £&HUWLILHG7D[5ROO 6XEMHFWWR&KDQJH /DQG9DOXH ſʫƀ,PSURYHG9DOXH ſʰƀ0DUNHW9DOXH ſʰƀ$VVHVVHG9DOXH ſʰƀ6FKRRO7D[DEOH9DOXH ſʰƀ7D[DEOH9DOXH ,IDOO9DOXHVVKRZQDERYHHTXDOWKLVSDUFHOZDVFUHDWHGDIWHUWKH)LQDO7D[5ROO £ 9.A.2.d Packet Pg. 168 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann &ROOLHU&RXQW\3URSHUW\$SSUDLVHU3URSHUW\6XPPDU\ 3DUFHO1R 6LWH$GGUHVV 'LVFODLPHU 6LWH&LW\6LWH=RQH 1RWH 1DPH$GGUHVV%$<6+25(3$5&(///& 7+$9(667( &LW\1$3/(6 6WDWH )/=LS 0DS1R 6WUDS1R 6HFWLRQ 7RZQVKLS 5DQJH $FUHV£ (VWLPDWHG $ $ /HJDO 1*7&/)12/27$&253*253*253* 0LOODJH$UHD0LOODJH5DWHV£ &DOFXODWLRQV 6XE&RQGR 1* 7&/)81,76FKRRO 2WKHU 7RWDO 8VH&RGH9$&$175(6,'(17,$/ /DWHVW6DOHV+LVWRU\ 1RWDOO6DOHVDUHOLVWHGGXHWR&RQILGHQWLDOLW\ 'DWH %RRN3DJH $PRXQW £&HUWLILHG7D[5ROO 6XEMHFWWR&KDQJH /DQG9DOXH ſʫƀ,PSURYHG9DOXH ſʰƀ0DUNHW9DOXH ſʰƀ$VVHVVHG9DOXH ſʰƀ6FKRRO7D[DEOH9DOXH ſʰƀ7D[DEOH9DOXH ,IDOO9DOXHVVKRZQDERYHHTXDOWKLVSDUFHOZDVFUHDWHGDIWHUWKH)LQDO7D[5ROO £ 9.A.2.d Packet Pg. 169 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann &ROOLHU&RXQW\3URSHUW\$SSUDLVHU3URSHUW\6XPPDU\ 3DUFHO1R 6LWH$GGUHVV 'LVFODLPHU 6LWH&LW\6LWH=RQH 1RWH 1DPH$GGUHVV%$<6+25(3$5&(///& 7+$9(667( &LW\1$3/(6 6WDWH )/=LS 0DS1R 6WUDS1R 6HFWLRQ 7RZQVKLS 5DQJH $FUHV£ (VWLPDWHG $ $ /HJDO 1*7&/)12/276$& 0LOODJH$UHD0LOODJH5DWHV£ &DOFXODWLRQV 6XE&RQGR 1* 7&/)81,76FKRRO 2WKHU 7RWDO 8VH&RGH$&5($*(127=21('$*5,&8/785$/ /DWHVW6DOHV+LVWRU\ 1RWDOO6DOHVDUHOLVWHGGXHWR&RQILGHQWLDOLW\ 'DWH %RRN3DJH $PRXQW £&HUWLILHG7D[5ROO 6XEMHFWWR&KDQJH /DQG9DOXH ſʫƀ,PSURYHG9DOXH ſʰƀ0DUNHW9DOXH ſʰƀ$VVHVVHG9DOXH ſʰƀ6FKRRO7D[DEOH9DOXH ſʰƀ7D[DEOH9DOXH ,IDOO9DOXHVVKRZQDERYHHTXDOWKLVSDUFHOZDVFUHDWHGDIWHUWKH)LQDO7D[5ROO £ 9.A.2.d Packet Pg. 170 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 'HWDLOE\(QWLW\1DPH VHDUFKVXQEL]RUJ,QTXLU\&RUSRUDWLRQ6HDUFK6HDUFK5HVXOW'HWDLO"LQTXLU\W\SH (QWLW\1DPH GLUHFWLRQ7\SH ,QLWLDO VHDUFK1DPH2UGHU %$<6+25(3$5« 'HSDUWPHQWRI6WDWH'LYLVLRQRI&RUSRUDWLRQV6HDUFK5HFRUGV'HWDLO%\'RFXPHQW1XPEHU 'ඞඑඛඑ඗ඖ඗ඎ&඗ක඘඗ක ගඑ඗ඖඛ)ORULGD'HSDUWPHQWRI6WDWH 9.A.2.d Packet Pg. 171 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 'HWDLOE\(QWLW\1DPH VHDUFKVXQEL]RUJ,QTXLU\&RUSRUDWLRQ6HDUFK6HDUFK5HVXOW'HWDLO"LQTXLU\W\SH (QWLW\1DPH GLUHFWLRQ7\SH ,QLWLDO VHDUFK1DPH2UGHU %$<6+25(3$5« 'RFXPHQW1XPEHU )(,(,11XPEHU 'DWH)LOHG (IIHFWLYH'DWH 6WDWH 6WDWXV 'HWDLOE\(QWLW\1DPH )ORULGD/LPLWHG/LDELOLW\&RPSDQ\ %$<6+25(3$5&(///& )LOLQJ,QIRUPDWLRQ / 121( )/ $&7,9( 3ULQFLSDO$GGUHVV 7+$9(18(6287+ 68,7( 1$3/(6)/ 0DLOLQJ$GGUHVV 7+$9(18(6287+ 68,7( 1$3/(6)/ 5HJLVWHUHG$JHQW1DPH $GGUHVV 72%,1-2$1) 7+$9(18(6287+ 68,7( 1$3/(6)/ $XWKRUL]HG3HUVRQV'HWDLO 1DPH $GGUHVV 7LWOH0*5 72%,1-2$1) 7+$9(18(6287+ 1$3/(6)/ $QQXDO5HSRUWV 1R$QQXDO5HSRUWV)LOHG 'RFXPHQW,PDJHV )ORULGD/LPLWHG/LDELOLW\9LHZLPDJHLQ3')IRUPDW )ORULGD'HSDUWPHQWRI6WDWH'LYLVLRQRI&RUSRUDWLRQV 9.A.2.d Packet Pg. 172 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann WZKWZdzKtEZ^,/W /^>K^hZ 9.A.2.d Packet Pg. 173 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 174 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 175 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 176 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann WZͲWW>/d/KEDd/E' EKd^ 9.A.2.d Packet Pg. 177 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 hƉĚĂƚĞĚϳͬϭϭͬϮϬϭϵWĂŐĞͮϭŽĨϱ Pre-Application Meeting Notes Petition Type: ___________________________ Date and Time: ___________________________ Assigned Planner: ____________________________________________________________ Engineering Manager (for PPL’s and FP’s): _______________________________________ Project Information Project Name: _________________________________________________________________ PL #: _________________________________________________________________________ Property ID #: ______________________ Current Zoning: _____________________________ Project Address: __________________ City: ___________ State: _____ Zip: _______________ Applicant: ____________________________________________________________________ Agent Name: _BBBBBBBBBBBBBBB________________ Phone: ___________________________ Agent/Firm Address: _________________________ City: __________ State: _____ Zip: ______ Property Owner: _______________________________________________________________ Please provide the following, if applicable: i.Total Acreage: ____________ ii.Proposed # of Residential Units: ____________ iii.Proposed Commercial Square Footage: ____________ iv.For Amendments, indicate the original petition number: _________________________ v.If there is an Ordinance or Resolution associated with this project, please indicate the type and number: _________________________________________________________ vi.If the project is within a Plat, provide the name and AR#/PL#: ____________________ ________________________________________________________________________ PUDA Timothy Finn PL20190002305 61838120007 RSF-3 & A FL Barraco & Associates,Inc.(239)461-3170 Suite 100 Fort FL Bayshore Parcel, LLC Wednesday,10/23/19,1:30PM 61838201007,61838200008,61838160009,61838080008 Jennifer Sapen 2271 McGregor Blvd. Meyers Fleischmann Parcel c/o Jennifer Sapen 33901 Naples 9.A.2.d Packet Pg. 178 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 179 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 180 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 181 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 182 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 183 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 184 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 185 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 186 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 187 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 188 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 189 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 190 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 191 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Applicant/Agent may also send site plans or conceptual plans for review in advance if desired. PL20190002305 – Fleischmann Parcel (PUDA) - PRE-APP INFO ƐƐŝŐŶĞĚKƉƐ^ƚĂĨĨ͗ůůĞŶDƵƌƌĂǇ ĂŵĚĞŶ^ŵŝƚŚ͕;KƉƐ^ƚĂĨĨͿ xName and Number of who submitted pre-app request :ĞŶŶŝĨĞƌ^ĂƉĞŶͬ;ϮϯϵͿϰϲϭͲϯϭϳϬͬ:ĞŶŶŝĨĞƌ^ΛĂƌƌĂĐŽ͘ŶĞƚ xAgent to list for PL# ĂƌƌĂĐŽĂŶĚƐƐŽĐŝĂƚĞƐ͕/ŶĐ͘ĐͬŽ:ĞŶŶŝĨĞƌ^ĂƉĞŶ xOwner of property (all owners for all parcels) ĂǇƐŚŽƌĞWĂƌĐĞů͕>> xConfirm Purpose of Pre-App: (Rezone, etc.) ZĞǌŽŶĞ&ůĞŝƐĐŚŵĂŶŶƉĂƌĐĞůƚŽďĞƉĂƌƚŽĨ^ĂďĂůĂǇWhĂŶĚĂĚĚĚĞŶƐŝƚǇ͘ xPlease list the density request of the project if applicable and number of homes/units/offices/docks (any that apply):ĞƐĐƌŝďĞƚŚĞƉƌŽũĞĐƚŚĞƌĞ͘WƌŽǀŝĚĞĚĞƚĂŝůƐŚĞƌĞ͕ƐŽƚŚĂƚƐƚĂĨĨŵĂǇďĞďĞƚƚĞƌƉƌĞƉĂƌĞĚƚŽĂĚĚƌĞƐƐƌĞůĂƚŝǀĞ ŝŶĨŽƌŵĂƚŝŽŶ͘ ƉƉůŝĐĂŶƚǁŽƵůĚůŝŬĞƚŽĂĚĚϮϯϬĚǁĞůůŝŶŐƵŶŝƚƐĂŶĚцϭϬϮ͘ϰϵĂĐƌĞƐƚŽƚŚĞ^ĂďĂůĂǇDWh͘dŚĞƐƵďũĞĐƚ ƉƌŽƉĞƌƚǇĂďƵƚƐƚŚĞ^ĂďĂůĂǇDWhƚŽƚŚĞŶŽƌƚŚ͕ĞĂƐƚ͕ĂŶĚƐŽƵƚŚ͘ xDetails about Project: PUD-AʹŝƐƚŚŝƐĂƉŚĂƐĞĚĚĞǀĞůŽƉŵĞŶƚĂŶĚŝĨƐŽ͕ǁŚĂƚƐĐŚĞĚƵůĞŝƐďĞŝŶŐƉƌŽƉŽƐĞĚ͍/ƐƚŚĞƉƌŽƉŽƐĂůĨŽƌĂƐƉĞĐŝĨŝĐ dƌĂĐƚŽƌĂĚĚŝƚŝŽŶŽĨĂdƌĂĐƚͬhƐĞ͍ hŶŬŶŽǁŶĂƚƚŚŝƐƚŝŵĞ͘dŚĞƐƵďũĞĐƚƉƌŽƉĞƌƚǇŝƐĐŽŵƉŽƐĞĚŽĨĨŝǀĞƐĞƉĂƌĂƚĞƉĂƌĐĞůƐ͗ϲϭϴϯϴϮϬϭϬϬϳ͕ ϲϭϴϯϴϮϬϬϬϬϴ͕ϲϭϴϯϴϭϲϬϬϬϵ͕ϲϭϴϯϴϭϮϬϬϬϳ͕ĂŶĚϲϭϴϯϴϬϴϬϬϬϴƚŽƚĂůŝŶŐцϭϬϮ͘ϰϵĂĐƌĞƐ͘ REQUIRED Supplemental Information provided by: Name: Dawn Russell Title: Land Planner Email: DawnR@Barraco.net Phone: (239) 461-3170 Cancellation/Reschedule Requests: Contact Danny Condomina-Client Services Supervisor danny.condomina@colliercountyfl Phone: 239-252-6866 STAFF FORM FOR SUPPLEMENTAL PRE-APPLICATION MEETING INFORMATION 9.A.2.d Packet Pg. 192 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 193 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann S89°32'19"W648.48'(C)S89°32'10"W673.65'(C)N00°19'45"E1344.09'(C)N00°20'11"EN00°43'16"W1344.00'(C)1348.91'(C)N89°30'51"E1321.26'(C)S00°44'12"E1349.42'(C)S00°19'19"W2688.11'(C)AREA = 102.49 Ac. +/-Lot 91Lot 71Lot 73Lot 90Lot 89Lot 74Lot 88Lot 87Lot 75Lot 76Lot 86Lot 85Lot 77Lot 84Lot 83Lot 80SW 1/4 of SE 1/4 of NE 1/4Lot2Lot1Lot3Lot53Lot54Lot55Lot5624252623Section24Section23Section25Section26SectionLineSectionLineSectionLine1/4SectionLine1/4-1/4SectionLine1/4-1/4SectionLineTownship 50 South,Range 25 EastSection 23Township50South,Range25EastSection26NE 1/4SE 1/4(P.B. 1, PG. 27A, C.C.R.)"Naples Groves and TruckCo's Little Farms No. 2"Lot 82Lot 81Lot 78Lot 79SW 1/4 of NE 1/4"Holly Terrace"(P.B. 4, PG. 64, C.C.R.)HollyAvenue(P)25'(P)25'(P)50'(P)50'(P)30'(P)25'(P)25'(P)25'(P)25'(P)RIGHTOFWAYLINE(P)RIGHTOFWAYLINE(P)RIGHTOFWAYLINE(P)(O.R. 4856, PG. 233, C.C.R.)61838201007ALEXIAN ENTERPRISES LLC(O.R. 4856, PG. 233, C.C.R.)61838200008ALEXIAN ENTERPRISES LLC(O.R. 4856, PG. 233, C.C.R.)61838160009ALEXIAN ENTERPRISES LLC(O.R. 4856, PG. 233, C.C.R.)61838120007ALEXIAN ENTERPRISES LLC(O.R. 4856, PG. 233, C.C.R.)61838080008ALEXIAN ENTERPRISES LLC(O.R. 5199, PG. 3180, C.C.R.)61838040006LARRY & MARJI POMPOSINI(O.R. 4870, PG. 318, C.C.R.)00395560307MINTO SABAL BAY, LLC(O.R. 4870, PG. 318, C.C.R.)00395560307MINTO SABAL BAY, LLC(O.R. 4870, PG. 318, C.C.R.)61838240000MINTO SABAL BAY, LLCWAYANTIGUATract"F"Tract"L"9089099109119129139149159 1 6917 930931968969Tract"L"Tract"L"Road(P)CountyDriveBayshoreSEESHEET3SEESHEET2"Isles of Collier Preserve Phase 12"(P.B. 64, PG. 64, C.C.R.)0 100 200 400SCALE IN FEETLEGEND:('7B.M. BENCHMARK(C) CALCULATEDCCR# CERTIFIED CORNERRECORDC.M.R. COLLIER COUNTYRECORDSC/L CENTER LINECONC. CONCRETECB= CHORD BEARING=CD= CHORD DISTANCE=CH= CHORD BEARING &DISTANCE=C.M. CONCRETEMONUMENTCOR. CORNERC.U.E. COUNTY UTILITYEASEMENTΔ= DELTA OR CENTRALANGLE=(D) DEEDD.B. DEED BOOKEL. ELEVATION(F) FIELDFD. FOUNDF.D.O.T. FLORIDADEPARTMENT OFTRANSPORTATIONF.P. & L. FLORIDA POWER &LIGHT CO.FRAC. FRACTIONI.E. IRRIGATIONEASEMENTI.P. IRON PIPEI.R. IRON RODL= LENGTHLB LICENSED BUSINESSL.B.E. LANDSCAPE BUFFEREASEMENTL.M.E. LAKE MAINTENANCEEASEMENT(M) MEASUREDO.R. OFFICIAL RECORDBOOK(P) PLATP.B. PLAT BOOKP.C. POINT OF CURVATUREPG. PAGEP.K. PARKER-KALONP.R.M. PERMANENTREFERENCEMONUMENTPROP. PROPERTYP.V.C. PLASTIC PIPER= RADIUS=R.C.P. REINFORCEDCONCRETE PIPEREF. REFERENCER/W RIGHT OF WAYTYP. TYPICALSEC. SECTIONW/ WITHWIT. WITNESS69:9$5662%,5:&$ 799,0)*9*SET "MAG" NAIL WITH DISC STAMPED LB6940SET 1/2" IRON ROD WITH CAP STAMPED LB6940SET 4"x4" CONC. MONUMENT STAMPED LB6940FOUND NAIL AS NOTEDFOUND CONC. MONUMENT AS NOTEDFOUND IRON PIPE OR IRON ROD AS NOTEDDRAINAGE INLETDRAINAGE MANHOLEMITERED END SECTIONYARD DRAINLIGHT POLEFLOOD LIGHTCONCRETE POWER POLEWOOD POWER POLEGUY ANCHORTELEPHONE BOXELECTRIC BOXCABLE TV BOXWATER VALVEWATER BOXFIRE HYDRANTBACK FLOW ASSEMBLYAIR RELEASE VALVEIRRIGATION VALVEIRRIGATION SERVICEWELLSANITARY MANHOLESANITARY SERVICESIGNMAIL BOXBLOW OFFFIBER OPTIC CABLE MARKERGAS LINE MARKERGAS VALVEFLORIDA PLANE(EAST ZONE)COORDINATE SYSTEMNAD 1983(NSRS2007)NDESCRIPTION (PER TITLE COMMITMENT)Lots 81 through 90, inclusive, Naples Groves and Truck Company's Little Farms No.2, according tothe plat thereof as recorded in Plat Book 1, Page 27A, Public Records of Collier County, Florida.1. DATE OF LAST FIELD WORK: AUGUST 15, 2019.2. THIS SURVEY DOES NOT MAKE ANY REPRESENTATION AS TO ZONING ORDEVELOPMENT RESTRICTIONS ON SUBJECT PARCEL.3. THIS SURVEY WAS PERFORMED FOR THE PURPOSE SHOWN HEREON AND DOESNOT MAKE ANY REPRESENTATION AS TO THE DELINEATION OF ANY JURISDICTIONALLINES EXCEPT AS SHOWN OR NOTED HEREON.4. NO ENVIRONMENTAL ASSESSMENT OR AUDIT WAS PERFORMED ON SUBJECTPARCEL BY THIS FIRM.5. ALL DISTANCES SHOWN ARE IN FEET AND DECIMALS THEREOF. UNLESS OTHERWISENOTED DISTANCES ARE ALSO (U.S. SURVEY FEET) GROUND AND CAN BE MULTIPLIEDBY 1.000011796 TO OBTAIN GRID DISTANCES.6. BEARINGS AND COORDINATES HEREON ARE STATE PLANE FLORIDA EAST ZONE(NAD1983 (NSRS 2007)) AND ARE BASED THE EAST LINE OF THE SOUTHEASTQUARTER (SE 1/4) OF SECTION 26 TO BEAR S00°19'19"W.7. IMPROVEMENTS OTHER THAN THOSE SHOWN IF ANY WERE NOT LOCATED.8. THERE ARE NO VISIBLE ENCROACHMENTS OTHER THAN THOSE SHOWN.9. OWNERSHIP OF ANY FENCE SHOWN HEREON IS UNKNOWN.10. ACCORDING TO F.I.R.M. No. 12021C0584H, MAP REVISED: MAY 16, 2012, THEPROPERTY IS LOCATED IN FLOOD ZONE AE (EL 6).11. THIS SURVEY WAS PREPARED IN ACCORDANCE WITH A AMERICAN LAND TITLECOMMITMENT PREPARED BY: OLD REPUBLIC NATIONAL TITLE INSURANCE COMPANY,COMMITMENT No. 737911, COMMITMENT DATE: JUNE 17, 2019 AT 11:00 PM.12. THE SURVEYED PARCEL CONTAINS 102.49 ACRES, MORE OR LESS.13. ELEVATIONS SHOWN ARE IN FEET ABOVE NORTH AMERICAN VERTICAL DATUM 1988AND ARE BASED ON A LEVEL LOOP BY THIS FIRM FROM NATIONAL GEODETICSURVEY BENCH MARK "Q 249" (PID=AD1229)(ELEVATION =4.73').NOTES:DATE SIGNED:THIS SURVEY IS FOR THE BENEFIT OF:OLD REPUBLIC NATIONAL TITLE INSURANCE COMPANYMINTO COMMUNITIES, LLCBAYSHORE PARCEL, LLCSHUTTS & BOWEN LLPTHOMPSON LEWIS LAW FIRM, PLLCI HEREBY CERTIFY THAT THIS SURVEY WAS DONE UNDER MY DIRECTION ANDSUPERVISION AND MEETS THE STANDARDS OF PRACTICE AS PER CHAPTER5J-17.050 THRU 052 F.A.C. PURSUANT TO CHAPTER 472.027, FLORIDA STATUTES.NOT VALID WITHOUT THE SIGNATURE AND THE ORIGINAL RAISED SEAL OF AFLORIDA LICENSED SURVEYOR AND MAPPER.SCOTT A. WHEELER (FOR THE FIRM - LB-6940)PROFESSIONAL SURVEYOR AND MAPPERFLORIDA CERTIFICATE NO.5949SHEET NUMBERPLAN REVISIONSSTRAP NUMBERSPROJECT / FILE NO.SCALEFIELD BOOKCHECKED BYDRAWN BYSURVEY DATEDRAWING DATA1 OF 3BOUNDARYSURVEY2378023-50-2508-15-2019P. OLSENSAW1"=200'6183808000861838160009618381200076183820000861838201007),/(1$0(/2&$7,213/27'$7(6':*-??':*?6859(<,1*?)5,$0/$<2873/27%< &+5,6(//,60F*5(*25%/9'68,7(32672)),&('5$:(5)2570<(56)/25,'$3+21()$;&,9,/(1*,1((5,1*/$1'6859(<,1*/$1'3/$11,1*)/25,'$&(57,),&$7(62)$87+25,=$7,21(1*,1((5,1*6859(<,1*/%35(3$5(')25352-(&7'(6&5,37,21A SUBDIVISION LYING INSECTIONS 14, 23 AND 26,TOWNSHIP 50 SOUTH,RANGE 25 EAST,COLLIER COUNTY, FLORIDAPLAT BOOK 1, PAGE 27,COLLIER COUNTY RECORDSNaples Grovesand Truck Co’sLittle Farms No. 2LOTS 81 THROUGH 90 OF THERECORD PLAT0,172&20081,7,(686$3$5.2$.6%28/(9$5'68,7(7$03$)/:::0,172&20)$;3+21(352-(&76859(<251279$/,':,7+2877+(6,*1$785($1'7+(25,*,1$/5$,6('6($/2)$)/25,'$/,&(16('6859(<25$1'0$33(5/,&(16(18(5 67$7(2)352)(6 6 ,2 1$/6859(<25'0$33(56&277$:+((/(5 )/25,'$0%1$THE PROPERTY IS AFFECTED AS NOTED BY THE FOLLOWING ITEMS FROMSCHEDULE B2 OF THE TITLE COMMITMENT AS FOLLOWS:6. All matters contained on the Plat of Naples Groves and Truck Company's Little FarmsNo. 2, as recorded in Plat Book l, Page 27 A, Public Records of Collier County,Florida. (AFFECTS PROPERTY, SHOWN)7. Easement in favor of United Telephone Company of Florida recorded in OfficialRecords Book 1010, Page 268, Public Records of Collier County, Florida. (DOESNOT AFFECT PROPERTY, NOT SHOWN)9. Resolution No. 88-230 recorded in Official Records Book 1384, Page 570, PublicRecords of Collier County, Florida. (AFFECTS ALL OF LOT 90 OF PLAT, NOTSHOWN)SURVEY RELATED ITEMS FROM SCHEDULE B-2:9.A.2.d Packet Pg. 194 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann ;SLot 91Lot 71Lot 73Lot 90Lot 89Lot 74Lot 88Lot 87Lot 75Lot 76Lot 86Lot 85Lot 77Lot 84Lot2Lot1Lot54Lot55Lot5624252623Section23Section24SectionLineSectionLine1/4-1/4SectionLineTownship 50 South,Range 25 EastSection 23SE 1/4(P.B. 1, PG. 27A, C.C.R.)"Naples Groves and Truck Co's Little Farms No. 2"Lot 78"Holly Terrace"(P.B. 4, PG. 64, C.C.R.)HollyAvenue(P)50'(P)30'(P)25'(P)25'(P)RIGHTOFWAYLINE(P)RIGHTOFWAYLINE(P)(O.R. 4856, PG. 233, C.C.R.)61838201007ALEXIAN ENTERPRISES LLC(O.R. 4856, PG. 233, C.C.R.)61838200008ALEXIAN ENTERPRISES LLC(O.R. 4856, PG. 233, C.C.R.)61838160009ALEXIAN ENTERPRISES LLC(O.R. 4856, PG. 233, C.C.R.)61838120007ALEXIAN ENTERPRISES LLC(O.R. 4870, PG. 318, C.C.R.)61838240000MINTO SABAL BAY, LLCTract"F"(FUTUREDEVELOPMENT)(P)CountyDriveBayshoreTract"L"(LAKE,L.M.E.&D.E.)(P)"Isles of Collier Preserve Phase 12"(P.B. 64, PG. 64, C.C.R.)(O.R. 4856, PG. 233, C.C.R.)61838080008ALEXIAN ENTERPRISES LLCRoad(P)(UNIMPROVED)(INTERIOR FENCES & INTERIOR IMPROVEMENTS OTHER THAN THOSE SHOWN WERE NOT LOCATED)SectionLineSection23Section14Section23Section22Section26Section23Township50South,Range25EastSection26NE 1/4NW 1/4SW 1/4NE 1/4S00°44'12"E1349.42'(C)N89°30'51"E1321.26'(C)N00°43'16"WN00°20'11"E1348.91'(C)NOTE:THE CONCRETE WALK,LIGHT POLES AND GUY ANCHORSFALL WITHIN THESURVEYED PROPERTY.S00°19'19"W2688.11'(C)1344.00'(C)S89°32'28"W2693.26'(C)S00°44'12"E2698.83'(C)N00°42'19"W5404.37'(C)N89°29'14"E5358.05'(C)S00°43'16"E2697.56'(C)(1/4SEC.COR.TOSEC.COR.)(1/4SEC.COR.TO1/4SEC.COR.)1349.42'(C)(1/4SEC.COR.TO1/4SEC.COR.)1345.89'(C)1345.89'(C)2666.27'(C)2708.08'(C)2696.29'(C)(SEC.COR.TO1/4SEC.COR.)1346.63'(C)1346.63'(C)S00°20'11"W2688.24'(C)(1/4-1/4SEC.COR.TO1/4-1/4SEC.COR.)N89°31'15"E1321.35'(C)N89°31'39"E1321.45'(C)N89°32'04"E1321.54'(C)N89°32'26"E1321.71'(C)N89°32'23"E1321.80'(C)(LOT86/87)CORNER AT BISECTORNOT ON SECTION LINE1321.63'(C)0.12'(C)(COR.TOSEC.LINE)336.01'(C)336.01'(C)337.35'(C)337.35'(C)337.35'(C)337.35'(C)337.20'(C)337.20'(C)337.20'(C)337.20'(C)335.91'(C)336.03'(C)335.70'(P)1341.00'(P)1341.00'(P)1341.00'(P)1341.00'(P)1341.00'(P)1341.00'(P)1341.00'(P)335.70'(P)335.70'(P)335.70'(P)335.70'(P)334.50'(P)334.50'(P)334.50'(P)334.50'(P)335.70'(P)335.70'(P)335.70'(P)FD. "MAG" NAIL W/DISK"LB 6940 PRM"FD. 1/2" I.R.(NO CAP)FD. 1/2" I.R.(NO CAP)FD. R.R. SPIKENORTH 1/4 SEC. 23)(CCR#20768)FD. 3/4" I.P. (W/ 1/2" I.R. IN CENTER)0.08' N. & 0.13' E. OF C/L x SEC. LINEFD. 4"x4" C.M.(W/ 3/4" PIPE BROKEN)SOUTH 1/4 COR. SEC. 23FD. 3"x3" C.M.(DISK STAMPED 22-23)WEST 1/4 COR. SEC. 23FD. 4"x 4" C.M. (W/ 5/8" I.R.)E 1/4 COR. COR. SEC. 23(CCR#22088)FD. 4"x 4" C.M. (DESTROYED)SET 1/2" I.R. "LB 6940"SOUTHEAST COR. SEC. 23(CCR#22075)SET 1/2" I.R. "LB6940"N=640682.13(Y)E=403469.99(X)N=642030.95(Y)E=403453.01(X)N=642042.15(Y)E=404774.25(X)N=646075.29(Y)E=402031.84(X)N=643343.51(Y)E=399398.98(X)N=643391.47(Y)E=404756.89(X)N=640692.83(Y)E=404791.60(X)N=640671.26(Y)E=402098.38(X)Overhead Utility Line5.8'(toGuy)Sidewalk10'(toGuy)5'5'PavementLEGEND:'B.M. BENCHMARK(C) CALCULATEDCCR# CERTIFIED CORNER RECORDC.M.R. COLLIER COUNTY RECORDSC/L CENTER LINECONC. CONCRETECB= CHORD BEARING=CD= CHORD DISTANCE=CH= CHORD BEARING & DISTANCE=C.M. CONCRETE MONUMENTCOR. CORNERC.U.E. COUNTY UTILITY EASEMENTΔ= DELTA OR CENTRAL ANGLE=(D) DEEDD.B. DEED BOOKEL. ELEVATION(F) FIELDFD. FOUNDF.D.O.T. FLORIDA DEPARTMENT OFTRANSPORTATIONF.P. & L. FLORIDA POWER & LIGHT CO.FRAC. FRACTIONI.E. IRRIGATION EASEMENTI.P. IRON PIPEI.R. IRON RODL= LENGTHLB LICENSED BUSINESSL.B.E. LANDSCAPE BUFFEREASEMENTL.M.E. LAKE MAINTENANCEEASEMENT(M) MEASUREDO.R. OFFICIAL RECORD BOOK(P) PLATP.B. PLAT BOOKP.C. POINT OF CURVATUREPG. PAGEP.K. PARKER-KALONP.R.M. PERMANENT REFERENCEMONUMENTPROP. PROPERTYP.T. POINT OF TANGENCYP.V.C. PLASTIC PIPER= RADIUS=R.C.P. REINFORCED CONCRETE PIPEREF. REFERENCER/W RIGHT OF WAYTYP. TYPICALSEC. SECTIONW/ WITHWIT. WITNESS(9:7:&$ 79SET "MAG" NAIL WITH DISC STAMPED LB6940SET 1/2" IRON ROD WITH CAP STAMPED LB6940SET 4"x4" CONC. MONUMENT STAMPED LB6940FOUND NAIL AS NOTEDFOUND CONC. MONUMENT AS NOTEDFOUND IRON PIPE OR IRON ROD AS NOTEDDRAINAGE INLETDRAINAGE MANHOLEMITERED END SECTIONYARD DRAINLIGHT POLEFLOOD LIGHTCONCRETE POWER POLEWOOD POWER POLEGUY ANCHORTELEPHONE BOXELECTRIC BOXCABLE TV BOXWATER VALVEWATER BOXFIRE HYDRANTBACK FLOW ASSEMBLYAIR RELEASE VALVEIRRIGATION VALVEIRRIGATION SERVICEWELLSANITARY MANHOLESANITARY SERVICESIGNMAIL BOXBLOW OFFFIBER OPTIC CABLE MARKERGAS LINE MARKERGAS VALVE69$5662%,59,0)*9*SHEET NUMBERPLAN REVISIONSSTRAP NUMBERSPROJECT / FILE NO.SCALEFIELD BOOKCHECKED BYDRAWN BYSURVEY DATEDRAWING DATA2 OF 3BOUNDARYSURVEY2378023-50-2508-15-2019P. OLSENSAW1"=100'),/(1$0(/2&$7,213/27'$7(6':*-??':*?6859(<,1*?)5,$0/$<2873/27%< &+5,6(//,60F*5(*25%/9'68,7(32672)),&('5$:(5)2570<(56)/25,'$3+21()$;&,9,/(1*,1((5,1*/$1'6859(<,1*/$1'3/$11,1*)/25,'$&(57,),&$7(62)$87+25,=$7,21(1*,1((5,1*6859(<,1*/%35(3$5(')25352-(&7'(6&5,37,21A SUBDIVISION LYING INSECTIONS 14, 23 AND 26,TOWNSHIP 50 SOUTH,RANGE 25 EAST,COLLIER COUNTY, FLORIDAPLAT BOOK 1, PAGE 27,COLLIER COUNTY RECORDSNaples Grovesand Truck Co’sLittle Farms No. 2LOTS 81 THROUGH 90 OF THERECORD PLAT0,172&20081,7,(686$3$5.2$.6%28/(9$5'68,7(7$03$)/:::0,172&20)$;3+21(352-(&76859(<251279$/,':,7+2877+(6,*1$785($1'7+(25,*,1$/5$,6('6($/2)$)/25,'$/,&(16('6859(<25$1'0$33(5/,&(16(18(5 67$7(2)352)(6 6 ,2 1$/6859(<25'0$33(56&277$:+((/(5 )/25,'$0%1$SEESHEET30 50 100 200SCALE IN FEETFLORIDA PLANE(EAST ZONE)COORDINATE SYSTEMNAD 1983(NSRS2007)N9.A.2.d Packet Pg. 195 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Lot 85Lot 84Lot 83Lot 80SW 1/4 of SE 1/4 of NE 1/4Section26Section25SectionLine1/4SectionLine1/4-1/4SectionLineTownship50South,Range25EastSection26NE 1/4Lot 82Lot 81Lot 78Lot 79SW 1/4 of NE 1/425'(P)25'(P)50'(P)25'(P)25'(P)RIGHTOFWAYLINE(P)(O.R. 4856, PG. 233, C.C.R.)61838080008ALEXIAN ENTERPRISES LLC(O.R. 5199, PG. 3180, C.C.R.)61838040006LARRY & MARJI POMPOSINI(O.R. 4870, PG. 318, C.C.R.)00395560307MINTO SABAL BAY, LLC(O.R. 4870, PG. 318, C.C.R.)00395560307MINTO SABAL BAY, LLCTract"L"(LAKE,L.M.E.&D.E.)(P)Road(P)"Isles of Collier Preserve Phase 12"(P.B. 64, PG. 64, C.C.R.)(O.R. 4856, PG. 233, C.C.R.)61838080008ALEXIAN ENTERPRISES LLCCountyDriveBayshore(UNIMPROVED)(P.B. 1, PG. 27A, C.C.R.)"Naples Groves and Truck Co's Little Farms No. 2"(INTERIOR FENCES & INTERIOR IMPROVEMENTS OTHER THAN THOSE SHOWN WERE NOT LOCATED)Section26Section23Section26Section27Section35Section26SE 1/4SW 1/4NW 1/4S00°19'19"W2688.11'(C)S89°32'19"WN00°19'45"ES89°32'10"W673.65'(C)1344.09'(C)648.48'(C)N00°20'11"E1344.00'(C)N00°21'03"E5375.10'(C)S89°32'10"W5389.90'(C)S00°20'11"W2688.24'(C)(1/4SEC.COR.TO1/4SEC.COR.)(1/4SEC.COR.TO1/4SEC.COR.)(1/4-1/4SEC.COR.TO1/4-1/4SEC.COR.)1347.31'(C)1347.31'(C)2688.37'(C)2686.73'(C)2695.29'(C)N89°32'23"E1321.80'(C)N89°32'21"E1321.88'(C)N89°32'19"E1321.97'(C)N89°32'14"E673.57'(C)672.04'(C)672.04'(C)672.03'(C)672.03'(C)336.01'(C)336.01'(C)336.03'(C)336.03'(C)673.48'(C)670.50'(P)1341.00'(P)1341.00'(P)1341.00'(P)670.50'(P)670.50'(P)669.00'(P)669.00'(P)669.00'(P)669.00'(P)334.50'(P)334.50'(P)334.50'(P)334.50'(P)WEST 1/4 COR. SEC. 26(CCR#22082)SOUTH 1/4 COR.SEC. 26(CCR#22077)FD. 5/8" I.R. "LB 43 WILSON MILLER"0.07' E. OF PROP. COR.FD. 4"x4" C.M. (W/ 1/2" I.R.)0.06' E. OF C/LFD. 4"x4" C.M. (W/ 1/2" I.R.)0.35' E. OF 1/4-1/4 SEC. LINEFD. 4"x4" C.M. (W/ 1/2" I.R.)0.11' N. & 0.07' E. OF PROP. COR.FD. 5/8" I.R. "LB43"0.18' W. OF PROP. COR.FD. 3.5"x3.5" C.M.(TOP BROKEN)EAST 1/4 COR. SEC. 26(CCR #0022081)SET 1/2" I.R. "LB6940"FD. 1" I.R. 0.15' S. & 1.42' E.OF PROP. COR.SET 1/2" I.R. "LB6940"FD. 4"x4" C.M.(W/ 3/4" PIPE BROKEN)SOUTH 1/4 COR. SEC. 23N=637999.27(Y)E=404102.85(X)N=639343.35(Y)E=404110.57(X)N=639338.13(Y)E=403462.10(X)N=637961.07(Y)E=399386.68(X)N=635296.19(Y)E=402065.48(X)N=640671.26(Y)E=402098.38(X)N=638004.73(Y)E=404776.49(X)LEGEND:'B.M. BENCHMARK(C) CALCULATEDCCR# CERTIFIED CORNER RECORDC.M.R. COLLIER COUNTY RECORDSC/L CENTER LINECONC. CONCRETECB= CHORD BEARING=CD= CHORD DISTANCE=CH= CHORD BEARING & DISTANCE=C.M. CONCRETE MONUMENTCOR. CORNERC.U.E. COUNTY UTILITY EASEMENTΔ= DELTA OR CENTRAL ANGLE=(D) DEEDD.B. DEED BOOKEL. ELEVATION(F) FIELDFD. FOUNDF.D.O.T. FLORIDA DEPARTMENT OFTRANSPORTATIONF.P. & L. FLORIDA POWER & LIGHT CO.FRAC. FRACTIONI.E. IRRIGATION EASEMENTI.P. IRON PIPEI.R. IRON RODL= LENGTHLB LICENSED BUSINESSL.B.E. LANDSCAPE BUFFEREASEMENTL.M.E. LAKE MAINTENANCEEASEMENT(M) MEASUREDO.R. OFFICIAL RECORD BOOK(P) PLATP.B. PLAT BOOKP.C. POINT OF CURVATUREPG. PAGEP.K. PARKER-KALONP.R.M. PERMANENT REFERENCEMONUMENTPROP. PROPERTYP.T. POINT OF TANGENCYP.V.C. PLASTIC PIPER= RADIUS=R.C.P. REINFORCED CONCRETE PIPEREF. REFERENCER/W RIGHT OF WAYTYP. TYPICALSEC. SECTIONW/ WITHWIT. WITNESS(9:7:&$ 79SET "MAG" NAIL WITH DISC STAMPED LB6940SET 1/2" IRON ROD WITH CAP STAMPED LB6940SET 4"x4" CONC. MONUMENT STAMPED LB6940FOUND NAIL AS NOTEDFOUND CONC. MONUMENT AS NOTEDFOUND IRON PIPE OR IRON ROD AS NOTEDDRAINAGE INLETDRAINAGE MANHOLEMITERED END SECTIONYARD DRAINLIGHT POLEFLOOD LIGHTCONCRETE POWER POLEWOOD POWER POLEGUY ANCHORTELEPHONE BOXELECTRIC BOXCABLE TV BOXWATER VALVEWATER BOXFIRE HYDRANTBACK FLOW ASSEMBLYAIR RELEASE VALVEIRRIGATION VALVEIRRIGATION SERVICEWELLSANITARY MANHOLESANITARY SERVICESIGNMAIL BOXBLOW OFFFIBER OPTIC CABLE MARKERGAS LINE MARKERGAS VALVE69$5662%,59,0)*9*SHEET NUMBERPLAN REVISIONSSTRAP NUMBERSPROJECT / FILE NO.SCALEFIELD BOOKCHECKED BYDRAWN BYSURVEY DATEDRAWING DATA3 OF 3BOUNDARYSURVEY2378023-50-2508-15-2019P. OLSENSAW1"=100'),/(1$0(/2&$7,213/27'$7(6':*-??':*?6859(<,1*?)5,$0/$<2873/27%< &+5,6(//,60F*5(*25%/9'68,7(32672)),&('5$:(5)2570<(56)/25,'$3+21()$;&,9,/(1*,1((5,1*/$1'6859(<,1*/$1'3/$11,1*)/25,'$&(57,),&$7(62)$87+25,=$7,21(1*,1((5,1*6859(<,1*/%35(3$5(')25352-(&7'(6&5,37,21A SUBDIVISION LYING INSECTIONS 14, 23 AND 26,TOWNSHIP 50 SOUTH,RANGE 25 EAST,COLLIER COUNTY, FLORIDAPLAT BOOK 1, PAGE 27,COLLIER COUNTY RECORDSNaples Grovesand Truck Co’sLittle Farms No. 2LOTS 81 THROUGH 90 OF THERECORD PLAT0,172&20081,7,(686$3$5.2$.6%28/(9$5'68,7(7$03$)/:::0,172&20)$;3+21(352-(&76859(<251279$/,':,7+2877+(6,*1$785($1'7+(25,*,1$/5$,6('6($/2)$)/25,'$/,&(16('6859(<25$1'0$33(5/,&(16(18(5 67$7(2)352)(6 6 ,2 1$/6859(<25'0$33(56&277$:+((/(5 )/25,'$0%1$SEESHEET20 50 100 200SCALE IN FEETFLORIDA PLANE(EAST ZONE)COORDINATE SYSTEMNAD 1983(NSRS2007)N9.A.2.d Packet Pg. 196 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 197 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 198 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 199 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann &&/s/d^K& hd,KZ/d/KE 9.A.2.d Packet Pg. 200 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 201 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 202 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 203 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 204 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 205 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 206 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Z/>t/d,WZK:d KhEZz 9.A.2.d Packet Pg. 207 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 208 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann E/D/E&KZDd/KEΘy,//d^ 9.A.2.d Packet Pg. 209 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 2271 McGregor Blvd. • Fort Myers, FL 33902 Phone (239) 461-3170 • Fax (239) 461-3169 MEMORANDUM TO:FROM: Laura DeJohn, AICP Dawn Russell COMPANY:DATE: Collier County Growth Management Department August 11, 2020 COPY TO:PROJECT NUMBER: Sabal Bay Minto, LLC PL20190002305 RE: Fleischmann Parcel Rezone to be included into the Sabal Bay MPUD Neighborhood Information Meeting (NIM) As required by LDC, a NIM was held Thursday, July 16th at the Isles of Collier Preserve Clubhouse (Multi-Purpose Room) located at 5570 Tobago Blvd, Naples at 5:30pm. The meeting was publicly advertised with the Naples Daily News and property owner letters were mailed out in June and again in July with zoom instructions. A copy of the News-Press advertisement and property owner letters are included. Three exhibit boards were displayed at the NIM and are included in this submittal. Thirty-five people attended the meeting and 109 people participated by zoom, please see the enclosed NIM participant list/sign-in sheets for details. The NIM lasted 2.5 hours with Q&As following the applicant’s presentation. In addition to the zoom video and recorded audio from the NIM, included with this memo, also provided is the following summary of the issues raised by the meeting attendees and zoom participants followed by the applicant’s responses: (please note that questions received prior to the NIM are addressed in the power point presentation, shown on the zoom video included with this submittal) Summary of Issues Raised 1.Majority of attendee questions were related to ICP’s amenities concerning the current status (some believe the current amenities are already at capacity), whether the developer would be adding or consider adding more, reduced amenity access for existing ICP residents if additional units are added. Also, a couple questions were raised as to whether the developer would improve the sales center by turning it into additional amenities for ICP when they hand it over to the HOA. 2.The second major issue was related to Bayshore Drive traffic. NIM participants raised concerns regarding the amount of increased traffic on Bayshore Drive as a result of the proposed development. There was also concern regarding construction traffic. 3.There were also some drainage and environmental questions posed. 9.A.2.d Packet Pg. 210 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Page 2 Applicant’s Responses 1.Minto commits to evaluate capacity and function of existing and proposed amenities within Isles of Collier Preserve. 2.Minto commits to working with the County on road impacts of heavy trucks/construction vehicles. 3.Along with using internal accessways where feasible, Minto will consider a construction access management plan to regulate impacts to Bayshore Drive. 4.Minto Sabal Bay, LLC’s project engineer will meet with the neighboring 10-acre property owner (Folio #61838040006) and the Water Management District. Attachments: 1.News-Press Affidavit and Published Ad 2.Property Owner Letters 3.Exhibits Displayed at NIM 4.NIM Handout Sample 5.Sign-in Sheets 6.NIM Participant List 7.Zoom Video & Audio Part 1 of 2 8.Zoom Video & Audio Part 2 of 2 9.NIM Email and Phone Correspondence 10.Property Owner List 11.HOAs and Civic Associations List 12.NIM Zoom Procedures 13.NIM Affidavit of Compliance 9.A.2.d Packet Pg. 211 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 212 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 213 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 214 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 8A | MONDAY, JUNE 29, 2020 |NAPLES DAILY NEWS + $89 Plus Free Shipping 7.5-8mm Cultured Pearl Seashell Necklace from Italy 18" rolo chain with a 2" extender. Sterling silver. 1 1ŝ4" wide. Lobster clasp. Also available in 18kt gold over sterling. Item #916981 Capture the beauty of the sea Celebrate the wonder of nature with our seashell necklace from Italy. The intricate textured and polished sterling silver pendant holds a luminous 7.5-8mm cultured freshwater pearl, creating an alluring look that goes with any style. Ross-Simons Item #920248 To receive this special offer, use offer code:FRESH69 1.800.556.7376 or visit ross-simons.com/fresh In collaboration with the Italian Trade Agency, the Ministry of Economic Development and ConƓndustria-FederoraƓTHEEXTRAORDINARY ITALIANJEWELRY THEEXTRAORDINARY ITALIANJEWELRYND-GCI0443085-01 NEIGHBORHOOD INFORMATION MEETING The public is invited to attend a neighborhood meeting held by Jennifer Sapen, of Barraco and Associates, Inc., representing Minto Sabal Bay, LLC on: Thursday, July 16, 2020 at 5:30 p.m. at Isles of Collier Preserve Clubhouse (Multi-Purpose Room) 5570 Tobago Blvd, Naples, FL 34113 Subject Property ID Numbers (Fleischmann Parcel): 61838201007, 61838200008, 61838160009, 61838120007, 61838080008 The property owner is petitioning Collier County for a proposed change to the Sabal Bay MPUD boundary and density (Ordinance 05-59) to approve a rezone of the subject property to be included in the Sabal Bay MPUD and allow development of up to 230 dwelling units on the described property, as proposed in PL20190002305. All other aspects of the planned development will remain unchanged. TITLE PETITION NO. PL20190002305 – Minto Sabal Bay, LLC, requests a substantial change to Ordinance No. 05-59, as amended, the Sabal Bay MPUD, to include the Fleischmann Parcel within the PUD’s boundary and increase acreage from 2,416.49 to 2,518.98 and the maximum number of dwelling units from 1,999 to 2,229. The subject property is located on the east side of Bayshore Drive less than one mile south of Thomasson Drive. Legal Description: Lots 81 – 90, inclusive, Naples Grove and Truck Company’s Little Farms No.2, according to plat thereof as recorded in Plat Book 1, Page 27A, Public Records of Collier County, Florida, with the subject property consisting of 102.49± acres. WE VALUE YOUR INPUT Business and property owners, residents and visitors are welcome to attend the presentation and discuss the project with the owner/developer and Collier County staff. If you are unable to attend this meeting, but have questions or comments, they can be directed by mail, phone, fax or e-mail by August 15, 2020 to: Jennifer Sapen, AICP Barraco and Associates, Inc. 2271 McGregor Blvd, Suite 100 Fort Myers, Florida 33901 Fax: (239) 461-3169 JenniferS@Barraco.net Phone: (239) 461-3170 of the extra $600 payments will end the prior Saturday or Sunday. A Trump administration official said the CARES Act legislation is inaccurate as written. Efforts to reach lawmakers who partici- pated in drafting the legislation were unsuccessful. The technicality apparently led to confusion, with some states mistakenly listing July 31 as the end date. New York state’s department of labor said it would switch the end date on its website for the additional $600 benefit from July 31 to the week ending July 26 after USA TODAY inquired about it. To avoid any confusion, Alabama’s Department of Labor said it will alert those who receive benefits that their ex- tra income bump will end after July 25. “We will be messaging it at least two weeks in advance,” Tara Hutchison, a spokeswoman for the state’s labor de- partment, said in an email. The $600 is part of the CARES Act, a $1.8 trillion package Congress passed to help the nation weather the economic storm brought by the coronavirus pan- demic, which shuttered businesses, slowed spending and erased a stagger- ing 22 million jobs in just two months. In 13 weeks, 45.7 million people filed first-time claims for jobless benefits as the unemployment rate soared to 13.3%, close to the highest level since the Great Depression. The extra $600 payment provided a vital boost, significantly increasing the assistance to those who had lost work. And even economists expected it to last through the end of July. “We’ve all being saying it’s July 31st, but it’s not,” says Heidi Shierholz, senior economist and director of policy for the left-leaning Economic Policy Institute. Checks that are $600 lighter will mean that already struggling Americans will have to pull their belts even tighter, economists say, and it may take even longer for the battered economy to re- gain its footing. Ohio Sen. Sherrod Brown told report- ers Tuesday that it was important to continue the benefit at a time when the country is still fighting the pandemic, especially as moratoriums lift on when renters can be evicted from their homes. “It puts money in people’s pockets,” the Ohio Democrat said. “We’re going to see a massive number of people evicted.” For Melissa Rusk of Bradenton, Flori- da, the thought of losing the $600 feder- al subsidy for even one week is almost too much to bear. “I would say it’s just about life or death in some situations,” she said. “It can potentially mean the difference between being able to help my husband pay bills.” Rusk, 36, lost her job at a recreational vehicle rental facility at the end of April. Her husband still works a warehouse job, but his income doesn’t cover the ex- penses for their family of six, which in- cludes four children ages 7 to 18. Without the federal subsidy, and with the numbers of new coronavirus infections skyrocketing in Florida, Rusk fears she will be forced to take a custom- er-facing job that could put her family, including her mother, at risk for con- tracting COVID-19. “I would have to literally put my life at risk and just take the chance and hope to God that I don’t get sick,” she said. The earlier-than-anticipated ending of the program will likely put more pres- sure on Congress in July when lawmak- ers plan to negotiate another possible coronavirus emergency package. “Lawmakers think they have until the end of July to figure this out,” Shierholz says, “but they don’t.” When asked about the early termina- tion of the program, a Senate Democrat- ic aide who did not want to be identified because they were not authorized to talk said it was an example of why Dem- ocrats have been pushing for an exten- sion and considering the possibility of automatically tying the benefits to the condition of the economy. Democrats have made extending un- employment one of their priorities, but Republicans have been skeptical, noting that some Americans are making more on unemployment than they were at their jobs and that businesses trying to reopen are having trouble rehiring. “The federal government will meet its obligation under the CARES Act. Any phase four economic package must pri- oritize pro-growth economic measures that incentivize employers and our great American workforce for re-em- ployment and a return to the labor mar- ket,” Judd Deere, White House deputy press secretary, said in a statement to USA TODAY. House Democrats in May narrowly passed a $3 trillion coronavirus package that among other things would extend the $600 unemployment assistance un- til January. But the bill was considered a nonstarter by the GOP-controlled Sen- ate, whose leaders argued more time was needed to examine how the trillions already passed were working and what needs remain as the country started to reopen. Senate Majority Leader Mitch McConnell called it a “liberal wish list” at the time. Phylicia Darice, 30, of Chattanooga, Tennessee, has yet to receive unem- ployment benefits since she applied in mid-April after being furloughed. She says no one from the Tennessee Department of Labor and Workforce Development informed her that the CARES Act supplement would end July 25, though she has called the depart- ment roughly 100 times to ask about the progress of her claim. “You keep going through it, and then you feel like you’re being lied to,” Darice said. Darice, who worked in retail custom- er service, may be able to return to work at the end of July, but with the virus still spreading, the future is uncertain. After weeks without income or unemploy- ment benefits, she is stretched thin fi- nancially, she says. “I realize $600 may not be much to some, but you’re talking about the liveli- hood for someone eating for ... a couple of weeks,” Darice said. “Or making sure rent is paid for August, because nothing is guaranteed.” Contributing: Michael Collins and Christal Hayes, USA TODAY; Wendy Rhodes, The Palm Beach (Florida) Post; Cassandra Stephenson, The (Nashville) Tennessean; Mark Williams, The Co- lumbus (Ohio) Dispatch. The additional $600 in weekly jobless benefits provided by the federal government is officially set to end July 31.GETTY IMAGES Benefit Continued from Page 1A In 13 weeks, 45.7 million people filed first-time claims for jobless benefits as the unemployment rate soared to 13.3%, close to the highest level since the Great Depression. 9.A.2.d Packet Pg. 215 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 216 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 217 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 218 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Ϯ 2271 McGregor Boulevard• Fort Myers, FL 33902 Phone (239) 461-3170 • Fax (239) 461-3169 WZK:d>Kd/KE 9.A.2.d Packet Pg. 219 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 127)25&216758&7,213/$167$786352-(&7'(6&5,37,21),/(1$0(/2&$7,213/27'$7(;2371,00':*-??':*?35(/,0?78(30$1'3$572)6(&7,213$572)6(&7,2172:16+,36287+5$1*(($67&2//,(5&2817<)/25,'$7+(,6/(672:16+,36287+5$1*(($672)&2//,(535(6(59(7+,63/$1,635(/,0,1$5<$1',17(1'(')25&21&(378$/3/$11,1*385326(621/<6,7(/$<287$1'/$1'86(,17(16,7,(625'(16,7,(60$<&+$1*(6,*1,),&$17/<%$6('83216859(<(1*,1((5,1*(19,5210(17$/$1'255(*8/$725<&21675$,176$1'2523325781,7,(63/27%<$1*(/,&$+$5'<'5$:,1*1279$/,':,7+2876($/6,*1$785($1''$7(&23<5,*+7%$55$&2$1'$662&,$7(6,1&5(352'8&7,21&+$1*(625$66,*10(176$5(352+,%,7('35(3$5(')250,172&20081,7,(686$3$5.2$.6%28/(9$5'68,7(7$03$)/:::0,172&20)$;3+21(0F*5(*25%/9'68,7(32672)),&('5$:(5)2570<(56)/25,'$3+21()$;arracoand Associates, Inc.B&,9,/(1*,1((5,1*/$1'6859(<,1*/$1'3/$11,1*www.barraco.net)/25,'$&(57,),&$7(62)$87+25,=$7,21(1*,1((5,1*6859(<,1*/%&52665()(5(1&(''5$:,1*6&52665()(5(1&(''5$:,1*6&52665()(5(1&(''5$:,1*6&3/$15(9,6,2166+((7180%(5352-(&7),/(120$67(56,7(3/$116:( 6&$/(,1)((7867+20$6621'5,9(9.A.2.d Packet Pg. 220 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann )25(;+,%,721/<127)25&216758&7,213/$167$786352-(&7'(6&5,37,21),/(1$0(/2&$7,213/27'$7(35236,7(':*-??':*?=21,1*??(;+,%,76?&20081,7<7+8$0$1'3$572)6(&7,213$572)6(&7,2172:16+,36287+5$1*(($67&2//,(5&2817<)/25,'$7+(,6/(672:16+,36287+5$1*(($672)&2//,(535(6(59(7+,63/$1,635(/,0,1$5<$1',17(1'(')25&21&(378$/3/$11,1*385326(621/<6,7(/$<287$1'/$1'86(,17(16,7,(625'(16,7,(60$<&+$1*(6,*1,),&$17/<%$6('83216859(<(1*,1((5,1*(19,5210(17$/$1'255(*8/$725<&21675$,176$1'2523325781,7,(63/27%<-(11,)(56$3(1'5$:,1*1279$/,':,7+2876($/6,*1$785($1''$7(&23<5,*+7%$55$&2$1'$662&,$7(6,1&5(352'8&7,21&+$1*(625$66,*10(176$5(352+,%,7('35(3$5(')250,172&20081,7,(686$3$5.2$.6%28/(9$5'68,7(7$03$)/:::0,172&20)$;3+21(0F*5(*25%/9'68,7(32672)),&('5$:(5)2570<(56)/25,'$3+21()$;arracoand Associates, Inc.B&,9,/(1*,1((5,1*/$1'6859(<,1*/$1'3/$11,1*www.barraco.net)/25,'$&(57,),&$7(62)$87+25,=$7,21(1*,1((5,1*6859(<,1*/%&52665()(5(1&(''5$:,1*6%$6(3/$1 67$':*&52665()(5(1&(''5$:,1*6&52665()(5(1&(''5$:,1*6&3/$15(9,6,2166+((7180%(5352-(&7),/(126,7(3/$1$1'$(5,$/29(5/$<127,1&/8'('6$%$/%$<38'16:( 6&$/(,1)((7127,1&/8'('/(*(1'$33529('6$%$/%$<38'352326('&216(59$7,21$5($66$%$/%$<38'$'',7,21(;,67,1*&216(59$7,21$5($$&6$%$/%$<38'7+20$6621'5%$<6+25('5+$0,/721$9(9.A.2.d Packet Pg. 221 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann )25(;+,%,721/<127)25&216758&7,213/$167$786352-(&7'(6&5,37,21),/(1$0(/2&$7,213/27'$7(35236,7(':*-??':*?=21,1*??(;+,%,76?&20081,7<7+8$0$1'3$572)6(&7,213$572)6(&7,2172:16+,36287+5$1*(($67&2//,(5&2817<)/25,'$7+(,6/(672:16+,36287+5$1*(($672)&2//,(535(6(59(7+,63/$1,635(/,0,1$5<$1',17(1'(')25&21&(378$/3/$11,1*385326(621/<6,7(/$<287$1'/$1'86(,17(16,7,(625'(16,7,(60$<&+$1*(6,*1,),&$17/<%$6('83216859(<(1*,1((5,1*(19,5210(17$/$1'255(*8/$725<&21675$,176$1'2523325781,7,(63/27%<-(11,)(56$3(1'5$:,1*1279$/,':,7+2876($/6,*1$785($1''$7(&23<5,*+7%$55$&2$1'$662&,$7(6,1&5(352'8&7,21&+$1*(625$66,*10(176$5(352+,%,7('35(3$5(')250,172&20081,7,(686$3$5.2$.6%28/(9$5'68,7(7$03$)/:::0,172&20)$;3+21(0F*5(*25%/9'68,7(32672)),&('5$:(5)2570<(56)/25,'$3+21()$;arracoand Associates, Inc.B&,9,/(1*,1((5,1*/$1'6859(<,1*/$1'3/$11,1*www.barraco.net)/25,'$&(57,),&$7(62)$87+25,=$7,21(1*,1((5,1*6859(<,1*/%&52665()(5(1&(''5$:,1*6%$6(3/$1 67$':*&52665()(5(1&(''5$:,1*6&52665()(5(1&(''5$:,1*6&3/$15(9,6,2166+((7180%(5352-(&7),/(126,7(3/$1$1'$(5,$/29(5/$<6$%$/%$<38'16:( 6&$/(,1)((7127,1&/8'('/(*(1'$33529('6$%$/%$<38'352326('&216(59$7,21$5($66$%$/%$<38'$'',7,21(;,67,1*&216(59$7,21$5($$&6$%$/%$<38'7+20$6621'5%$<6+25('5+$0,/721$9(9.A.2.d Packet Pg. 222 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 223 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 224 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 225 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 226 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 227 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 228 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 229 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 230 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 231 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 232 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 233 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 234 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 235 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 236 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 237 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 238 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 239 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 240 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 241 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 242 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 243 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 244 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 245 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 246 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 247 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 248 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 249 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 250 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann &>/^,DEEZKEE/',KZ,KK/E&KZDd/KEDd/E':h>zϭϲ͕ϮϬϮϬW>ϮϬϭϵϬϬϬϮϯϬϱEDZ^^/dz ^dd /W D/>Z^^W,KEEhDZ>ĂƵƌĂĞ:ŽŚŶ;ŽƵŶƚǇWůĂŶŶĞƌͿϮϴϬϬEŽƌƚŚ,ŽƌƐĞƐĐŚŽĞƌŝǀĞEĂƉůĞƐ &> ϯϰϭϬϰůĂƵƌĂ͘ĚĞũŽŚŶΛĐŽůůŝĞƌĐŽƵŶƚǇĨů͘ŐŽǀ;ϮϯϵͿϮϱϮͲϰϯϮϰDŝĐŚĂĞůůŐŝŶ;DŝŶƚŽͿ ϰϮϴϬdĂŵŝĂŵŝdƌĂŝů͕^ƚĞϮϬϯͬϮϬϰ EĂƉůĞƐ &> ϯϰϭϭϮDůŐŝŶΛŵŝŶƚŽƵƐĂ͘ĐŽŵ;ϮϯϵͿϴϵϲͲϭϰϬϮ:ĞŶŶŝĨĞƌ^ĂƉĞŶ;ĂƌƌĂĐŽΘƐƐŽĐŝĂƚĞƐͿ ϮϮϳϭDĐ'ƌĞŐŽƌůǀĚ͕^ƵŝƚĞϭϬϬ&ŽƌƚDǇĞƌƐ &> ϯϯϵϬϭũĞŶŶŝĨĞƌƐΛďĂƌƌĂĐŽ͘ŶĞƚ;ϮϯϵͿϰϲϭͲϯϭϳϬĂƌů͘ĂƌƌĂĐŽ;ĂƌƌĂĐŽΘƐƐŽĐŝĂƚĞƐͿ ϮϮϳϭDĐ'ƌĞŐŽƌůǀĚ͕^ƵŝƚĞϭϬϬ &ŽƌƚDǇĞƌƐ &> ϯϯϵϬϭĂƌůΛďĂƌƌĂĐŽ͘ŶĞƚ;ϮϯϵͿϰϲϭͲϯϭϳϬtĞƐ<ĂǇŶĞ;ĂƌƌĂĐŽΘƐƐŽĐŝĂƚĞƐͿ ϮϮϳϭDĐ'ƌĞŐŽƌůǀĚ͕^ƵŝƚĞϭϬϬ &ŽƌƚDǇĞƌƐ &> ϯϯϵϬϭtĞƐ<ΛďĂƌƌĂĐŽ͘ŶĞƚ;ϮϯϵͿϰϲϭͲϯϭϳϬĂǁŶZƵƐƐĞůů;ĂƌƌĂĐŽΘƐƐŽĐŝĂƚĞƐͿ ϮϮϳϭDĐ'ƌĞŐŽƌůǀĚ͕^ƵŝƚĞϭϬϬ &ŽƌƚDǇĞƌƐ &> ϯϯϵϬϭĚĂǁŶƌΛďĂƌƌĂĐŽ͘ŶĞƚ;ϮϯϵͿϰϲϭͲϯϭϳϬZŝĐŚzŽǀĂŶŽǀŝĐŚ;z<>Ăǁ&ŝƌŵͿ ϰϬϬϭdĂŵŝĂŵŝdƌĂŝůEŽƌƚŚ͕^ƵŝƚĞϯϬϬ EĂƉůĞƐ &> ϯϰϭϬϯƌǇŽǀĂŶŽǀŝĐŚΛĐǇŬůĂǁĨŝƌŵ͘ĐŽŵ;ϮϯϵͿϰϯϱͲϭϮϭϴŝƉƌŝĂŶDĂůĂĞƐĐƵ;dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐͿ ϮϴϬϬĂǀŝƐŽƵůĞǀĂƌĚ͕^ƵŝƚĞϮϬϬ EĂƉůĞƐ &> ϯϰϭϬϰĐŵĂůĂĞƐĐƵΛƚƌĞďŝůĐŽĐŬ͘ďŝǌ;ϮϯϵͿϱϲϲͲϵϱϱϭĂŶŽǇůĞ;dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐͿ ϮϴϬϬĂǀŝƐŽƵůĞǀĂƌĚ͕^ƵŝƚĞϮϬϬ EĂƉůĞƐ &> ϯϰϭϬϰĚĚŽǇůĞΛƚƌĞďŝůĐŽĐŬ͘ďŝǌ;ϮϯϵͿϱϲϲͲϵϱϱϭƌŝŬ,ŝŶƌŝĐŚƐĞŶ ϲϰϱϬtĂƌǁŝĐŬǀĞ͘ EĂƉůĞƐ &> ϯϰϭϭϯĞŚŝŶƌŝĐŚƐĞŶΛŐŵĂŝů͘ĐŽŵ;ϯϬϭͿϯϲϲͲϵϴϰϴ<ĂƌĞŶ,ŝŶƌŝĐŚƐĞŶ ϲϰϱϬtĂƌǁŝĐŬǀĞ͘ EĂƉůĞƐ &> ϯϰϭϭϯŬĂƌĞŶ͘ŚŝŶƌŝĐŚƐĞŶΛŐŵĂŝů͘ĐŽŵ;ϯϬϭͿϯϯϮͲϳϵϴϲĂǀŝĚtŽŽĚǁŽƌƚŚ Ϯϳϯϱ>ĂŬĞǀŝĞǁǀĞ͘ EĂƉůĞƐ &>ƌĞĂůƚǇǀŽŝĐĞΛŐŵĂŝů͘ĐŽŵ;ϮϯϵͿϳϳϰͲϱϬϲϬĂŶZŽƐĞůŝĞƉ ϲϴϮϱĞƋƵŝĂtĂǇ EĂƉůĞƐ &> ϯϰϭϭϯĚƌŽƐĞůŝĞƉΛŐŵĂŝů͘ĐŽŵ;ϲϬϴͿϲϲϵͲϰϲϰϲ^ƵƐĂŶZŽƐĞůŝĞƉ ϲϴϮϱĞƋƵŝĂtĂǇ EĂƉůĞƐ &> ϯϰϭϭϯƐƵƐĂŶƌŽƐĞůŝĞƉΛŐŵĂŝů͘ĐŽŵ;ϱϭϱͿϯϭϰͲϮϮϴϬ'ĞŽƌŐĞĂŶǌ ϴϭϯŚĂƌůĞŵĂŐŶĞůǀĚ EĂƉůĞƐ &> ϯϰϭϭϮŐŚĚĂŶǌΛǇĂŚŽŽ͘ĐŽŵϳϳϰͲϮϲϭϴdŝŵǇĐŚ ϲϱϮϵŽŵŝŶŝĐĂƌŝǀĞ͕hŶŝƚϮϬϮ EĂƉůĞƐ &>ƚŝŵŽƚŚǇǌǇĐŚΛŐŵĂŝů͘ĐŽŵĚŐĂƌ,ĞƌŶĂŶĚĞǌϮϴϯϭ,ŽůůǇǀĞEĂƉůĞƐ &> ϯϰϭϭϮĞĚŐĂƌůĂŚĞƌŶĂŶĚĞǌΛǇĂŚŽŽ͘ĐŽŵsŝŶƵǆŽϲϱϰϵŽŵŝŶŝĐĂƌŝǀĞ͕ηϮϬϮEĂƉůĞƐ &>ǀŝŶďƵǆŽΛŐŵĂŝů͘ĐŽŵ;ϴϲϰͿϯϱϰͲϮϴϲϰ<ƌŝƐƚŝŶĞ>ĂůĂŝƌ ϯϬϰϰƌĞĐĂǀĞ͘ EĂƉůĞƐ &> ϯϰϭϭϮƚŚĞůĂĐůĂŝƌƐΛŐŵĂŝů͘ĐŽŵů^ĐŚĂŶƚǌĞŶϯϯϮϭĂŶĂů^ƚ͘EĂƉůĞƐ &>^ϭƌĞŬŽ͘>ΛĐŽŵĐĂƐƚ͘ŶĞƚWĂƵůĂz͘DƵƌƉŚǇϲϮϰϱhŶŝŽŶ/ƐůĂŶĚtĂǇEĂƉůĞƐ &>ƉǇŵϰƐǁŝŵΛŚŽƚŵĂŝů͘ĐŽŵ;ϵϬϴͿϯϵϮͲϰϳϯϯdŽŵDƵƌƉŚǇ ϵϮϰϱhŶŝŽŶ/ƐůĂŶĚtĂǇ EĂƉůĞƐ &> ϯϰϭϭϯƚŬŵƵƌƉŚǇũƌΛŚŽƚŵĂŝů͘ĐŽŵ;ϵϬϴͿϮϭϳͲϲϳϱϯĚΘ^ĂŶĚǇ'ƌĂĐĞ ϱϬϭϲŶĚƌŽƐƌ͘ EĂƉůĞƐ &>ĞĚǁĂƌĚŐƌĂĐĞϬϴΛĐŽŵĐĂƐƚ͘ŶĞƚ;ϮϯϵͿϰϭϳͲϰϰϵϰZĂŶĚǇtŝůƐŽŶ ϱϵϭϬ,Ăŝƚŝƌ͘ EĂƉůĞƐ &>ƌĂŶĚǇǁϭϬϳΛǇĂŚŽŽ͘ĐŽŵ;ϮϯϵͿϯϬϮͲϲϴϴϭWĞƚĞƌĞDĂƌĐŽ ϱϳϯϳŶĞŐĂĚĂƌŝǀĞ EĂƉůĞƐ &>ƉĚĞŵĂƌĐŽΛŵĞĂĚĞŶŵŽŽƌĞ͘ĐŽŵ;ϮϭϲͿϱϵϴͲϭϵϱϲDĂƌǇ,ŽƌŶ ϲϵϲϰĂǇŽƵƌƚ EĂƉůĞƐ &>ŵĂƌǇŚŽƌŶΛĐŽŵĐĂƐƚ͘ŶĞƚ;ϱϲϭͿϴϭϴͲϵϲϰϰĞŶŶEŽƌƐƚƌŽŵ^ŚĂǁŬĞǇ ϳϬϱϮŽŵŝŶŝĐĂƌ͘ EĂƉůĞƐ &>ũŽŚŶ͘ƐŚĂǁŬĞǇΛǇĂŚŽŽ͘ĐŽŵ;ϮϯϵͿϯϬϮͲϱϮϱϮZĂĞtŝŶĚƵƐ ϱϲϵϬůďŽǁǀĞ͘ EĂƉůĞƐ &>ƌĂĞ͘ĚĞůƌĂǇΛŐŵĂŝů͘ĐŽŵ;ϵϱϰͿϮϳϬͲϰϱϬϬWƌĞƐƚŽŶtŝŶĚƵƐ ϱϲϵϬůďŽǁǀĞ͘ EĂƉůĞƐ &>ũƉƌĞƐƚŽŶϭϵϭϱΛǇĂŚŽŽ͘ĐŽŵ;ϲϯϭͿϲϲϰͲϰϴϲϯWĂƵůĂ^ƚĞƌŶĞƌ ϲϯϳϭŶƚŝŐƵĂtĂǇ EĂƉůĞƐ &>ƉƐƚĞƌŶĞƌΛĐŽŵĐĂƐƚ͘ŶĞƚE/DddE^9.A.2.d Packet Pg. 251 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann &>/^,DEEZKEE/',KZ,KK/E&KZDd/KEDd/E':h>zϭϲ͕ϮϬϮϬW>ϮϬϭϵϬϬϬϮϯϬϱ^ƚĞǀĞŶ^ƚĞƌŶďĞƌŐϲϱϲϵŽŵŝŶŝĐĂƌŝǀĞ͕hŶŝƚϮϬϮEĂƉůĞƐ &> ϯϰϭϭϯƐƚĞďĞϭϴΛĂŽů͘ĐŽŵ;ϱϭϲͿϳϰϵͲϱϳϬϬ:ĂŶŝĐĞΘ'ĞƌĂůĚ>ĂƉŬĞ ϰϵϬϭŶĚƌŽƐƌ͘ EĂƉůĞƐ &>ũĂŶůĂƉŬĞΛĂŽů͘ĐŽŵ;ϮϯϵͿϵϭϵͲϴϳϵϱDĂƌŐĂƌĞƚŚĞǀĂůŝĞƌ ϱϳϬϴ,ŝŐŚďŽƵƌŶĞƌ͘ EĂƉůĞƐ &> ϯϰϭϭϯĐŚĞǀĂůŝĞƌƉĞŐŐǇΛǇĂŚŽŽ͘ĐŽŵ;ϳϯϮͿϵϳϳͲϰϵϵϭŝůĞĞŶ'ĂůůĂŐŚĞƌ ϳϭϲϵŽŵŝŶŝĐĂƌ͘ EĂƉůĞƐ &>ĞŝůĞĞŶŐĂůůĂŐŚĞƌϰϰΛŐŵĂŝů͘ĐŽŵ;ϱϭϲͿϰϰϯͲϳϱϮϵ^ƚĞƉŚĞŶzŽƵŶŐ ϱϬϬϯŶĚƌŽƐƌ͘ EĂƉůĞƐ &>ƐǇŽƵŶŐϭϭϮϬϱϯΛŐŵĂŝů͘ĐŽŵ;ϵϳϯͿϰϳϵͲϭϯϬϵ:ŽĞ^ƚĞĞůũǁƐƚĞĞůϯΛĂŽů͘ĐŽŵ;ϳϬϯͿϰϴϯͲϭϮϱϭ>ǇŶŶĞ^ƚĞĞů;ϳϬϯͿϰϬϯͲϰϮϰϯŽďΘĂƌŽů>ĞƉŵĂŶůĞƉŵĂŶƐΛĐŽŵĐĂƐƚ͘ŶĞƚ;ϴϰϳͿϵϴϳͲϱϰϱϰDŝĐŚĂĞů^ŝŵŽŶ ϱϳϮϬ,ŝŐŚďŽƵƌŶĞƌŝǀĞ EĂƉůĞƐ &> ϯϰϭϭϯŵŝĐŚĂĞůƐƐŝŵŽŶ͘ĞƐƋΛŐŵĂŝů͘ĐŽŵ;ϱϭϲͿϯϭϳͲϳϯϬϰ/ƌŝƐ͘dŽĚĚ ϱϭϰϲŶĚƌŽƐƌŝǀĞ EĂƉůĞƐ &> ϯϰϭϭϯŝƌŝƐ͘Ğ͘ƚŽĚĚΛŐŵĂŝů͘ĐŽŵWĂƚƌŝĐŝĂzŽƵŶŐƉĂǇŽƵŶŐϯΛŚŽƚŵĂŝů͘ĐŽŵ;ϮϯϵͿϳϰϱͲϱϵϮϲZŝĐŚĂƌĚĂƚƚŝůŽ ϱϵϮϮ,ĂŝƚŝƌŝǀĞ EĂƉůĞƐ &> ϯϰϭϭϯĚŝĐŬĚĂƚƚŝůŝŽΛŐŵĂŝů͘ĐŽŵE/DKKDWZd//WEd^E/DddE^;KEd/EhͿ9.A.2.d Packet Pg. 252 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann From:DeaneConnie To:LauraDeJohnVEN;BellowsRay Cc:Jennifer Sapen;FrenchJames;JenkinsAnita;VelascoJessica;BatesDanielle;BrethauerPaula;CurryDeborah Subject:FW: Collier County, FL: Sabal Bay Mixed Planned Unit Development Rezone (to include the Fleischmann Parcel) Neighborhood Information Meeting Date:Wednesday, July 15, 2020 11:25:23 AM )<,±WKHUHYLVHGHQRWLILHUIRUWKLV1,0KDVEHHQGLVWULEXWHGVHHEHORZ .LQGUHJDUGV Connie Deane Community Liaison Community and Media Relations Section Collier County Growth Management Department 2885 S. Horseshoe Drive Naples, FL 34104 Connie.Deane@colliercountyfl.gov 239.252.8192 (main) 239.252.8365 (desk) 239.253.5616 (cell) From: webmaster@colliercountyfl.gov <webmaster@colliercountyfl.gov> Sent: Wednesday, July 15, 2020 11:17 AM To: DeaneConnie <Connie.Deane@colliercountyfl.gov> Subject: Collier County, FL: Sabal Bay Mixed Planned Unit Development Rezone (to include the Fleischmann Parcel) Neighborhood Information Meeting EXTERNAL EMAIL:This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Content Updated: This Event has been previously sent out. Sabal Bay Mixed Planned Unit Development Rezone (to include the Fleischmann Parcel) Neighborhood Information Meeting •Date: 07/16/2020 5:30 PM •Location: Isles of Collier Preserve Clubhouse (Multi-Purpose Room) 5570 Tobago Blvd Naples, Florida 34113 If you are not able to attend the meeting in person, we will also be conducting the meeting simultaneously through Zoom. Please email JenniferS@Barraco.net prior to the meeting if you will be attending via Zoom or have any questions. For detailed information regarding this petition, please click the link PL20190002305 For more information regarding the meeting, please contact Laura DeJohn, AICP, at 239- 252-4324 or via email at Laura.DeJohn@colliercountyfl.gov 9.A.2.d Packet Pg. 253 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann From:Nancy Van Buskirk To:Jennifer Sapen Subject:ICP Meeting Date:Wednesday, July 08, 2020 10:48:46 AM Mr. Burke is concerned about the public meeting and is trying to put forth the concerns of a group of residents. He was confused and now agrees that the meeting is 7/16/20. I explained that we were waiting for direction from the other party involved (and he immediately knew it was Minto). I asked him to wait a few days and hopefully we would have some more information to give him. He agreed and asked that you call him back by Friday. That would allow some time to talk to Chris if necessary. His phone number is 239-290-4820. Thank you. 9.A.2.d Packet Pg. 254 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann From:Bob Phelan To:Jennifer Sapen Subject:Fleischmann Parcel Bayshore Dr and Thomasson, 230 dwelling units Date:Wednesday, July 08, 2020 4:35:00 PM Jennifer, Please forward me your presentation info that describes how the property will be developed, since I am not available for a neighborhood info meeting on 7/16. Will there be multi- family dwellings, if so how many stories high? Concerned property owner in Isles of Collier, Bob Phelan Bobjphelan1@gmail.com 6100 Antigua Way Naples, FL 34113 9.A.2.d Packet Pg. 255 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann From:hollowin95@aol.com To:Jennifer Sapen Subject:Re: PUD Rezone Date:Friday, July 17, 2020 11:51:54 AM Jennifer, Thank you so much for your incredibly quick response. Obviously no concerns for us. Chuck -----Original Message----- From: Jennifer Sapen <JenniferS@barraco.net> To: hollowin95@aol.com <hollowin95@aol.com> Sent: Fri, Jul 17, 2020 10:44 am Subject: RE: PUD Rezone Hello Mr. Drake. The 106 acres being rezoned to be a part of Isles of Collier Preserve is a little over a mile west of the Treviso Bay project boundary. The request includes an additional 230 single family detached and attached units. No multifamily is proposed for the new land addition. I’ve attached an aerial map showing the new “Fleischmann Parcel” in blue with yellow cross hatch and Treviso Bay is labeled. -HQQLIHU6DSHQ$,&3 Vice President of Land Planning Barraco and Associates, Inc. Civil Engineers ~ Land Surveyors ~ Land Planners 2271 McGregor Boulevard, Suite 100 Fort Myers, FL 33901 (239) 461-3170 Phone (239) 461-3169 Fax http://www.barraco.net File: )URP hollowin95@aol.com [mailto:hollowin95@aol.com] 6HQW Thursday, July 16, 2020 9:24 PM 7R Jennifer Sapen <JenniferS@barraco.net> 6XEMHFW PUD Rezone Jennifer S. (that is all that was in the letter of notification), We were unable to attend the meeting today at the Isles of Collier clubhouse and the Zoom session. Can you send me a copy of the developer's plan for dwelling units in the expanded area? If not, can you tell me where to go to ask? I live in Treviso Bay at the end of a street that borders near the new area and would like to know exactly where new buildings will be built. Thank you for your assistance. Chuck Drake 410-598-9713 In order to use electronic files provided by Barraco and Associates, Inc. you must agree to the following: In accepting and utilizing any drawings or other electronic data provided by Barraco and Associates, Inc., the recipient agrees that all 9.A.2.d Packet Pg. 256 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann such drawings and data are instruments of service of Barraco and Associates, Inc. who shall be deemed the author of the drawings and data, and shall retain all common law, statutory and other rights, including copyrights. Any inconsistencies the recipient discovers will be reported to Barraco and Associates, Inc. and will be corrected by Barraco and Associates, Inc. The recipient accepts responsibility for confirming with Barraco and Associates, Inc. that the electronic file is current at the time of use by the recipient. The recipient also agrees to hold Barraco and Associates, Inc. harmless for any cost or damages incurred due to the recipient's use of an outdated electronic file and for any costs associated with updating the recipient's electronic files in the event of future revisions by Barraco and Associates, Inc. The recipient agrees not to use these drawings and data, in whole or in part, for any purpose or project other than the project which is the subject of this agreement, nor shall the recipient provide that attached data to any other party not indicated as a recipient in the "To" field of this message. The recipient agrees to waive all claims against Barraco and Associates, Inc. resulting in any way from any unauthorized changes or reuse of the drawings and data for any other project by anyone other than Barraco and Associates, Inc. In addition, the recipient agrees, to the fullest extent permitted by law, to indemnify and hold Barraco and Associates, Inc. harmless from any damage, liability or costs, including reasonable attorney fees and costs of defense, arising from any changes made by anyone other than Barraco and Associates, Inc. or from any reuse of the drawings and data without the prior written consent of Barraco and Associates, Inc. 9.A.2.d Packet Pg. 257 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann From:Elliott To:Jennifer Sapen Cc:Denise;david demers Subject:Fleischmann meeting Date:Monday, July 13, 2020 8:57:02 AM My husband and I are residents of ICP for the past 5 years and so is our daughter and husband for the past 3 years. I speak for my husband and me and wish to ask you to postpone this meeting due to overexposure at this time considering the upward positive cases of Covid-19 in our 34113 area. We are both seniors and active in ICP but are diligent in social distancing and wear mask etc. We need to continue to know that when we play Pickle ball, tennis or take our bike rides and long walks that we will continue to be safe. Opening our back gates to whomever wants to attend this meeting in our clubhouse is not the way to help our community stay safe or healthy, unless you take everyone's temperature, have them produce proof that they had a coved test the day before etc. Please, please cancel this meeting for all the good of the residents in ICP. Thank you for listening, Fay and Elliott Myers 6572 Dominica Dr. unit 201 9.A.2.d Packet Pg. 258 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann From:LauraDeJohnVEN To:Jennifer Sapen;Dawn Russell Subject:FW: Fleischmann Proposal-Amended Document Date:Thursday, July 16, 2020 11:43:33 AM Attachments:Minto NIM.pdf FYI, Attached is public input received this morning, which will be included in the public input file for PL20190002305 Laura DeJohn, AICP Collier County Growth Management Department Zoning Services (Vendor) 2800 North Horseshoe Drive Naples, FL 34104 Desk: (239) 252-4324 laura.dejohn@colliercountyfl.gov -----Original Message----- From: Gary Lubben <glubben1@mac.com> Sent: Thursday, July 16, 2020 7:46 AM To: FialaDonna <Donna.Fiala@colliercountyfl.gov>; TaylorPenny <Penny.Taylor@colliercountyfl.gov> Cc: LauraDeJohnVEN <Laura.DeJohn@colliercountyfl.gov>; FinnTimothy <Timothy.Finn@colliercountyfl.gov> Subject: Fleischmann Proposal-Amended Document EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. All, I am hereby formally withdrawn all prior submissions relating to the proposed expansion of the Sabal Bay MPUD I’ve sent to the above distribution list. In reviewing the prior submissions I concluded they were insufficiently clear and potentially subject to erroneous interpretation. The attached document seeks to address these deficiencies. Please disregard, delete and ignore the prior submissions as they do not fairly and accurately raise the points I wanted to highlight. Thank you, Gary Lubben ________________________________ Under Florida Law, e-mail addresses are public records. If you do not want your e-mail address released in response to a public records request, do not send electronic mail to this entity. Instead, contact this office by telephone or in writing. 9.A.2.d Packet Pg. 259 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann From:Genevieve Hurley To:Jennifer Sapen Subject:Fwd: Fleischman Parcel Date:Monday, July 13, 2020 3:09:06 PM Genevieve Hurley Sent from my iPad Begin forwarded message: From: Genevieve Hurley <genevieve.e.hurley@gmail.com> Date: July 13, 2020 at 3:07:27 PM EDT To: jennifers@barracco.net Subject: Fleischman Parcel Question for the informational meeting scheduled July 16: What would be the impact on use and capacity of existing amenities if these units are added to the PUD? Also, use and capacity of the existing ICP entry/exits? I am a single family homeowner in Phase 1. I do not want more traffic on the streets or amenities. Let’s preserve this beautiful place and do not add to development. Genevieve Hurley Sent from my iPad 9.A.2.d Packet Pg. 260 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann From:Jenna Choate To:Jennifer Sapen Subject:building on fleischmann parcel question Date:Tuesday, July 14, 2020 11:08:21 AM hi Jennifer, I'm the homeowner of 3140 Woodside Ave. , Naples FL 34112. I received your letters recently about the isle's expanding and just have a question. the back of my home faces the woods where your client is wanting to build. i know last year they cut what seems to be a road from the isles to bayshore dr. will they be building condos right behind my house? or will there be that space there and then be building across the road they just cut through? I hope that makes sense. I bought my house in 2018 just because it backed up to the woods and we would have a nice view. i just want to be sure they are not building directly behind my house and obstructing my view. thank you for your response Jenna Choate Administrative Assistant to Douglas F. Adams Jenna@WingsSTL.com 239-601-1850 For the protection of Mr. Adams' personal information, correspondence will only be done Mon. Tues. Thurs. Fri. 10-3 EST while in the office. Thank you! 9.A.2.d Packet Pg. 261 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 'DZQ5XVVHOO)URP.DUHQ+LQULFKVHQNDUHQKLQULFKVHQ#JPDLOFRP!6HQW:HGQHVGD\-XO\$07R-HQQLIHU6DSHQ6XEMHFW,&30HHWLQJ7KXUVGD\-XO\+HOOR-HQQLIHU, PLQWHUHVWHGWRNQRZKRZPDQ\YLOODVFRDFKKRPHVDQGVLQJOHIDPLO\UHVLGHQFHVRXUFXUUHQWSODQDQGWKHQHZSODQHQWDLO&RXOG\RXSOHDVHVHQGPHWKHEUHDNGRZQRIWKRVHQXPEHUV", PRQO\LQWHUHVWHGLQWKHQXPEHUVWKDWDUHSHUWDLQLQJH[FOXVLYHO\WR,&3ZLWKRXW6SULQJV7KDQN\RX.DUHQ.DUHQ+LQULFKVHQ:DUZLFN$YH9.A.2.d Packet Pg. 262 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 'DZQ5XVVHOO)URP0DUF5RVHQEHUJPDUF#PDUFURVHQEHUJFRP!6HQW7XHVGD\-XO\307R-HQQLIHU6DSHQ6XEMHFW1,00HHWLQJLQ1DSOHVUH)OHLVFKPDQQ3DUFHO-HQQLIHU,ZLOOQRWEHDEOHWRDWWHQGWKH1,0RQ-XO\DWWKH,VOHVRI&ROOLHU3UHVHUYH$VDKRPHRZQHUWKHUH,ZRXOGDSSUHFLDWHLWLI\RXFRXOGDQVZHUVRPHEDVLFTXHVWLRQVIRUPH:KDWLVWKHFXUUHQWPD[LPXPQXPEHURIGZHOOLQJVWKDW0LQWRLVDOORZHGWREXLOGRQWKHSURSHUW\H[FOXGLQJ)OHLVFKPDQQ":KDWZLOOEHWKHPD[LPXPQXPEHURIGZHOOLQJWKDW0LQWRZLOOEHDOORZHGWREXLOGRQWKHSURSHUW\LQFOXGLQJ)OHLVFKPDQQ",UHDOL]HWKDWWKH38'FRYHUVPRUHWKDQ,&36SULQJVHWFVR,NQRZWKDWVRPHRIWKHGZHOOLQJVDUHDOORFDWHGWR6SULQJV%XWLWDSSHDUVWKDW0LQWRZLOOEHDOORZHGWREXLOGXSWRPRUHGZHOOLQJVFRUUHFW",DOVRXQGHUVWDQGWKDWUHDOORFDWLRQRIGHQVLW\DQGRWKHUIDFWRUVPD\PDNHWKHGLIIHUHQFHEHWZHHQZKDWLVFXUUHQWO\DOORZHGTXHVWLRQDQGZKDWZLOOEHDOORZHGTXHVWLRQOHVVWKDQ+RZPXFKOHVVDQGKRZZDVWKLVFDOFXODWHG",WKLQNE\WKHQDWXUHRIWKHVHTXHVWLRQV\RXJHWWKHSRLQW,DPWU\LQJWRPDNHHYHQLI,DPDOLWWOHXQFOHDULQP\ZRUGLQJ,XQGHUVWDQGWKDW\RXPLJKWKDYHWRFRQIHUZLWK0LNH(OJLQRQWKLV<RXFDQFHUWDLQO\H[SHFWWKLVWREHDPDMRULVVXHDWWKHPHHWLQJDVPRVW,&3UHVLGHQWV,NQRZGRQRWXQGHUVWDQGKRZWKHQXPEHUVDUHGHULYHG,WZRXOGEHSUXGHQWIRU\RXWREHDEVROXWHO\FOHDURQWKLVDWWKHPHHWLQJDQGLI\RXOLNH\RXFDQWU\WKLVSDUWRIWKHSUHVHQWDWLRQRXWRQPH:KHWKHURUQRW\RXZDQWWRGRWKDW,ZRXOGJUHDWO\DSSUHFLDWH\RXUDQVZHUVWRWKHDERYHWKUHHTXHVWLRQV,DOVRZRXOGOLNHWRNQRZZKHUHZKHQDQGKRZPLQXWHVRIWKH1,0ZLOOEHFRPHDYDLODEOH7KDQN\RXVRPXFK0DUF5RVHQEHUJBBBBBBBBBBBBB)ORULGD$GGUHVV%HTXLD:D\1DSOHV)/PDUF#PDUFURVHQEHUJFRP9.A.2.d Packet Pg. 263 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann From:Marc Rosenberg To:Jennifer Sapen Subject:NIM Meeting in Naples re: Fleischmann Parcel Date:Tuesday, July 07, 2020 3:57:38 PM Jennifer, I will not be able to attend the NIM on July 16 at the Isles of Collier Preserve. As a homeowner there, I would appreciate it if you could answer some basic questions for me: 1. What is the current maximum number of dwellings that Minto is allowed to build on the property, excluding Fleischmann? 2. What will be the maximum number of dwelling that Minto will be allowed to build on the property, including Fleischmann? 3. I realize that the PUD covers more than ICP (Springs, etc.), so I know that some of the dwellings are allocated to Springs. But it appears that Minto will be allowed to build up to 300 more dwellings, correct? I also understand that reallocation of density and other factors may make the difference between what is currently allowed (question 1) and what will be allowed (question 2) less than 300. How much less and how was this calculated? I think by the nature of these questions, you get the point I am trying to make, even if I am a little unclear in my wording. I understand that you might have to confer with Mike Elgin on this. You can certainly expect this to be a major issue at the meeting as most ICP residents I know do not understand how the numbers are derived. It would be prudent for you to be absolutely clear on this at the meeting and, if you like, you can try this part of the presentation out on me. Whether or not you want to do that, I would greatly appreciate your answers to the above three questions. I also would like to know where, when and how minutes of the NIM will become available. Thank you so much. Marc Rosenberg _____________ Florida Address: 6864 Bequia Way Naples, FL 34113 marc@marcrosenberg.com 908.419.1178 9.A.2.d Packet Pg. 264 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann From:Michael Elgin To:ForesterDebrah;ScottTami Cc:Jennifer Sapen Subject:Fleischmann Neighborhood Information Meeting Date:Monday, July 13, 2020 3:39:16 PM Attachments:23780 2020-07-10 Executed_Property owner letter for NIM.PDF Good Afternoon, For distribution to the CRA members. Minto’s Consulting team has been coordinating with County Staff over the past week to address requests for a virtual option for the Neighborhood Information Meeting. We understand these are unique times which are constantly changing and want to ensure that the process provides the opportunity to be informed and participate in the safest environment possible. A revised notice was mailed on 7/10/2020 providing a virtual participation option for the Neighborhood Information Meeting. We are also requesting that questions be provided in advance if possible so that the consultant team can ensure that they are properly addressed. Additionally, Isles of Collier Preserve Residents have been provided with a copy of the revised notice on Monday afternoon via Community Update eblast distribution. I have attached a copy of the Revised notice to this response which provides the zoom participation information. Thank you for your concern. We look forward to presenting the project on Thursday. Please let me know if you have any additional questions. Zoom information is below as requested. The zoom meeting information is: https://zoom.us/j/93759823744 OR Dial by your location Meeting ID: 937 5982 3744 +1 646 558 8656 US (New York) +1 301 715 8592 US (Germantown) +1 312 626 6799 US (Chicago) +1 669 900 9128 US (San Jose) +1 253 215 8782 US (Tacoma) +1 346 248 7799 US (Houston) Meeting ID: 937 5982 3744 Michael Elgin Director of Community Development MINTO COMMUNITIES - USA 4280 Tamiami Trail E, Ste 203/204, Naples, FL, 34112 T 239.896.1402 |C239.351.6951 A division of The Minto Group Follow us on 9.A.2.d Packet Pg. 265 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann From:Donna McGinnis To:Michael Elgin Cc:Jennifer Sapen;Shirley.Garcia@colliercountyfl.gov Subject:RE: Fleischmann Neighborhood Information Meeting Date:Monday, July 13, 2020 3:58:45 PM Thank you so much for making a virtual option available. I plan to attend virtually and look forward to seeing the latest about the project. Donna From: Michael Elgin <MElgin@mintousa.com> Sent: Monday, July 13, 2020 3:36 PM To: Donna McGinnis <DMcGinnis@naplesgarden.org> Cc: Jennifer Sapen <JenniferS@barraco.net>; Shirley.Garcia@colliercountyfl.gov Subject: Fleischmann Neighborhood Information Meeting Good Afternoon Donna, Please find below and attached a virtual option for the NIM on Thursday. Minto’s Consulting team has been coordinating with County Staff over the past week to address requests for a virtual option for the Neighborhood Information Meeting. We understand these are unique times which are constantly changing and want to ensure that the process provides the opportunity to be informed and participate in the safest environment possible. A revised notice was mailed on 7/10/2020 providing a virtual participation option for the Neighborhood Information Meeting. We are also requesting that questions be provided in advance if possible so that the consultant team can ensure that they are properly addressed. Additionally, Isles of Collier Preserve Residents have been provided with a copy of the revised notice on Monday afternoon via Community Update eblast distribution. I have attached a copy of the Revised notice to this response which provides the zoom participation information. Thank you for your concern. We look forward to presenting the project on Thursday. Please let me know if you have any additional questions. Zoom information is below as requested. The zoom meeting information is: https://zoom.us/j/93759823744 OR Dial by your location Meeting ID: 937 5982 3744 +1 646 558 8656 US (New York) +1 301 715 8592 US (Germantown) +1 312 626 6799 US (Chicago) +1 669 900 9128 US (San Jose) +1 253 215 8782 US (Tacoma) +1 346 248 7799 US (Houston) 9.A.2.d Packet Pg. 266 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Meeting ID: 937 5982 3744 Michael Elgin Director of Community Development MINTO COMMUNITIES - USA 4280 Tamiami Trail E, Ste 203/204, Naples, FL, 34112 T 239.896.1402 |C239.351.6951 A division of The Minto Group Follow us on 9.A.2.d Packet Pg. 267 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann From:Michael Elgin To:Marc Rosenberg Cc:Jennifer Sapen Subject:Fleischmann Neighborhood Information Meeting Date:Monday, July 13, 2020 3:37:44 PM Attachments:23780 2020-07-10 Executed_Property owner letter for NIM.PDF Good Afternoon, Minto’s Consulting team has been coordinating with County Staff over the past week to address requests for a virtual option for the Neighborhood Information Meeting. We understand these are unique times which are constantly changing and want to ensure that the process provides the opportunity to be informed and participate in the safest environment possible. A revised notice was mailed on 7/10/2020 providing a virtual participation option for the Neighborhood Information Meeting. We are also requesting that questions be provided in advance if possible so that the consultant team can ensure that they are properly addressed. Additionally, Isles of Collier Preserve Residents have been provided with a copy of the revised notice on Monday afternoon via Community Update eblast distribution. I have attached a copy of the Revised notice to this response which provides the zoom participation information. Thank you for your concern. We look forward to presenting the project on Thursday. Please let me know if you have any additional questions. Zoom information is below as requested. The zoom meeting information is: https://zoom.us/j/93759823744 OR Dial by your location Meeting ID: 937 5982 3744 +1 646 558 8656 US (New York) +1 301 715 8592 US (Germantown) +1 312 626 6799 US (Chicago) +1 669 900 9128 US (San Jose) +1 253 215 8782 US (Tacoma) +1 346 248 7799 US (Houston) Meeting ID: 937 5982 3744 Michael Elgin Director of Community Development MINTO COMMUNITIES - USA 4280 Tamiami Trail E, Ste 203/204, Naples, FL, 34112 T 239.896.1402 |C239.351.6951 A division of The Minto Group Follow us on 9.A.2.d Packet Pg. 268 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann From:Michael Elgin To:olelely@comcast.net Cc:Jennifer Sapen Subject:Fleischmann Neighborhood Information Meeting Date:Monday, July 13, 2020 3:22:45 PM Attachments:23780 2020-07-10 Executed_Property owner letter for NIM.PDF Good Afternoon, Minto’s Consulting team has been coordinating with County Staff over the past week to address requests for a virtual option for the Neighborhood Information Meeting. We understand these are unique times which are constantly changing and want to ensure that the process provides the opportunity to be informed and participate in the safest environment possible. A revised notice was mailed on 7/10/2020 providing a virtual participation option for the Neighborhood Information Meeting. We are also requesting that questions be provided in advance if possible so that the consultant team can ensure that they are properly addressed. Additionally, Isles of Collier Preserve Residents have been provided with a copy of the revised notice on Monday afternoon via Community Update eblast distribution. I have attached a copy of the Revised notice to this response which provides the zoom participation information. Thank you for your concern. We look forward to presenting the project on Thursday. Please let me know if you have any additional questions. Zoom information is below as requested. The zoom meeting information is: https://zoom.us/j/93759823744 OR Dial by your location Meeting ID: 937 5982 3744 +1 646 558 8656 US (New York) +1 301 715 8592 US (Germantown) +1 312 626 6799 US (Chicago) +1 669 900 9128 US (San Jose) +1 253 215 8782 US (Tacoma) +1 346 248 7799 US (Houston) Meeting ID: 937 5982 3744 Michael Elgin Director of Community Development MINTO COMMUNITIES - USA 4280 Tamiami Trail E, Ste 203/204, Naples, FL, 34112 T 239.896.1402 |C239.351.6951 A division of The Minto Group 9.A.2.d Packet Pg. 269 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 'DZQ5XVVHOO7R0LFKDHO(OJLQ&F&DUO$%DUUDFR:HV.D\QH6XEMHFW)OHLVFKPDQQUHVLGHQWFDOO/ƌĞĐĞŝǀĞĚĂƉŚŽŶĞĐĂůůĨƌŽŵdĞƌƌǇŽĐĂůŝƐǁŚŽůŝǀĞƐĂƚϯϬϮϰtŽŽĚƐŝĚĞǀĞ͘,ĞŚĂĚƐŽŵĞƋƵĞƐƚŝŽŶƐĂďŽƵƚǁŚĞƌĞƚŚĞĂŵĞŶĚŵĞŶƚĂƌĞĂǁĂƐ͕ǁŚŝĐŚ/ĞǆƉůĂŝŶĞĚǁĂƐƐŽƵƚŚŽĨƚŚĞŶĞǁůǇĐŽŶƐƚƌƵĐƚĞĚƌŽĂĚƚŽWĂƌĐĞůd͘,ĞĂůƐŽŚĂĚƚǁŽƋƵĞƐƚŝŽŶƐ/ǁĂƐŶ͛ƚƐƵƌĞŽĨƚŚĞĂŶƐǁĞƌ͗ϭ͘^ŽŵĞǁŽŽĚƐƌĞŵĂŝŶďĞƚǁĞĞŶDƌ͘ŽĐĂůŝƐ͛ŚŽŵĞĂŶĚƚŚĞŶĞǁWĂƌĐĞůdƌŽĂĚ͘,ĞǁĂŶƚƐƚŽŬŶŽǁŝĨƚŚŽƐĞǁŝůůƌĞŵĂŝŶ͘Ϯ͘tŚĂƚŝƐƚŚĞƚŝŵĞĨƌĂŵĞĨŽƌĐŽŶƐƚƌƵĐƚŝŽŶŶĞĂƌDƌ͘ŽĐĂůŝƐ͛ŚŽŵĞ͍,ŝƐĞŵĂŝů͗ƚĐŐŽŶĞΛŚŽƚŵĂŝů͘ĐŽŵ :ĞŶŶŝĨĞƌ^ĂƉĞŶ͕/WsŝĐĞWƌĞƐŝĚĞŶƚŽĨ>ĂŶĚWůĂŶŶŝŶŐĂƌƌĂĐŽĂŶĚƐƐŽĐŝĂƚĞƐ͕/ŶĐ͘ŝǀŝůŶŐŝŶĞĞƌƐΕ>ĂŶĚ^ƵƌǀĞǇŽƌƐΕ>ĂŶĚWůĂŶŶĞƌƐϮϮϳϭDĐ'ƌĞŐŽƌŽƵůĞǀĂƌĚ͕^ƵŝƚĞϭϬϬ&ŽƌƚDǇĞƌƐ͕&>ϯϯϵϬϭ;ϮϯϵͿϰϲϭͲϯϭϳϬWŚŽŶĞ;ϮϯϵͿϰϲϭͲϯϭϲϵ&ĂǆŚƚƚƉ͗ͬͬǁǁǁ͘ďĂƌƌĂĐŽ͘ŶĞƚ&ŝůĞ͗9.A.2.d Packet Pg. 270 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann From:Jennifer Sapen To:"Kelly McNab" Subject:RE: Sabal Bay Mixed Planned Unit Development Rezone (to include the Fleischmann Parcel) Neighborhood Information Meeting Date:Thursday, July 16, 2020 3:15:00 PM Attachments:23780 2020-07-10 Executed_Property owner letter for NIM.PDF Page two of the attached neighborhood notice letter provides instructions for the Zoom meeting. Jennifer Sapen, AICP Vice President of Land Planning Barraco and Associates, Inc. Civil Engineers ~ Land Surveyors ~ Land Planners 2271 McGregor Boulevard, Suite 100 Fort Myers, FL 33901 (239) 461-3170 Phone (239) 461-3169 Fax http://www.barraco.net File: From: Kelly McNab [mailto:Kellym@conservancy.org] Sent: Thursday, July 16, 2020 3:06 PM To: Jennifer Sapen <JenniferS@barraco.net> Subject: Sabal Bay Mixed Planned Unit Development Rezone (to include the Fleischmann Parcel) Neighborhood Information Meeting Good afternoon, The Conservancy of Southwest Florida is following this project and I was hoping to receive the Zoom information for the meeting tonight. Thank you, Kelly McNab Environmental Planning Specialist Conservancy of Southwest Florida 1495 Smith Preserve Way Naples, FL 34102 Phone (239) 262-0304 x267 Cell (239) 253-8372 Protecting Southwest Florida’s unique natural environment and quality of life…now and forever. www.conservancy.org 9.A.2.d Packet Pg. 271 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 'DZQ5XVVHOO7RGDOHODPEHUW#HPEDUTPDLOFRP:HV.D\QH6XEMHFW5(0LQWRPHHWLQJDW,VOHVRI&ROOLHU3UHVHUYH$WWDFKPHQWVB/RF0DSB$'BSGIdŚĂŶŬǇŽƵĨŽƌƌĞĂĐŚŝŶŐŽƵƚDƌ͘>ĂŵďĞƌƚ͕ĂŶĚĚŽŶ͛ƚĨĞĞůďĂĚĂďŽƵƚĂůĂĐŬŽĨŽŽŵĞǆƉĞƌŝĞŶĐĞʹŝƚ͛ƐŐŝǀĞŶŵĞƚŚĞƌƵŶĂƌŽƵŶĚŵŽƌĞƚŚĂŶŽŶĐĞ͘ĞĐĂƵƐĞŽĨƚŚĂƚ͕/͛ŵĂƐŬŝŶŐtĞƐǁŚŽŝƐĐĐ͛ĚŽŶƚŚŝƐĞŵĂŝůƚŽƌĞƐƉŽŶĚ͘dŚĞĂƚƚĂĐŚĞĚĂĞƌŝĂůůŽĐĂƚŝŽŶŵĂƉƐŚŽǁƐƚŚĞĂƌĞĂďĞŝŶŐĂĚĚĞĚƚŽ/ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞǁŝƚŚĂĐƌŽƐƐŚĂƚĐŚ͘KŶůǇƐŝŶŐůĞĨĂŵŝůǇĚĞƚĂĐŚĞĚĂŶĚĂƚƚĂĐŚĞĚ;ƚǁŝŶǀŝůůĂƐͿĂƌĞƉƌŽƉŽƐĞĚŝŶƚŚĞŶĞǁĂƌĞĂ͕ŶŽŵƵůƚŝĨĂŵŝůǇ͘ :ĞŶŶŝĨĞƌ^ĂƉĞŶ͕/WsŝĐĞWƌĞƐŝĚĞŶƚŽĨ>ĂŶĚWůĂŶŶŝŶŐĂƌƌĂĐŽĂŶĚƐƐŽĐŝĂƚĞƐ͕/ŶĐ͘ŝǀŝůŶŐŝŶĞĞƌƐΕ>ĂŶĚ^ƵƌǀĞǇŽƌƐΕ>ĂŶĚWůĂŶŶĞƌƐϮϮϳϭDĐ'ƌĞŐŽƌŽƵůĞǀĂƌĚ͕^ƵŝƚĞϭϬϬ&ŽƌƚDǇĞƌƐ͕&>ϯϯϵϬϭ;ϮϯϵͿϰϲϭͲϯϭϳϬWŚŽŶĞ;ϮϯϵͿϰϲϭͲϯϭϲϵ&ĂǆŚƚƚƉ͗ͬͬǁǁǁ͘ďĂƌƌĂĐŽ͘ŶĞƚ&ŝůĞ͗&ƌŽŵ͗ĚĂůĞůĂŵďĞƌƚΛĞŵďĂƌƋŵĂŝů͘ĐŽŵ΀ŵĂŝůƚŽ͗ĚĂůĞůĂŵďĞƌƚΛĞŵďĂƌƋŵĂŝů͘ĐŽŵ΁^ĞŶƚ͗dŚƵƌƐĚĂǇ͕:ƵůǇϭϲ͕ϮϬϮϬϮ͗ϮϭWDdŽ͗:ĞŶŶŝĨĞƌ^ĂƉĞŶф:ĞŶŶŝĨĞƌ^ΛďĂƌƌĂĐŽ͘ŶĞƚх^ƵďũĞĐƚ͗DŝŶƚŽŵĞĞƚŝŶŐĂƚ/ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞ/ŚĂǀĞŶŽƚǌŽŽŵĞĚĂƚƚŚŝƐƉŽŝŶƚŝŶƚŝŵĞ͘ĂŶ/ũƵƐƚǁĂƚĐŚĂŶĚůŝƐƚĞŶǁŝƚŚŽƵƚƚƵƌŶŝŶŐŽŶĐĂŵĞƌĂ͘/ĚŽŶŽƚŶĞĞĚƚŽƐƉĞĂŬ͘ŽǇŽƵũƵƐƚƐĞŶĚŵĞĂŶŝŶǀŝƚĞĂŶĚ/ŐŽĨƌŽŵƚŚĞƌĞ͘/ƌĞĐĞŝǀĞĚŝŶĨŽƌŵĂƚŝŽŶŝŶĂůĞƚƚĞƌĨƌŽŵĂƌƌĂĐŽĂďŽƵƚDŝŶƚŽĂĚĚŝŶŐƚŽŝƚ͛ƐWh͘/ĂŵŝŶƚĞƌĞƐƚĞĚƚŽŚĞƌĞǁŚĂƚƚŚĞǇŚĂǀĞƚŽƐĂǇ͘/ůŝǀĞŝŶƚŚĞŝƐůĞƐŽĨĐŽůůŝĞƌƉƌĞƐĞƌǀĞ͘9.A.2.d Packet Pg. 272 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann ĂůĞ>ĂŵďĞƌƚϲϴϬϱĞƋƵŝĂtĂǇEĂƉůĞƐĨůϯϰϭϭϯdŚĂŶŬƐ9.A.2.d Packet Pg. 273 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann From:Jennifer Sapen To:"dwight oakley" Cc:TaylorPenny Subject:RE: Fleischmann Parcel presentation Date:Wednesday, July 15, 2020 4:55:00 PM Thank you for reaching out Mr. Oakley. I will forward your questions to the team and we will address them during Thursday evening's presentation. Jennifer Sapen, AICP Vice President of Land Planning Barraco and Associates, Inc. Civil Engineers ~ Land Surveyors ~ Land Planners 2271 McGregor Boulevard, Suite 100 Fort Myers, FL 33901 (239) 461-3170 Phone (239) 461-3169 Fax http://www.barraco.net File: -----Original Message----- From: dwight oakley [mailto:dwight@dwightoakley.com] Sent: Wednesday, July 15, 2020 4:51 PM To: Jennifer Sapen <JenniferS@barraco.net> Cc: TaylorPenny <Penny.Taylor@CollierCountyFL.Gov> Subject: Fleischmann Parcel presentation Hi Jennifer, Thank you for making the upcoming presentation accessible through Zoom. As a full-time resident of South Bayshore (that portion of Bayshore Dr. that is South of Thomasson) and a member of the Bayshore CRA Advisory Board I have a couple of questions regarding the proposed subject property rezoning to allow an additional 230 dwelling units to be added to the Sabal Bay MUPUD. 1. Are you presenting updated & revised “Trip Generation” traffic count per the County’s request - that would be specific to the Fleischmann Parcel? 2. Would you please present a “Trip Generation” count that includes both that of the Fleischmann property and the existing Sabal Bay parcel that lies West of So. Bayshore Dr.? It would helpful and fair for everyone to be aware of the projected total number of vehicles being generated by this combination. 3. Would you explain how you arrive at a “Peak Hour” volume of traffic for a luxury life-style community vs a standard multi-family community? 4. When the original Sabal Bay community was approved by the County, the basis for the internal road link from, what is now, Antigua Way to So. Bayshore was to allow Isle residents East of So. Bayshore to cross easily over to the Isle community West of So. Bayshore and continue to the Hamilton Harbor Yacht Club. Therefore, the planned roadway exiting out the Isle’s onto Hamilton Ave. completes the original request for access to an attractive local amenity. 9.A.2.d Packet Pg. 274 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann My point here is that residents in the Bayshore and So. Bayshore community were given the impression, per Sabal Bay, that the internal road link was not intended to put daily traffic from the Isles onto So. Bayshore Dr.. The request for rezoning does the opposite - it turns So. Bayshore specifically into a “cut-through” street. What value does having this new traffic bring to the neighborhood? This is important because the proposed rezoning and its associated traffic now puts the Bayshore and So. Bayshore neighborhood quality of life, property values, recent improvements in crime reduction, proposed new community assets and sense of place in question. Do you think 70 + automobiles using So. Bayshore Dr. during a peak hour is a good idea? This number does not include existing typical neighborhood traffic. 5. Onto something else - if the rezoning request is approved and construction begins, will the Isle’s once again use “WIDE-LOAD” semi-trailer trucks that measure 12’ in width on So. Bayshore (with road lanes of 10’) to remove tree debris from their working site? If so, will the Isle’s commit to working with the County Transportation/ Roads & Bridges Department to document the road status of So. Bayshore Dr. before and after such use by heavy transportation equipment? 6. If, at any point in time, the daily traffic count generated by the Isle’s residents on So. Bayshore results in a higher trip generation than expected or an unmanageable traffic condition evolves - how would the Isle community be willing to help the Bayshore CRA and the County to resolve the problem? 7. Will the So. Bayshore residents ever be exposed to daily construction traffic during the start up and completion of either two projects - Fleischmann and the 69 dwelling unit Isle community West of So. Bayshore Dr.? If not, please explain how this will be accomplished - if yes, please explain as well. Contact me if you have any questions or comments. Sincerely, Dwight 9.A.2.d Packet Pg. 275 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann From:Jennifer Sapen To:"Michael Elgin" Subject:RE: New voicemail 1 from Big Table Room <221> Date:Monday, July 13, 2020 4:07:00 PM I called and left a voicemail explaining that the meeting will be available via zoom or conference call dial-in number, and that they should be receiving mailers tomorrow and an email blast to ICP residents from Minto. Jennifer Sapen, AICP Vice President of Land Planning Barraco and Associates, Inc. Civil Engineers ~ Land Surveyors ~ Land Planners 2271 McGregor Boulevard, Suite 100 Fort Myers, FL 33901 (239) 461-3170 Phone (239) 461-3169 Fax http://www.barraco.net File: -----Original Message----- From: Michael Elgin [mailto:MElgin@mintousa.com] Sent: Monday, July 13, 2020 3:18 PM To: Jennifer Sapen <JenniferS@barraco.net> Subject: RE: New voicemail 1 from Big Table Room <221> Can you return his call and have him provide you with an email so that we can make sure he receives and electronic version of the revised notice providing the virtual option. Thanks. Michael Elgin Director of Community Development Minto Communities - USA 4280 Tamiami Trail E, Ste 203/204, Naples, FL, 34112 T 239.896.1402 | F 239.529.5290 minto.com -----Original Message----- From: Jennifer Sapen <JenniferS@barraco.net> Sent: Monday, July 13, 2020 2:31 PM To: Michael Elgin <MElgin@mintousa.com> Subject: FW: New voicemail 1 from Big Table Room <221> Voicemail from Mark Desantis requesting a zoom meeting / dial-in meeting. Jennifer Sapen, AICP Vice President of Land Planning Barraco and Associates, Inc. Civil Engineers ~ Land Surveyors ~ Land Planners 2271 McGregor Boulevard, Suite 100 Fort Myers, FL 33901 (239) 461-3170 Phone 9.A.2.d Packet Pg. 276 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann (239) 461-3169 Fax https://linkprotect.cudasvc.com/url? a=http%3a%2f%2fwww.barraco.net&c=E,1,4mAWk1KNpIibrYa0pfuWnAWUgqx- 7In5JmElBJ_KS0nIJEVDYYunZyrkXUkNk- JeSsJuU6JCLIPnNeqK3mi1ft7BRlN3Dv9233xS5TWEI_uoUGpQRxdG1lQ,&typo=1 File: -----Original Message----- From: vm@star2star.com [mailto:vm@star2star.com] Sent: Monday, July 13, 2020 9:28 AM To: Jennifer Sapen <JenniferS@barraco.net> Subject: New voicemail 1 from Big Table Room <221> Jennifer Sapen: Your Star2Star phone system received a 55 second long voicemail message from Big Table Room <221>, on Monday, July 13, 2020 at 09:26:42 AM. This email message has been sent to advise you of this waiting voicemail message. You may check this voicemail message by dialing into your Star2Star phone system or you may play the attached sound file. ________________________________ In order to use electronic files provided by Barraco and Associates, Inc. you must agree to the following: In accepting and utilizing any drawings or other electronic data provided by Barraco and Associates, Inc., the recipient agrees that all such drawings and data are instruments of service of Barraco and Associates, Inc. who shall be deemed the author of the drawings and data, and shall retain all common law, statutory and other rights, including copyrights. Any inconsistencies the recipient discovers will be reported to Barraco and Associates, Inc. and will be corrected by Barraco and Associates, Inc. The recipient accepts responsibility for confirming with Barraco and Associates, Inc. that the electronic file is current at the time of use by the recipient. The recipient also agrees to hold Barraco and Associates, Inc. harmless for any cost or damages incurred due to the recipient's use of an outdated electronic file and for any costs associated with updating the recipient's electronic files in the event of future revisions by Barraco and Associates, Inc. The recipient agrees not to use these drawings and data, in whole or in part, for any purpose or project other than the project which is the subject of this agreement, nor shall the recipient provide that attached data to any other party not indicated as a recipient in the "To" field of this message. The recipient agrees to waive all claims against Barraco and Associates, Inc. resulting in any way from any unauthorized changes or reuse of the drawings and data for any other project by anyone other than Barraco and Associates, Inc. In addition, the recipient agrees, to the fullest extent permitted by law, to indemnify and hold Barraco and Associates, Inc. harmless from any damage, liability or costs, including reasonable attorney fees and costs of defense, arising from any changes made by anyone other than Barraco and Associates, Inc. or from any reuse of the drawings and data without the prior written consent of Barraco and Associates, Inc. 9.A.2.d Packet Pg. 277 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann From:Jennifer Sapen To:"Gary Lubben" Subject:RE: Zoom NIM 7/16/2020 Date:Wednesday, July 15, 2020 2:55:00 PM Attachments:23780 2020-07-10 Executed_Property owner letter for NIM.PDF Good afternoon Mr. Lubben. Please find attached the letter that was distributed to property owners within 500' of the subject property. The top of the second page provides login information for the Zoom meeting as well as phone numbers if you prefer to call in. Thank you, Jennifer Sapen, AICP Vice President of Land Planning Barraco and Associates, Inc. Civil Engineers ~ Land Surveyors ~ Land Planners 2271 McGregor Boulevard, Suite 100 Fort Myers, FL 33901 (239) 461-3170 Phone (239) 461-3169 Fax http://www.barraco.net File: -----Original Message----- From: Gary Lubben [mailto:glubben1@mac.com] Sent: Wednesday, July 15, 2020 12:43 PM To: Jennifer Sapen <JenniferS@barraco.net> Subject: Zoom NIM 7/16/2020 Please send me Zoom meeting details so I can attend virtually. Gary Lubben 9.A.2.d Packet Pg. 278 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 'DZQ5XVVHOO7R*DU\5\DQ6XEMHFW5(3/38'5H]RQLQJ,QTXLU\5HVSRQVH$WWDFKPHQWV([HFXWHGB3URSHUW\RZQHUOHWWHUIRU1,03')ĞŝŶŐŽƵƚŽĨƐƚĂƚĞǇŽƵŵĂǇŶŽƚŚĂǀĞǇĞƚƌĞĐĞŝǀĞĚƚŚĞƐĞĐŽŶĚůĞƚƚĞƌǁĞŵĂŝůĞĚůĂƐƚ&ƌŝĚĂǇ͘tĞĂĚĚĞĚĂǌŽŽŵŽƉƚŝŽŶ͘zŽƵƌƋƵĞƐƚŝŽŶƐǁŝůůďĞƐƚĂŶƐǁĞƌĞĚďǇůŽŐŐŝŶŐŽŶƵƐŝŶŐƚŚĞŝŶĨŽƌŵĂƚŝŽŶŽŶƚŚĞƐĞĐŽŶĚƉĂŐĞ͘/ƚ͛ƐŶŽƚƐƚĂŶĚĂƌĚƉƌŽƚŽĐŽůƚŽƐĞŶĚŽƵƚĂƐĞĐŽŶĚůĞƚƚĞƌŽƌĐŽŶĚƵĐƚŵĞĞƚŝŶŐƐŽŶŽŽŵ͕ďƵƚŶŽƚŚŝŶŐƐĞĞŵƐƚŽĨŽůůŽǁŶŽƌŵĂůƐƚĂŶĚĂƌĚƐĂŶǇŵŽƌĞ͘ :ĞŶŶŝĨĞƌ^ĂƉĞŶ͕/WsŝĐĞWƌĞƐŝĚĞŶƚŽĨ>ĂŶĚWůĂŶŶŝŶŐĂƌƌĂĐŽĂŶĚƐƐŽĐŝĂƚĞƐ͕/ŶĐ͘ŝǀŝůŶŐŝŶĞĞƌƐΕ>ĂŶĚ^ƵƌǀĞǇŽƌƐΕ>ĂŶĚWůĂŶŶĞƌƐϮϮϳϭDĐ'ƌĞŐŽƌŽƵůĞǀĂƌĚ͕^ƵŝƚĞϭϬϬ&ŽƌƚDǇĞƌƐ͕&>ϯϯϵϬϭ;ϮϯϵͿϰϲϭͲϯϭϳϬWŚŽŶĞ;ϮϯϵͿϰϲϭͲϯϭϲϵ&ĂǆŚƚƚƉ͗ͬͬǁǁǁ͘ďĂƌƌĂĐŽ͘ŶĞƚ&ŝůĞ͗&ƌŽŵ͗'ĂƌǇZǇĂŶ΀ŵĂŝůƚŽ͗ŐƌǇĂŶ͘ϮϮϴϯΛŐŵĂŝů͘ĐŽŵ΁^ĞŶƚ͗dŚƵƌƐĚĂǇ͕:ƵůǇϭϲ͕ϮϬϮϬϭϭ͗ϮϭDdŽ͗:ĞŶŶŝĨĞƌ^ĂƉĞŶф:ĞŶŶŝĨĞƌ^ΛďĂƌƌĂĐŽ͘ŶĞƚх^ƵďũĞĐƚ͗ZĞ͗W>ϮϬϭϵϬϬϬϮϯϬϱͲWhZĞǌŽŶŝŶŐ/ŶƋƵŝƌǇZĞƐƉŽŶƐĞ7K[-HQQLIHU,ZLOOQRWEHDWWHQGLQJDV,DPFXUUHQWO\RXWRIWKH6WDWH,I\RXKDYHH[KLELWV\RXFDQVKDUHZLWKPHWKDWZRXOGEHJUHDW2Q7KX-XODW$0-HQQLIHU6DSHQ-HQQLIHU6#EDUUDFRQHW!ZURWHdŚĂŶŬǇŽƵDƌ͘ZǇĂŶ͘tĞŚĂǀĞĂĨĞǁĞǆŚŝďŝƚƐĂŶĚůĂŶĚƉůĂŶƐƚŚĂƚǁĞǁŝůůďĞƉƌĞƐĞŶƚŝŶŐĂƚƚŽŶŝŐŚƚ͛ƐŵĞĞƚŝŶŐ͘/ŚĂǀĞĂĚĚĞĚǇŽƵƌƋƵĞƐƚŝŽŶƚŽƚŚĞƉƌĞƐĞŶƚĂƚŝŽŶĂŶĚŝƚǁŝůůďĞĂŶƐǁĞƌĞĚ͘9.A.2.d Packet Pg. 279 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann :ĞŶŶŝĨĞƌ^ĂƉĞŶ͕/WsŝĐĞWƌĞƐŝĚĞŶƚŽĨ>ĂŶĚWůĂŶŶŝŶŐĂƌƌĂĐŽĂŶĚƐƐŽĐŝĂƚĞƐ͕/ŶĐ͘ŝǀŝůŶŐŝŶĞĞƌƐΕ>ĂŶĚ^ƵƌǀĞǇŽƌƐΕ>ĂŶĚWůĂŶŶĞƌƐϮϮϳϭDĐ'ƌĞŐŽƌŽƵůĞǀĂƌĚ͕^ƵŝƚĞϭϬϬ&ŽƌƚDǇĞƌƐ͕&>ϯϯϵϬϭ;ϮϯϵͿϰϲϭͲϯϭϳϬWŚŽŶĞ;ϮϯϵͿϰϲϭͲϯϭϲϵ&ĂǆŚƚƚƉ͗ͬͬǁǁǁ͘ďĂƌƌĂĐŽ͘ŶĞƚ&ŝůĞ͗&ƌŽŵ͗:ƵůŝĞĂŶŝĞůĞǁƐŬŝ^ĞŶƚ͗&ƌŝĚĂǇ͕:ƵůǇϭϬ͕ϮϬϮϬϴ͗ϭϵDdŽ͗:ĞŶŶŝĨĞƌ^ĂƉĞŶф:ĞŶŶŝĨĞƌ^ΛďĂƌƌĂĐŽ͘ŶĞƚхĐ͗>ĂƵƌĂ͘Ğ:ŽŚŶΛĐŽůůŝĞƌĐŽƵŶƚǇĨů͘ŐŽǀ͖'ĂƌǇZǇĂŶфŐƌǇĂŶ͘ϮϮϴϯΛŐŵĂŝů͘ĐŽŵх͖&ŝůĞфĨŝůĞΛďĂƌƌĂĐŽ͘ŶĞƚх^ƵďũĞĐƚ͗Z͗W>ϮϬϭϵϬϬϬϮϯϬϱͲWhZĞǌŽŶŝŶŐ/ŶƋƵŝƌǇZĞƐƉŽŶƐĞ:ĞŶͲWůĞĂƐĞƐĞĞĞŵĂŝůďĞůŽǁ͘WůĞĂƐĞĂĚǀŝƐĞ͘9.A.2.d Packet Pg. 280 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann dŚĂŶŬǇŽƵ͕:ƵůŝĞ&ƌŽŵ͗'ĂƌǇZǇĂŶ΀ŵĂŝůƚŽ͗ŐƌǇĂŶ͘ϮϮϴϯΛŐŵĂŝů͘ĐŽŵ΁^ĞŶƚ͗dƵĞƐĚĂǇ͕:ƵůǇϬϳ͕ϮϬϮϬϭϬ͗ϱϰDdŽ͗:ƵůŝĞĂŶŝĞůĞǁƐŬŝф:ƵůŝĞΛďĂƌƌĂĐŽ͘ŶĞƚхĐ͗>ĂƵƌĂ͘Ğ:ŽŚŶΛĐŽůůŝĞƌĐŽƵŶƚǇĨů͘ŐŽǀ͖:ĞŶŶŝĨĞƌ^ĂƉĞŶф:ĞŶŶŝĨĞƌ^ΛďĂƌƌĂĐŽ͘ŶĞƚх͖&ŝůĞфĨŝůĞΛďĂƌƌĂĐŽ͘ŶĞƚх^ƵďũĞĐƚ͗ZĞ͗W>ϮϬϭϵϬϬϬϮϯϬϱͲWhZĞǌŽŶŝŶŐ/ŶƋƵŝƌǇZĞƐƉŽŶƐĞ-XOLH,MXVWUHFHLYHGFRUUHVSRQGHQFHGDWHGIURP\RXUILUP,WGHVFULEHVDFKDQJHWRWKH38'H[WHQGLQJDFUHDJHDQGDGGLQJSODQQHGGZHOOLQJXQLWV,VWKHUHDPDSGUDZLQJDYDLODEOHWKDWVKRZVWKHUHYLVHGSODQ"7K[*DU\5\DQ,VOHVRI&ROOLHU2Q0DUDW$0-XOLH'DQLHOHZVNL-XOLH'#EDUUDFRQHW!ZURWH'ƌĞĂƚ͘dŚĞƌĞǁĂƐĂĐŽŶĐĞƉƚƵĂůƉůĂŶƐƵďŵŝƚƚĞĚ͘ĞƚĂŝůĞŶŐŝŶĞĞƌĞĚĚƌĂǁŝŶŐƐǁŽƵůĚĐŽŵĞĂƚĂůĂƚĞƌƐƚĂŐĞŝŶĚĞǀĞůŽƉŵĞŶƚ͘^ŝŶĐĞƌĞůǇ͕9.A.2.d Packet Pg. 281 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann :ƵůŝĞ&ƌŽŵ͗'ĂƌǇZǇĂŶ΀ŵĂŝůƚŽ͗ŐƌǇĂŶ͘ϮϮϴϯΛŐŵĂŝů͘ĐŽŵ΁^ĞŶƚ͗&ƌŝĚĂǇ͕DĂƌĐŚϬϲ͕ϮϬϮϬϭϭ͗ϬϭDdŽ͗:ƵůŝĞĂŶŝĞůĞǁƐŬŝф:ƵůŝĞΛďĂƌƌĂĐŽ͘ŶĞƚхĐ͗>ĂƵƌĂ͘Ğ:ŽŚŶΛĐŽůůŝĞƌĐŽƵŶƚǇĨů͘ŐŽǀ͖:ĞŶŶŝĨĞƌ^ĂƉĞŶф:ĞŶŶŝĨĞƌ^ΛďĂƌƌĂĐŽ͘ŶĞƚх͖&ŝůĞфĨŝůĞΛďĂƌƌĂĐŽ͘ŶĞƚх^ƵďũĞĐƚ͗ZĞ͗W>ϮϬϭϵϬϬϬϮϯϬϱͲWhZĞǌŽŶŝŶŐ/ŶƋƵŝƌǇZĞƐƉŽŶƐĞ-XOLHWKDQN\RXIRUWKHLQIRUPDWLRQLWZDVYHU\KHOSIXO4XHVWLRQIRU\RX,GLGQRWVHHDORWVSHFLILFGUDZLQJIRUWKHVLWHQRUDURDGSODQ$UHWKH\DSDUWRIWKHVXEPLVVLRQDYDLODEOHRQOLQH"*DU\2Q0DUDW$0-XOLH'DQLHOHZVNL-XOLH'#EDUUDFRQHW!ZURWHDƌ͘ZǇĂŶ͕dŚĂŶŬǇŽƵĨŽƌǇŽƵƌĂƚƚĞŶƚŝŽŶŝŶƚŚŝƐŵĂƚƚĞƌ͘WƌŽǀŝĚĞĚďĞůŽǁŝƐĂůŝŶŬƚŽƚŚĞŽůůŝĞƌŽƵŶƚǇĨŝůĞŽŶƚŚĞƉƌŽƉŽƐĞĚĂŵĞŶĚŵĞŶƚ͘'ĞŶĞƌĂůůǇ͕ƚŚĞĂŵĞŶĚŵĞŶƚƐĞĞŬƐƚŽĞǆƉĂŶĚƚŚĞ/ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞ͘dŚĞĂĚĚŝƚŝŽŶĂůƉƌŽũĞĐƚĂƌĞĂǁŝůůďĞĂĐŽŶƚŝŶƵĂƚŝŽŶŽĨƚŚĞŚŝŐŚƋƵĂůŝƚǇƌĞƐŝĚĞŶƚŝĂůĚĞǀĞůŽƉŵĞŶƚƚŚĞ/ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞƐĞŶũŽǇƐƚŽĚĂǇ͘dŚĞŝŶĨŽƌŵĂƚŝŽŶǁŝƚŚŝŶƚŚĞŽƵŶƚǇĨŝůĞƐŽƵƚůŝŶĞƐƚŚĞƌĞƋƵĞƐƚĞĚĐŚĂŶŐĞƐ͕ĂƐǁĞůůĂƐƚŚĞĞŶǀŝƌŽŶŵĞŶƚĂůŝŶĨŽƌŵĂƚŝŽŶ͘9.A.2.d Packet Pg. 282 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann dŚĞEĞŝŐŚďŽƌŚŽŽĚ/ŶĨŽƌŵĂƚŝŽŶDĞĞƚŝŶŐ;E/DͿŽŶDĂƌĐŚϭϴƚŚŝƐŶŽƚǇŽƵƌŽŶůǇŽƉƉŽƌƚƵŶŝƚǇƚŽŽƉŝŶĞŽŶƚŚĞĂŵĞŶĚŵĞŶƚ͘dǁŽƉƵďůŝĐŚĞĂƌŝŶŐƐǁŝůůďĞŚĞůĚ͖ƚŚĞĨŝƌƐƚǁŝƚŚŽůůŝĞƌŽƵŶƚǇWůĂŶŶŝŶŐΘŽŶŝŶŐŽŵŵŝƐƐŝŽŶ͕ƚŚĞƐĞĐŽŶĚĂƚƚŚĞŽĂƌĚŽĨŽƵŶƚǇŽŵŵŝƐƐŝŽŶĞƌƐ͘ƐǁŝƚŚƚŚĞE/DŶŽƚŝĐĞ͕ǇŽƵǁŝůůĂůƐŽďĞŶŽƚŝĨŝĞĚǀŝĂŵĂŝůŽŶƚŚĞŶĞǆƚƉƵďůŝĐŚĞĂƌŝŶŐĚĂƚĞ͘ŚƚƚƉƐ͗ͬͬĐǀƉŽƌƚĂů͘ĐŽůůŝĞƌĐŽƵŶƚǇĨů͘ŐŽǀͬŝƚǇsŝĞǁtĞďͬWůĂŶŶŝŶŐͬ^ƚĂƚƵƐ͍ƉůĂŶŶŝŶŐ/ĚсϯϬϮϰϰdŚĞWůĂŶŶŝŶŐWƌŽũĞĐƚƉƉůŝĐĂƚŝŽŶEƵŵďĞƌŝƐ͗W>ϮϬϭϵϬϬϬϮϯϬϱĨŽƌǇŽƵƌƵƐĞ͘dŚĞůŝŶŬŵĂǇƌĞƋƵŝƌĞǇŽƵƚŽƉƵƚŝŶĂĐŽĚĞƚŽŵĂŬĞƐƵƌĞǇŽƵĂƌĞŚƵŵĂŶ͕ŽŶĐĞƚŚĞĐŽĚĞŝƐĐŽŵƉůĞƚĞĚĐŽƌƌĞĐƚůǇ͕ǇŽƵƐŚŽƵůĚďĞĂďůĞƚŽƌĞǀŝĞǁƚŚĞƉƌŽũĞĐƚĂŶĚĂůůĚŽĐƵŵĞŶƚƐƐƵďŵŝƚƚĞĚ͘^ŝŶĐĞƌĞůǇ͕:ƵůŝĞĂŶŝĞůĞǁƐŬŝƐƐŝƐƚĂŶƚWƌŽũĞĐƚDĂŶĂŐĞƌĂƌƌĂĐŽŶĚƐƐŽĐŝĂƚĞƐ͕/ŶĐ͘ŝǀŝůŶŐŝŶĞĞƌƐΕ>ĂŶĚ^ƵƌǀĞǇŽƌƐΕWůĂŶŶĞƌƐϮϮϳϭDĐ'ƌĞŐŽƌůǀĚ͘&ŽƌƚDǇĞƌƐ͕&>ϯϯϵϬϭ;ϮϯϵͿϰϲϭͲϯϭϳϬDĂŝŶ;ϮϯϵͿϰϲϭͲϯϭϲϵ&Ăǆ9.A.2.d Packet Pg. 283 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann From:Jennifer Sapen To:"Kelvin Cross" Subject:RE: Neighborhood Information Meeting Date:Friday, July 17, 2020 9:57:00 AM Congratulations on your new home and thank you for dropping a note. Nice to hear positive feedback. I will pass it along to the team. Jennifer Sapen, AICP Vice President of Land Planning Barraco and Associates, Inc. Civil Engineers ~ Land Surveyors ~ Land Planners 2271 McGregor Boulevard, Suite 100 Fort Myers, FL 33901 (239) 461-3170 Phone (239) 461-3169 Fax http://www.barraco.net File: From: Kelvin Cross [mailto:kelvincross@aol.com] Sent: Thursday, July 16, 2020 8:07 PM To: Jennifer Sapen <JenniferS@barraco.net> Subject: Re: Neighborhood Information Meeting Thanks for the information meeting. As a future resident of Union Island Way please keep it up and keep us informed. Minto’s acquisition of the property and build out of more ICP units is clearly a benefit to the current residents. Having another developer a potentially develop an incompatible lesser community is not in our interest. Kelvin Cross Sent from my iPad On Jul 13, 2020, at 2:35 PM, Isles Of Collier Preserve <tkaknevicius@accessdifference.com> wrote: Fleischmann Parcel Neighborhood Information Meeting Updated Notice with Virtual Participation Option Dear Property Owner: Please be advised that a formal application has been submitted to Collier County seeking 9.A.2.d Packet Pg. 284 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann approval of a PUD Rezone for the following described property: Fleischmann Parcel: Property ID Numbers 61838201007, 61838200008, 61838160009, 61838120007, 61838080008 The petitioner is asking the County to approve this application to rezone the subject property to be included within the Sabal Bay MPUD boundary and allow development of up to 230 dwelling units on the described property. TITLE An Ordinance of the Board of County Commissioners of Collier County, Florida amending Ordinance No. 05-59, Sabal Bay Mixed Used Planned Unit Development (MPUD), to change the PUD boundary and to increase acreage from 2,416.49 to 2,518.98 and the maximum number of dwelling units from 1,999 to 2,229; and providing an effective date. The subject property is located on the east side of Bayshore Drive less than one mile south of Thomasson Drive. Legal Description: Lots 81 – 90, inclusive, Naples Grove and Truck Company’s Little Farms No.2, according to plat thereof as recorded in Plat Book 1, Page 27A, Public Records of Collier County, Florida. [PL20190002305] In compliance with the Land Development Code requirements, a Neighborhood Information Meeting will be held to provide you an opportunity to become fully aware of our development intentions and to give you an opportunity to influence the form of development. The Neighborhood Information Meeting will be held at the following date and time: Thursday July 16, 2020 at 5:30 p.m. at Isles of Collier Preserve Clubhouse (Multi-Purpose Room), located at 5570 Tobago Blvd, Naples, FL 34113. Due to social distancing a second session may be held, immediately after the first, if all attendees are unable to be accommodated in the first session. If you are not able to attend the meeting in person, we will also be conducting the meeting simultaneously through Zoom. If you will be attending via Zoom and have specific questions you would like answered please email them to JenniferS@Barraco.net<mailto:JenniferS@Barraco.net> prior to the meeting. The zoom meeting information is: https://zoom.us/j/93759823744 OR Dial by your location Meeting ID: 937 5982 3744 +1 646 558 8656 US (New York) +1 301 715 8592 US (Germantown) +1 312 626 6799 US (Chicago) +1 669 900 9128 US (San Jose) +1 253 215 8782 US (Tacoma) +1 346 248 7799 US (Houston) SUBJECT PROPERTY 9.A.2.d Packet Pg. 285 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann If you are unable to attend this meeting, but have questions or comments, they can be directed by mail, phone, fax or e-mail by August 15, 2020 to: Jennifer Sapen, AICP Barraco and Associates, Inc. 2271 McGregor Blvd, Suite 100 Fort Myers, Florida 33901 Fax: (239) 461-3169 JenniferS@Barraco.net<mailto:JenniferS@Barraco.net> Phone: (239) 461-3170 At this meeting the petitioner will make every effort to illustrate how the property will be developed and to answer any questions. RSVP Requested For All Who Wish To Attend In Person! ,VOHV2I&ROOLHU3UHVHUYH_7REDJR%OYG1DSOHV 1DSOHV)/ 8QVXEVFULEHNHOYLQFURVV#DROFRP 9.A.2.d Packet Pg. 286 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 8SGDWH3URILOH_$ERXW&RQVWDQW&RQWDFW 6HQWE\WNDNQHYLFLXV#DFFHVVGLIIHUHQFHFRP 9.A.2.d Packet Pg. 287 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann From:Jennifer Sapen To:"Michael Elgin" Subject:RE: New voicemail 1 from Nancy VanBuskirk <201> Date:Monday, July 13, 2020 4:09:00 PM I called and left a voicemail explaining that the meeting will be available via zoom or conference call dial-in number, and that they should be receiving mailers tomorrow and an email blast to ICP residents from Minto. Jennifer Sapen, AICP Vice President of Land Planning Barraco and Associates, Inc. Civil Engineers ~ Land Surveyors ~ Land Planners 2271 McGregor Boulevard, Suite 100 Fort Myers, FL 33901 (239) 461-3170 Phone (239) 461-3169 Fax http://www.barraco.net File: -----Original Message----- From: Michael Elgin [mailto:MElgin@mintousa.com] Sent: Monday, July 13, 2020 3:28 PM To: Jennifer Sapen <JenniferS@barraco.net> Subject: FW: New voicemail 1 from Nancy VanBuskirk <201> Same thing with this one. Can you return the call and then provide the updated notice via email to this resident. Thanks. Michael Elgin Director of Community Development Minto Communities - USA 4280 Tamiami Trail E, Ste 203/204, Naples, FL, 34112 T 239.896.1402 | F 239.529.5290 minto.com -----Original Message----- From: Jennifer Sapen <JenniferS@barraco.net> Sent: Tuesday, July 7, 2020 8:07 PM To: Michael Elgin <MElgin@mintousa.com> Subject: FW: New voicemail 1 from Nancy VanBuskirk <201> Another resident asking about the NIM to be conducted online. Jennifer Sapen, AICP Vice President of Land Planning Barraco and Associates, Inc. Civil Engineers ~ Land Surveyors ~ Land Planners 2271 McGregor Boulevard, Suite 100 Fort Myers, FL 33901 (239) 461-3170 Phone (239) 461-3169 Fax https://linkprotect.cudasvc.com/url?a=http%3a%2f%2fwww.barraco.net&c=E,1,VZ6-ddprJsgsyv2204Zjs- P31T3fMWnA4I4cfcHc7Cg47A6jWSOTYN9MK8cyCTzaYjRy32kOIwmTNvnBUoPqNqWV2AjcFYVGFnAabMcLhUtL_OeITgYEvBc,&typo=1 File: -----Original Message----- From: vm@star2star.com [mailto:vm@star2star.com] Sent: Tuesday, July 07, 2020 2:41 PM To: Jennifer Sapen <JenniferS@barraco.net> Subject: New voicemail 1 from Nancy VanBuskirk <201> Jennifer Sapen: Your Star2Star phone system received a 43 second long voicemail message from Nancy VanBuskirk <201>, on Tuesday, July 07, 2020 at 02:40:33 PM. 9.A.2.d Packet Pg. 288 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann This email message has been sent to advise you of this waiting voicemail message. You may check this voicemail message by dialing into your Star2Star phone system or you may play the attached sound file. ________________________________ In order to use electronic files provided by Barraco and Associates, Inc. you must agree to the following: In accepting and utilizing any drawings or other electronic data provided by Barraco and Associates, Inc., the recipient agrees that all such drawings and data are instruments of service of Barraco and Associates, Inc. who shall be deemed the author of the drawings and data, and shall retain all common law, statutory and other rights, including copyrights. Any inconsistencies the recipient discovers will be reported to Barraco and Associates, Inc. and will be corrected by Barraco and Associates, Inc. The recipient accepts responsibility for confirming with Barraco and Associates, Inc. that the electronic file is current at the time of use by the recipient. The recipient also agrees to hold Barraco and Associates, Inc. harmless for any cost or damages incurred due to the recipient's use of an outdated electronic file and for any costs associated with updating the recipient's electronic files in the event of future revisions by Barraco and Associates, Inc. The recipient agrees not to use these drawings and data, in whole or in part, for any purpose or project other than the project which is the subject of this agreement, nor shall the recipient provide that attached data to any other party not indicated as a recipient in the "To" field of this message. The recipient agrees to waive all claims against Barraco and Associates, Inc. resulting in any way from any unauthorized changes or reuse of the drawings and data for any other project by anyone other than Barraco and Associates, Inc. In addition, the recipient agrees, to the fullest extent permitted by law, to indemnify and hold Barraco and Associates, Inc. harmless from any damage, liability or costs, including reasonable attorney fees and costs of defense, arising from any changes made by anyone other than Barraco and Associates, Inc. or from any reuse of the drawings and data without the prior written consent of Barraco and Associates, Inc. 9.A.2.d Packet Pg. 289 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 'DZQ5XVVHOO)URP0LFKDHO(OJLQ0(OJLQ#PLQWRXVDFRP!6HQW0RQGD\-XO\$07RULFNFDODFFL&F'RQQD)LDOD#FROOLHUFRXQW\IOJRY$QG\6ROLV#FROOLHUFRXQW\IOJRY%XUW6DXQGHUV#FROOLHUFRXQW\IOJRY3HQQ\7D\ORU#FROOLHUFRXQW\IOJRY%LOO0F'DQLHO#FROOLHUFRXQW\IOJRY-HQQLIHU6DSHQ6XEMHFW5()OHLVFKPDQQ3URSHUW\$WWDFKPHQWV([HFXWHGB3URSHUW\RZQHUOHWWHUIRU1,03')'ŽŽĚDŽƌŶŝŶŐ͕DŝŶƚŽ͛ƐŽŶƐƵůƚŝŶŐƚĞĂŵŚĂƐďĞĞŶĐŽŽƌĚŝŶĂƚŝŶŐǁŝƚŚŽƵŶƚǇ^ƚĂĨĨŽǀĞƌƚŚĞƉĂƐƚǁĞĞŬƚŽĂĚĚƌĞƐƐƚŚĞĐŽŶĐĞƌŶƐǇŽƵŚĂǀĞĐŝƚĞĚďĞůŽǁ͘tĞƵŶĚĞƌƐƚĂŶĚƚŚĞƐĞĂƌĞƵŶŝƋƵĞƚŝŵĞƐǁŚŝĐŚĂƌĞĐŽŶƐƚĂŶƚůǇĐŚĂŶŐŝŶŐĂŶĚǁĂŶƚƚŽĞŶƐƵƌĞƚŚĂƚƚŚĞƉƌŽĐĞƐƐƉƌŽǀŝĚĞƐƚŚĞŽƉƉŽƌƚƵŶŝƚǇƚŽďĞŝŶĨŽƌŵĞĚĂŶĚƉĂƌƚŝĐŝƉĂƚĞŝŶƚŚĞƐĂĨĞƐƚĞŶǀŝƌŽŶŵĞŶƚƉŽƐƐŝďůĞ͘ƌĞǀŝƐĞĚŶŽƚŝĐĞǁĂƐŵĂŝůĞĚŽŶϳͬϭϬͬϮϬϮϬƉƌŽǀŝĚŝŶŐĂǀŝƌƚƵĂůƉĂƌƚŝĐŝƉĂƚŝŽŶŽƉƚŝŽŶĨŽƌƚŚĞEĞŝŐŚďŽƌŚŽŽĚ/ŶĨŽƌŵĂƚŝŽŶDĞĞƚŝŶŐ͘tĞĂƌĞĂůƐŽƌĞƋƵĞƐƚŝŶŐƚŚĂƚƋƵĞƐƚŝŽŶƐďĞƉƌŽǀŝĚĞĚŝŶĂĚǀĂŶĐĞŝĨƉŽƐƐŝďůĞƐŽƚŚĂƚƚŚĞĐŽŶƐƵůƚĂŶƚƚĞĂŵĐĂŶĞŶƐƵƌĞƚŚĂƚƚŚĞǇĂƌĞƉƌŽƉĞƌůǇĂĚĚƌĞƐƐĞĚ͘ĚĚŝƚŝŽŶĂůůǇ͕/ǁŝůůďĞƉƌŽǀŝĚŝŶŐ/ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞZĞƐŝĚĞŶƚƐǁŝƚŚĂĐŽƉǇŽĨƚŚĞƌĞǀŝƐĞĚŶŽƚŝĐĞƚŽŵŽƌƌŽǁǀŝĂŽŵŵƵŶŝƚǇhƉĚĂƚĞĞďůĂƐƚĚŝƐƚƌŝďƵƚŝŽŶ͘/ŚĂǀĞĂƚƚĂĐŚĞĚĂĐŽƉǇŽĨƚŚĞZĞǀŝƐĞĚŶŽƚŝĐĞƚŽƚŚŝƐƌĞƐƉŽŶƐĞǁŚŝĐŚƉƌŽǀŝĚĞƐƚŚĞǌŽŽŵƉĂƌƚŝĐŝƉĂƚŝŽŶŝŶĨŽƌŵĂƚŝŽŶ͘dŚĂŶŬǇŽƵĨŽƌǇŽƵƌĐŽŶĐĞƌŶ͘tĞůŽŽŬĨŽƌǁĂƌĚƚŽƉƌĞƐĞŶƚŝŶŐƚŚĞƉƌŽũĞĐƚŽŶdŚƵƌƐĚĂǇ͘WůĞĂƐĞůĞƚŵĞŬŶŽǁŝĨǇŽƵŚĂǀĞĂŶǇĂĚĚŝƚŝŽŶĂůƋƵĞƐƚŝŽŶƐ͘DŝĐŚĂĞůůŐŝŶŝƌĞĐƚŽƌŽĨŽŵŵƵŶŝƚǇĞǀĞůŽƉŵĞŶƚD/EdKKDDhE/d/^Ͳh^ϰϮϴϬdĂŵŝĂŵŝdƌĂŝů͕^ƚĞϮϬϯͬϮϬϰ͕EĂƉůĞƐ͕&>͕ϯϰϭϭϮdϮϯϵ͘ϴϵϲ͘ϭϰϬϮͮϮϯϵ͘ϯϱϭ͘ϲϵϱϭĚŝǀŝƐŝŽŶŽĨdŚĞDŝŶƚŽ'ƌŽƵƉ&ŽůůŽǁƵƐŽŶ9.A.2.d Packet Pg. 290 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann &ƌŽŵ͗ƌŝĐŬĐĂůĂĐĐŝфƌďĐĂůĂĐĐŝΛŐŵĂŝů͘ĐŽŵх^ĞŶƚ͗DŽŶĚĂǇ͕:ƵůǇϭϯ͕ϮϬϮϬϵ͗ϰϯDdŽ͗ŽŶŶĂ͘&ŝĂůĂΛĐŽůůŝĞƌĐŽƵŶƚǇĨů͘ŐŽǀ͖ŶĚǇ͘^ŽůŝƐΛĐŽůůŝĞƌĐŽƵŶƚǇĨů͘ŐŽǀ͖Ƶƌƚ͘^ĂƵŶĚĞƌƐΛĐŽůůŝĞƌĐŽƵŶƚǇĨů͘ŐŽǀ͖WĞŶŶǇ͘dĂǇůŽƌΛĐŽůůŝĞƌĐŽƵŶƚǇĨů͘ŐŽǀ͖ŝůů͘DĐĂŶŝĞůΛĐŽůůŝĞƌĐŽƵŶƚǇĨů͘ŐŽǀ͖DŝĐŚĂĞůůŐŝŶфDůŐŝŶΛŵŝŶƚŽƵƐĂ͘ĐŽŵх^ƵďũĞĐƚ͗ZĞ͗&ůĞŝƐĐŚŵĂŶŶWƌŽƉĞƌƚǇ'HDU0V6DSHQ7KLVHPDLOLVLQUHJDUGVWRWKHPHHWLQJUHJDUGLQJWKH)OHLVKPDQ3DUFHOVFKHGXOHGWREHKHOGRQ7KXUVGD\-XO\DWWKH,VOHVRI&ROOLHU&OXEKRXVH&RQVLGHULQJWKHRQJRLQJVXUJHRI&29,'KROGLQJDQHQFORVHGPHHWLQJOLNHWKLVDWWKLVWLPHLVLUUHVSRQVLEOHDQGREMHFWLRQDEOH/LNHP\VHOIWKHUHDUHPDQ\,VOHVRI&ROOLHUUHVLGHQWVWKDWKDYHKLJKOHYHOLQWHUHVWLQWKLVSURMHFWDQGFRXOGEHKLJKO\LPSDFWHGE\WKHRXWFRPHWKDWDUHQRWFXUUHQWO\LQWRZQ:LWKLQYHVWPHQWVPDQ\KDYHPDGHLQWKLVFRPPXQLW\WKLVSURMHFWFOHDUO\KDVPDQ\LPSOLFDWLRQVIRURXUHQYLURQPHQWRXUSURSHUW\LQYHVWPHQWDQGWKHFRPPXQLW\DWODUJH&29,'WKUHDWHQVRXUKHDOWKDQGWKHULVNVDVVRFLDWHGZLWKDWWHQGLQJWKLVPHHWLQJSDUWLFXODUO\IRUWKRVHRIXVLQKLJKULVNJURXSVQHHGVWREHUHVSHFWHG:HDUHUHTXHVWLQJWKDWWKHPHHWLQJEHUHVFKHGXOHGDWDWLPHWKDWSHUPLWVZLWKSOHQW\QRWLFHIRUVDIHDWWHQGDQFHE\DOOLQWHUHVWHGSDUWLHV,WLVQRWIDLUWREHSODFHGLQWKLVVLWXDWLRQWKDWZHQHHGWRFKRRVHEHWZHHQRXUKHDOWKFRQFHUQVDORQJZLWKRXULQWHUHVWDQGILQDQFLDOLQYHVWPHQWLQRXUFRPPXQLW\5HJDUGV5LFN .HOO\&DODFFL&RPSDUW,VOH'U1DSOHV)ODUEFDODFFL#JPDLOFRP9.A.2.d Packet Pg. 291 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 1$0(1$0(1$0(1$0(1$0(1$0()2/,25,77(552$'//&&2857675((768,7(%8))$/21<(;&+$1*(&211(&7,21,1& 4,6,/3$5(17$/3523(57<0$1$*(0(17//&$9(//,12:$<1$3/(6)/217$5,2,1&%26:(//$9(7252172050&$1$'$)/23&2//&67(3+$1,(/$1('$5,(1&7$9(//,12:$<//&25&+$5'+,//52$'6&$5%2528*+0(217$5,2,1&-2+1675((781,70$5.+$0/5(&$1$'$+2//<$9(18(75867$,5325738//,1*5'61$3/(6)/:22'6,'($9(758677,.$3523(57,(6&2//,(5%/9'1$3/(6)/3,1(75(('5,9(//&32%2;1$3/(6)/3,1(75((//&32%2;1$3/(6)/323/$5:$</$1'75867 7$0,$0,75$,/167(1$3/(6)/7+20$6621/17586732%2;1$3/(6)/7+20$6621/$1(//&6281'5')76$/21*$1<77($67,//&77($67,,//&77($67,,,//&'($5),(/''5,9(67(*5((1:,&+&775(9,*5283//&/,/<$9(1257+/$.((/0201$1(*$'$'5/$1'75867 $1(*$'$'51$3/(6)/'20,1,&$'581,7//& 0($'2:$9(0210287+%($&+1-(/(9(1,1&5<$1//&7+5((*$//(5,$72:(512(/5'/%'$//$67;75(9,&2857/$1'75867 $,532575'61$3/(6)/7$0,$0,75$,///&%(5/,15'&520:(//&7$3 0%3$5,6,/,9,1*75867'20,1,&$'51$3/(6)/$5($/(67$7(&211(&7,217+(:5,*+76:$<//&%85173,1('51$3/(6)/$%%(11<3$571(56//&%81.(5+,//67&+$5/(67210$$%%58==(6(&$50(1 )$11,( 3+,//,36'50(')25'1<$%5$+$0(/,=$%(7+0$5<&$625,$&28571$3/(6)/$'$06//&48((16%/9'1$3/(6)/$'$06'28*/$6)/,77/(+$5%285/$1(1$3/(6)/$))(/'775'$9,'$$/$1:(16,(56.,5(975867$))(/'7/$:2)),&(6&:1$7,21$/$9(:(67$//,6:,$))(/'775'$9,'$$/$1:(16,(56.,5(975867$))(/'7/$:2)),&(6&:1$7,21$/$9(:(67$//,6:,$))(/'775'$9,'$$/$1:(16,(56.,5(975867$))(/'7/$:2)),&(6&:1$7,21$/$9(:(67$//,6:,$))(/'775'$9,'$$/$1:(16,(56.,5(975867$))(/'7/$:2)),&(6&:1$7,21$/$9(:(67$//,6:,$))(/'775'$9,'$$/$1:(16,(56.,5(975867$))(/'7/$:2)),&(66&:1$7,21$/$9(18(:(67$//,6:,$))(/'775'$9,'$$/$1:(16,(56.,5(975867$))(/'7/$:2)),&(66&:1$7,21$/$9(18(:(67$//,6:,$))/(5%$&+52'1(</((0$5<7$))/(5%$&+/8&$<$:$<1$3/(6)/$))25'$%/(+286,1*,1'<//& :+,7(+$//3/&$50(/,1$)2162*(25*( 7(5(6$60(/526('5,9(&+(67(51-$,5(<0,&+$(/. '(1,6(6287+*/(15'.,11(/211-$-$(//&:,//2:&70$5&2,6/$1')/$-$(//&:,//2:&70$5&2,6/$1')/$-$(//&:,//2:&70$5&2,6/$1')/$-$(//&:,//2:&70$5&2,6/$1')/$-$(//&:,//2:&70$5&2,6/$1')/$-$(//&:,//2:&70$5&2,6/$1')/$-$(//&:,//2:&70$5&2,6/$1')/$-$(//&:,//2:&70$5&2,6/$1')/$..-//&32%2;1$3/(6)/$.=//&&$17(5%85<&72$.'$/(1<$/$1**22'5,'*(/,9,1*75867 0$5<$.,1*5(9/,9,1*75867 :$5:,&.$9(18(1$3/(6)/$/$1*:(16,(56.,5(975867 :1$7,21$/$9(0,/:$8.((:,$/$1:(16,(56.,758673,1(75(('51$3/(6)/$/$1:(16,(56.,758673,1(75(('5,9(1$3/(6)/$/&$/$/,%(5$72' *,/'$0$1(*$'$'51$3/(6)/$/,621&$1.(50$175867 $1'526'51$3/(6)/$//,.$75(17$/3523(57<//& &+,33,1*+$05':22'5,'*(,/$/7$0,5$120$852&21)('(5$7('51$3/(6)/$/7+85865(''</,9,1*75867 6$5$'$35(''</,9,1*75867 ,1',$175$,/5'2$.%522.,/$/9(52*80(5& $0<-:22''$/(/$1((',1$01$0(=686$1526($9(1$3/(6)/1RWLFH7KLVGDWDEHORQJVWRWKH&ROOLHU&RXQW\3URSHUW\$SSUDLVHU V2IILFH&&3$7KHUHIRUHWKHUHFLSLHQWDJUHHVQRWWRUHSUHVHQWWKLVGDWDWRDQ\RQHDVRWKHUWKDQ&&3$SURYLGHGGDWD7KHUHFLSLHQWPD\QRWWUDQVIHUWKLVGDWDWRRWKHUVZLWKRXWFRQVHQWIURPWKH&&3$3HWLWLRQ3/_%XIIHU _'DWH_6LWH/RFDWLRQ6DEDO%D\38'32/LVWBB3/9.A.2.d Packet Pg. 292 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann $1$67$6,20$57,1+ 7+20$6621/11$3/(6)/ $1'(00<5(92&$%/(75867 /20%$5'</$1(1$3/(6)/ $1'(5621*5(19,//( 0(/$1,(6$1'(5621 %25'(5675((7&2+$66(70$ $1'5($67(55<- 5+21'$/ *5($7&2857&,51:0$66,//212+ $1'526'5,9(//& :,1'<+,//'51257+%522.,/ $11(5('3$7+121,5$ 5(92&$%/(,19(670(1775867 &$<&71$3/(6)/ $110$5,(6$/9$**,25(975867 +$,7,'5,9(1$3/(6)/ $11$5800$3$8/$0 -26(3+0 $9(:+,7(6721(1< $11($3*$55(92&$%/(75867 '20,1,&$'51$3/(6)/ $1721,2535$765(975867 6:1'&70,$0,)/ $5$1*20$5,$/(12125 526($9(81,7$1$3/(6)/ $5&(5,-2+1$/)5(' /,/,$1$$5&(5, $1(*$'$'51$3/(6)/ $5&+$0%$8/7)$0,/<75867 &/$5(1'21'51$3/(6)/ $5&+,%$/'*25'215 0$5&,$/ 2/':,//2:5'1(:+$57)25'1< $5&,$0$*$/<0 6:7(550,$0,)/ $5+&%71$3)///& $/786*528386,1& 17$780%/9'3+2(1,;$= $5,$11$ /2*$1,55(975867 621'(5+(1'5,9(1$3/(6)/ $50(172587+& %(48,$:$<1$3/(6)/ $512/''$9,'& +2//<$9(1$3/(6)/ $512/''$9,'& +2//<$9(1$3/(6)/ $512/'52%(57+ 52%,1- :$5:,&.$9(18(1$3/(6)/ $512/':$/7(5+ $11$0 .2/%$9(6$<(59,//(1- $521621-$0(6' 1$1&<* 0$57,1,48('51$3/(6)/ $57(6,$19(1785(6//& 5('21$:$<1$3/(6)/ $57+85* .,00+2)0$11 )$0,/</,9,1*75867 $0(6%85<'53/$127; $57+85-$0(6 '20,1,&$'51$3/(6)/ $7+$1$62328/26-2+1* 3$8/$0$5,($7+$1$62328/26 %$57+(/(0<$9(18(1$3/(6)/$867,1&$5/$-'20,1,&$'51$3/(6)/$867,1'$9,'&+$5/(6',1$+-$&48(/,1($867,15(6,'(1&(/(6$/&<21658(-$0(6*5$170,/1(&$11(6)5$1&($867,17+20$69/$5<6$3(/&$1'526'51$3/(6)/$9$/21$3$570(17+20(6//& *2/'(1*$7(3.:<1$3/(6)/$9$/21$3$570(17+20(6//& *2/'(1*$7(3.:<1$3/(6)/$9$/21$3$570(17+20(6//& *2/'(1*$7(3.:<1$3/(6)/$9$/21$3$570(17+20(6//& *2/'(1*$7(3.:<1$3/(6)/$9$/21$3$570(17+20(6//& *2/'(1*$7(3.:<1$3/(6)/$9$/21$3$570(17+20(6//& *2/'(1*$7(3.:<1$3/(6)/$9$/21$3$570(17+20(6//& *2/'(1*$7(3.:<1$3/(6)/$;,11%$5%$5$&$625,$&71$3/(6)/%$+/5$-,9 $18*5((1),(/'$9(1257+<25.011&$1$'$%$,/(<1,&2/$*(25*(:,*1$/7+20$6621/$1(1$3/(6)/%$,1%$6,/ 721,&675$7)25''51$3/(6)/%$,1%$6,/ 721,&675$7)25''51$3/(6)/%$.$/521 /,+,($671'67(1(:<25.1<%$.(5.(9,10,&+$(/-8/,($11%$.(5'$.72$'50$&20%0,%$.(5/,6$0$6+),(/'6/$1(*5((1:,&+&7%$.(57('+&211,((&800,16&$625,$&28571$3/(6)/%$/%,5&6($0 .8680%6($0 -2,173523(57<5(975867&$625,$&71$3/(6)/%$/%21,-26(3+$ -2$11575(9,&28571$3/(6)/%$//-$0(63(9(5*5((175$,/25&+$5'3$5.1<%$//.$5,1+(/(1($*/(/$.(&28576$15$021&$%$//(67(526-26(2&526($9(81,7$1$3/(6)/%$/=/,0$5<%(7+75(9,&71$3/(6)/%$1(5-((5$1-((7 1,/$1-$1$6,7,26(1'(52&$5,6%$'&$%$1.2)$0(5,&$&25325$7(5($/(67$66(60(176 1&175<2167&+$5/277(1&%$37,67(-2&(/<1(-($1$1'5(:6$9(1$3/(6)/%$5%$5$*52$&+75867+,*+%2851('51$3/(6)/%$5%$5$0675$&+$175867/<)25',6/('51$3/(6)/%$5*,1(5=21,$/20%$5'</11$3/(6)/%$55(77'21$/'$:22'6,'($9(1$3/(6)/%$55(773$75,&.0 -2$10 %(48,$:$<1$3/(6)/%$572/20(,-$0(6(+2//2:5'6.,//0$11-%$6,/(-50,&+$(/- &$52/$ &$<&28571$3/(6)/%$<6+25(3$5&(///&7+$9(667(1$3/(6)/32/LVWBB3/9.A.2.d Packet Pg. 293 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann %$<6+25(3$5&(///& 7+$9(667(1$3/(6)/ %$<6+25(3$5&(///& 7+$9(667(1$3/(6)/ %$<6+25(3$5&(///& 7+$9(667(1$3/(6)/ %$<6+25(3$5&(///& 7+$9(667(1$3/(6)/ %($&+.$7+/((10 ,9</10,11(721.$01 %($/.(9,10 -$0,(0 &5(67'5/21*9$//(<1- %($721,$,1:,//,$0*5$17 *(25*(72:1%/9'1$3/(6)/ %($77,(.,0/((( .$5,.%($77,( 1,&+2/65'($67/$16,1*0, %($77<'$9,'( $1'5(:6$9(1$3/(6)/ %($83$5,$170,&+$(/7 /2,60%($83$5,$17 1$7$/,(5%($83$5,$17 *5((1:22'$9(580)25'5,%($87,)8/+20(62))/25,'$//& 5$)),$'51$3/(6)/%($87,)8/+20(62))/25,'$//& 5$)),$'51$3/(6)/%((*$13$8/- 9,5*,1,$(&/$5(1'21'51$3/(6)/%(*25*$5<: 02//<$3$0(/$0$+(5'20,1,&$'51$3/(6)/%(,(5-8',7+5/8&$<$:$<1$3/(6)/%(/,=$,5((51(67 0$5,(&:22'6,'($9(1$3/(6)/%(//5$()25'$ 3(**,(-3(0%52.(:$<1$3/(6)/%(//21(-26(3+*-$0(63+,**,16'20,1,&$'5,9(1$3/(6)/%(/75$1&21&(3&,21+2//<$9(1$3/(6)/%(11(5)$0,/<5(9/,975867 $1'526'51$3/(6)/%(11(770$77+(:&25$/%(55<'5,9(&2/80%862+%(5*(6'$0,$1181(=*,66(//(&257$'$526($9(1$3/(6)/%(5,1*0$5.3/8&,(0$5,(320(5,($8/$.(6+25(/$1(*5266(32,176+20,%(5.-$0(6' '211$03(0%52.(:$<1$3/(6)/%(50$10$5.%(50$10,&+$(/&2167,787,21'51$3/(6)/%(50$10$5.0 9,5*,1,$/&2167,787,21'51$3/(6)/%(5167(,1-())5(<. '(%5$6 '20,1,&$'51$3/(6)/%(562.3$8/$17+21<&<17+,$$11%(562./$.(3,1(6'5%5,*+7210,%(572/21('$5/$'9,//$*(%522.'5&,1&,11$7,2+%(9(5/<-68'2//,9,1*75867 $1'526'51$3/(6)/%,$1&2-2<&(0/$1',1*/$1(620(5632,171-%,%%2-2+1 '$5/$072572/$&71$3/(6)/%,%(15,&+$5'0 /,1'$'5,9(552$'6$81'(5672:15,%,(5/(21$5'75(9,&71$3/(6)/%,1'$6'21$/'5%$5%$5$''$/725,2+,*+%2851('51$3/(6)/%,1*(57,027+<$ .,0%(5/<5 $1'526'51$3/(6)/%,5'5(92&$%/(758670&&250$&.5(92&$%/(75867 &/$5(1'21'51$3/(6)/%,5*,7,0$,2/,9,1*75867$1(*$'$'51$3/(6)/%,5.6-$1,&(/<11('20,1,&$'51$3/(6)/%-25113%$</(<5(9758671(7+67%(//(98(:$%/$1'6&277 1$1&<$1'526'51$3/(6)/%/$1',26&$5-(56(<$9(*5((1:22'/$.(1<%/$6,(15,&2&$50(1 686$1( &2%%/(6721(&72;)25'2+%/,66',$1$*/(11%/,669$//(<9,(:'5*5($7)$//607%/8(0$5/,167$7,216//&2$.),(/''5%5$1'21)/%2$70$15(92&$%/(758673$5.:22'5',1',$1$3$%2$75,*+7/,9,1*75867:$7(50$1676(0$5,(77$*$%2(1,6&+-8(5*(13(7(5&25' &526$+*2/'%(5*%2(1,6&+ &5((.9,(:&,5&5$1%(55<7:33$%2*$57)$0,/<758675('21$:$<1$3/(6)/%2*$57)$0,/<758675('211$:$<1$3/(6)/%2*$57,,+$52/'*,5(1(%2*$5752//,1*+,//6/$1(0$563$%2+1(-2+13 .$7+/((1032%2;5(+2%(7+%($&+'(%2+5(5'$9,'$ 3$75,&,$//$1',025(/1:$/(6:,%2+5(5'28*/$6*(5$5'3(**<$11(%2+5(548$,/&,5&/(3/<0287+0,%21$&&,)5$1.$17+21<-8',7+/((%21$&&,'20,1,&$'5,9(81,71$3/(6)/%21$&8627+20$6(0$5,$11(/%21$&862&$625,$&28571$3/(6)/%21'-())(5<7 1$1&<((+22.(567635,1*),(/',/%21':,//,$0$7,))$1<$11(%21'.$5,/<11(%21'%,5&+75((/$1(1(:&$67/(/%3&$1$'$%21,7$)0$5;7586716('*:,&.6781,7&&+,&$*2,/%210$5/$1'75867*%21,1, ./(326$/$5,12/223(67(52)/%211(5-2+1&,5586'5$6+/$1'0$%212-$0(6/ /,1'$7$1'526'51$3/(6)/%21202/2'(11,6$(8*(1(67)$,5/$:11-32/LVWBB3/9.A.2.d Packet Pg. 294 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann %27$1,&$/*$5'(1,1&7+( %$<6+25('567('1$3/(6)/ %27$1,&$/*$5'(1,1&7+( '%$1$3/(6%27$1,&$/*$5'(1 %$<6+25('567('1$3/(6)/%27$1,&$/*$5'(1,1&7+('%$1$3/(6%27$1,&$/*$5'(1 %$<6+25('567('1$3/(6)/%27$1,&$/*$5'(1,1&7+('%$1$3/(6%27$1,&$/*$5'(1 %$<6+25('567('1$3/(6)/%27$1,&$/*$5'(1,1&7+('%$1$3/(6%27$1,&$/*$5'(1 %$<6+25('567('1$3/(6)/%27$1,&$/*$5'(1,1&7+('%$1$3/(6%27$1,&$/*$5'(1 %$<6+25('567('1$3/(6)/%27$1,&$/*$5'(1,1&7+('%$1$3/(6%27,&$/*$5'(1 %$<6+25('567('1$3/(6)/%277(,&+(5-$0(6:,//,$0/25,$11%277(,&+(575(9,&71$3/(6)/%2:0$1.(11(7+ 6+$5521- /8&$<$:$<1$3/(6)/%2</(-())(5</ 52%(57$* $1'526'5,9(1$3/(6)/%2=$57+('*$5)26+('20,1,&$'5,9(1$3/(6)/%5$'/(()$0,/<75867%(48,$:$<1$3/(6)/%5$'<&+$5/(6.(9,11250$1'<'51$3/(6)/%5$'<+23(075(9,&28571$3/(6)/%5$*$52%(57)5$1&,6$&&25'32,1''5+,1*+$00$%5$1'/(.(1(':$5'&25,11(0$5,(%5$1'/(8//0$1$9(1:6$/(025%5$11,&.'(1,6(008/%(55<67&/,17211<%5$6(/9,&.,75(9,&71$3/(6)/%5(&+(/-2+15 &+$5,/)281'(56&,5&/(1$3/(6)/%5(&+(/-2+15 &+$5,/)281'(56&,5&/(1$3/(6)/%5(('(1/(,*+'$1)25'671$3/(6)/%5(//(17+,1-5:%5,$1/,6$/%5(//(17+,1(/%2:$9(1$3/(6)/%5(17*5(** $0<%(48,$:$<1$3/(6)/%5(:67(552*(5$17+21<3+,/,33$-$1(%5(:67(57+(2/''2&7256+286(+,*+/(,*+&+,&+(67(5:(676866(;31581,7('.,1*'20 %5,$1&%2(9()$0,/<75867&(175$/$9(+2//$1'0,%5,6.<%211,(/'20,1,&$'51$3/(6)/%52&$72/$:5(1&(- 526(0 ('*(*529($9(67$7(1,6/$1'1<%52&.&(17(5//&$6+(/$1'29(5/22.<281*+$55,6*$%52*$1-())5(<$//(11$1&<0$5,(%52*$1'20,1,&$'5,9(81,71$3/(6)/%52866($83(7(5- 686$10 /,*+7%2851:$<1$3/(6)/%52:1'$55(//:$<1(.,0%(5/</28,6(%52:1%522.65'+$55,6212+%52:1'$9,')/2<''$:1&$7+(//%52:13(0%52.(:$<1$3/(6)/%58&(-6+80:$<75867 686$1)6+80:$<75867 2&($1$9(:(//60(%5812&21&(77$53,&.(73267/$1(3+2(1,;9,//(3$%5<$17-2150,1',$9(1$3/(6)/%6&3523(57<//&75$'(&(17(5:$<1$3/(6)/%6&3523(57<//&75$'(&(17(5:$<1$3/(6)/%8&+<,19(670(176//&)5((0$152$':(67(59,/(2+%8/7,1&.67()$$13233</8/8//&32%2;1$3/(6)/%8/7,1&.67()$$1(3233</8/8//&32%2;1$3/(6)/%85.(52/$1''/,1'$-26(3+,1(%85.(32%2;3257&/,17212+%8516&+$5/(6-&$03$1,/(&,51$3/(6)/%8516-$0(6- &$52/($7:,/,*+75'52&.<32,171<%8552:(63$8/6%(9(5/</$85,1(%8552:(6 $&./,16'51$3/(6)/%85721.$7+/((1$1$1&<3+,//,3632%2;2$.%/8))60$%86%<9,&.,(/1(('/(52&.&28576</9$1,$2+%8;29,1&(17+ /$85$0'20,1,&$'51$3/(6)/%<5'/,1'$/28,6(+,*+%2851('51$3/(6)/&$/('(5+$$65(975867:$5:,&.$9(1$3/(6)/&0 /0/,1'(55(975867:$5:,&.$9(1$3/(6)/&6)/25,'$//&:)/$*/(56767(0,$0,)/&$%5(5$(81,&(323/$5:$<1$3/(6)/&$*($/,6+$</$.(:22'%/9'1$3/(6)/&$*($/,6+$</$.(:22'%/9'1$3/(6)/&$-867(75261(/ &/21,()2 &&$-867(5(9/,975867 &$7$/,1$'51$3/(6)/&$/$25/$1'2'$1,(/&$/$+$5%25%/9'37&+$5/277()/&$/$&&,5,&.% .(//</63<*/$66&7081'(/(,1,/&$/$5&2-2+152'&$7+/((1.(//<&$/$5&2%522.+,//6&,5&/(:+,7(3/$,161<&$/':(//72%,$66&+22//$1(+817,1*7211<&$//$+$1$17+21<0&<17+,$/',(+0'20,1,&$'51$3/(6)/&$0$5$72*5(*25<3$75,&,$&&$0$5$72:$7(5%5,'*('51257+52<$/7212+&$0(521&$52/(/28,6(+$,7,'5,9(1$3/(6)/&$0,//(&/$=5(975867'20,1,&$'51$3/(6)/32/LVWBB3/9.A.2.d Packet Pg. 295 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann &$03%(//5,&+$5' 0$85((1) $6725'56$<9,//(1< &$03%(//68(0,7&+(// +,*+%2851('51$3/(6)/ &$0326'$<6( 526($9(1$3/(6)/ &$1&,20,/(,9,6$ 7+20$6621/11$3/(6)/ &$11217+20$6* *$/( 7$0,$0,75/(1$3/(6)/ &$11217+20$6* *$/( 7$0,$0,75/(1$3/(6)/ &$1121(686$1( 3(7(5-&$1121(,,, %2%%<-21(6'5,9($1'29(50$ &$17$6$12$17+21< 0,&+(//( $1'526'51$3/(6)/ &$5$,17(51$7,21$///& 1$9$66$/$1(1$3/(6)/ &$5$,17(51$7,21$///& 1$9$66$/$1(1$3/(6)/ &$5$,17(51$7,21$///& 1$9$66$/$1(1$3/(6)/ &$5$0'$9,'0 %(9(5/(<- &$625,$&71$3/(6)/ &$5%$//($-8/,2 $11$+(51$1'(= *2/'(1*$7(%/9'(1$3/(6)/ &$5%$//2*,29$11, 7+20$6621/11$3/(6)/ &$5',1$/(-26(3+* ),/20(1$0&$5',1$/( &203$57,6/('51$3/(6)/ &$5(<&$7+(5,1(&2&+5$1( (/,=$%(7+&2&+5$1(5(,' -2+1$/(;$1'(5&2&+5$1(-5 :(67(1'$9(1(:<25.1<&$5/,1-26(3+0,&+$(/-8'<$11&$5/,1$17,*8$:$<1$3/(6)/&$5/621(/,=$%(7+$11(5,.5,&+$5'&$5/621$9(//,12:$<1$3/(6)/&$51(<-55,&+$5'9'(%5$/&$51(<$0:(//52$')/(0,1*7211-&$52/%(5./(</,9,1*75867$8*867-)5((6(67$1'526'51$3/(6)/&$52/'(/$5,2,55(96175867 $9(11$3/(6)/&$53(17,(5$11,()5$1&,6*$*121*$0%/(675((7*(25*(72:1/*%&$1$'$&$55-5+$55<(%$5%$5$/&$55&203$57,6/('51$3/(6)/&$55,$*()/25,'$+2/',1*6,1& 32672$.%/9'+2867217;&$55,$*()/25,'$+2/',1*6,1& 32672$.%/9'+2867217;&$552//0$5,/<1.$7+5<1+,*+%2851('51$3/(6)/&$587+3$0(/$-$1( '213$8/ 0- -(/81'.$52/,1(&28571)25(67/$.(01&$59$//27+,(55<3$6&$/&$<&28571$3/(6)/&$6(<&2//((1075(9,&71$3/(6)/&$6+,10$5<$11686$12 %5,(1$1'526'51$3/(6)/&$66,'<-2+1%5,&.0,//5'%(')25'1+&$66,7<%5(1'217</(5/8&$<$:$<1$3/(6)/&$67,//275,1,'$' (9$25&+$5'/11$3/(6)/&$67250$5,$1$3(5(=6$1'5$$11+(51$1'(=<(//2:6721('51)70<(56)/&$6752(5,. %(57+$*,/&+5,67671$3/(6)/&$6752(5,. %(57+$*,/&+5,67671$3/(6)/&$6752129$3+,/,3-$0(6/2,6$11&$6752129$:$5:,&.$9(1$3/(6)/&$68//252&&2(/0:22'$9(.(1025(1<&$68//252&&2(/0:22'$9(18(.(1025(1<&$7$*186*5(**67(3+(10,1'<68(&$7$*186+20(67($'&7*,/%(5769,//(3$&$7217(55,/<11(75(9,&28571$3/(6)/&$87,//2-2+10'$:1&67877,*/,*+7%2851:$<1$3/(6)/&$9$//252%(57 -2<&(5('),(/'5'%(/$,50'&$9$//252%(57( &<17+,$0 %((&+:22'&70$66$3(48$1<&$9$//21(526(6$,17$1'5(:6%/9'$371$3/(6)/&'&/$1',19(670(176,1&*22'/(77(5'11$3/(6)/&'&/$1',19(670(176,1&*22'/(77(5'11$3/(6)/&(/(67,1'$1,(/29(5/$1'(,60(%$<6+25('51$3/(6)/&(5&21(3(7(5- &<17+,$/ 5,'*(:22''5672:0$&(50,1$52-$0(652%(57'211$/<11&(50,1$52)$55676&5$17213$&(521(*(5$5'2 &$55,(6,;7((10,/('52$.9,//(/0=&$1$'$&(521(*(5$5'2 &$55,(/6,;7((10,/('52$.9,//(/0=&$1$'$&+$%27-5*(25*(:52&.9,//(0($'2:60,//,60$&+$1'5$0$+$6( 35,<$$&./,16'5,9(1$3/(6)/&+$5(/,6$11(77(*8(5<*3/$1&+(5/20%$5'</11$3/(6)/&+$5(/86(/,48(702+$:.3/1$3/(6)/&+(175-,(3,1(9,(:7586787'32%2;1$3/(6)/&+(175-,(3,1(9,(:7586787'32%2;1$3/(6)/&+(1-(11<1$/+$0%5$&,51$3/(6)/&+(1-(11<1$/+$0%5$&,51$3/(6)/&+(9$/,(50$5*$5(76$5$+ +,*+%2851('51$3/(6)/&+,&.(5,1*1,&+2/$660$5<$1*(/$*$'$/(7$526($9(1$3/(6)/&+2$7(-(11$('28*/$6)$'$06:22'6,'($9(1$3/(6)/32/LVWBB3/9.A.2.d Packet Pg. 296 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann &+5,67,1(&0$;:(//'(&/75867 *21($:$<&2857:+($721,/ &+80%/(<(5,.$' 129$72&71$3/(6)/ &+80%/(<(5,.$' 129$72&71$3/(6)/ &,$032'211$0 $17+21<7-5 75(9,&71$3/(6)/ &,&&+,'20,1,&1,&+2/$6 *(25*,$/28,6(&,&&+, $1(*$'$'5,9(1$3/(6)/ &,7<2)1$3/(6 7+6761$3/(6)/ &,7<2)1$3/(6 7+6761$3/(6)/ &,7<2)1$3/(6 7+6761$3/(6)/ &,7<2)1$3/(6 7+6761$3/(6)/ &/$5,'$)$0,/<75867 +,*+%2851('51$3/(6)/ &/$5.(7,027+<$ -())(5<$//(1&/$5.( 5(38%/,&'51$3/(6)/ &/$9(5,$5$)$(/ $681&,21- 9$//(<5'/$.()25(67,/ &/(23+$77$1,6 7+$9(6:1$3/(6)/ &/(23+$77$1,6 7+$9(6:1$3/(6)/ &2%,1.$5(1 )5$1.758*/,2 &52&86$9()/25$/3$5.1< &2&$/,67(55< :22'6,'($9(1$3/(6)/ &2*+/$17+20$6.(11(7+ %$5%$5$+(/6(/&2*+/$1 $1(*$'$'5,9(1$3/(6)/ &2+(1$/21 %$5%$5$ 72572/$&71$3/(6)/ &2+(152&+(//( +,*+%2851('51$3/(6)/ &2/$1'27(5(6$$ 1*5((1:22'$9(18(0(',1$+,/ &2/((1.52+15(92&$%/(75867 &27721:22'&7:$+3(7211' &2/(0$1:,//,$0- 3$75,&,$$5($5'21 $1'526'5,9(1$3/(6)/ &2/(77(-26(3+) )/25(1&(: +$5021<+,//5'+$5:,1721&7 &2//((10'5(+(55(975867 16800(5/$1''5$33/(721:, &2//,(5&17< &25($/3523(57<0$1$*(0(17 7$0,$0,75(67(1$3/(6)/ &2//,(5&17< &25($/3523(57<0$1$*(0(17 7$0,$0,75(67(1$3/(6)/ &2//,(5&17< &25($/3523(57<0$1$*(0(17 7$0,$0,75(67(1$3/(6)/ &2//,(5&17< &25($/3523(57<0$1$*(0(17 7$0,$0,75(67(1$3/(6)/ &2//,(5&17< &25($/3523(57<0$1$*(0(17 7$0,$0,75(67(1$3/(6)/ &2//,(5&17< &25($/3523(57<0$1$*(0(17 7$0,$0,75(67(1$3/(6)/ &2//,(5&17< &25($/3523(57<0$1$*(0(17 7$0,$0,75(67(1$3/(6)/ &2//,(5&17< &25($/3523(57<0$1$*(0(17 7$0,$0,75(67(1$3/(6)/ &2//,(5&17< &25($/3523(57<0$1$*(0(17 7$0,$0,75(67(1$3/(6)/ &2//,(5&17< &25($/3523(57<0$1$*(0(17 7$0,$0,75(67(1$3/(6)/ &2//,(5&17< +286,1*$/7(51$7,9(,1& %$7+(</11$3/(6)/ &2//,(5&17< +286,1*$/7(51$7,9(,1& %$7+(</11$3/(6)/ &2//,(5&17< +286,1*$/7(51$7,9(,1& %$7+(</11$3/(6)/ &2//,(5&17< +286,1*$/7(51$7,9(,1& %$7+(</11$3/(6)/ &2//,(5&17< +286,1*$/7(51$7,9(,1& %$7+(</11$3/(6)/ &2//,(5),1$1&,$/,1& 7$0,$0,75$,/(1$3/(6)/ &2//,(5),1$1&,$/,1& 7$0,$0,75$,/(1$3/(6)/ &2//,(5),1$1&,$/,1& 7$0,$0,75/(1$3/(6)/ &2//,(5),1$1&,$/,1& 7$0,$0,75/(1$3/(6)/ &2//,(5/$1''(9(/230(17,1& *22'/(77(5'11$3/(6)/ &2//,(5/$1''(9(/230(17,1& *22'/(77(5'11$3/(6)/ &2//,(5/$1''(9(/230(17,1& *22'/(77(5'167(1$3/(6)/&2//,(5/$1''(9(/230(17,1&*22'/(77(5'167(1$3/(6)/&2//,167+20$60,&+$(/%$5%$5$*$,/&2//,16&/$5(1'21'51$3/(6)/&200(5&,$/3523(57,(66:,1& 0$+2*$1<581/11$3/(6)/&20260,&+$(/(8*(1((//(1/<11&221%(//6+,5(/$1(&/$5.67210,&21/(<'(%5$-7+6711$3/(6)/&211(5&/,))25'6&277%85176,(11$&,5&/(1$3/(6)/&211256/$:5(1&(3+,336$9(($6752&.$:$<1<&2152<.$5(1$%(48,$:$<1$3/(6)/&2167$1&(-%5(66(75867(67 0,1',$9(1$3/(6)/&217,0$5<-($16$,17$1'5(:6%/9'$37%1$3/(6)/&217,1(17$/)81'//&$771/(*$/'(3$570(17:1(;(&87,9(3.:<0(12021(()$//6:,&217,1(1=$$17+21<7 '$1((1 6877213/$&(&+$5'212+&21:$<,,,(':$5')5$1&,69$/(5,(.$<&21:$<$17,*8$:$<1$3/(6)/&21:$<-$<1(&+,*+671(:%85<32570$&22.521$/'' .$5(1/0$57,1,48('51$3/(6)/&22/%2$76//&7$0,$0,75/(1$3/(6)/&223(5.(9,1'$9,'-2',68=$11(&223(5'20,1,&$'51$3/(6)/32/LVWBB3/9.A.2.d Packet Pg. 297 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann &251),(/'67(9(1( '20,1,&$'5,9(81,71$3/(6)/ &255$/-8$1& 62/,, /$1&(:22':$<1$3/(6)/ &267$17,12%5<$1$ '25((10 $1'526'51$3/(6)/ &267$1=2*$5<3 /($+% 7+20$6'5,9(6,/9(5/$.(2+ &267(//2-5-2+13$75,&. (,/((16+($+(1&267(//2 6785*(21%$<5'/8;(0%85*:,&286,16*25'2167(3+(1$11(&286,16.$9$1$*+&5(6&(17-$&.721*/$6*2:*:681,7('.,1*'20 &5$%75((:,//,$0-2'$-$1((//(1&5$%75((32%2;:$56(.$,/&5$16+$:'21$/'/ 6$1'5$, %(48,$:$<1$3/(6)/&5(:61(('+$0( -8/,($&2167,787,21'51$3/(6)/&52//$$17+21< &+5,67,1( '20,1,&$'51$3/(6)/&5287+$0(/-21$7+$1+0,1*&+,1&5287+$0(/0$5</1+$5/(<69,//(3$&58&,77/,9,1*75867:$5:,&.$9(1$3/(6)/&58=',$1$%$5&(/2/$=$5252'5,*8(=25&+$5'/11$3/(6)/&58='20,1*$ 3('52%,6&$<1('51$3/(6)/&58=/,12(7+20$6621/11$3/(6)/&5<67$/&2168/7,1*//&*22'/(77(1257+1$3/(6)/&5<67$/&2168/7,1*//&*22'/(77(1257+1$3/(6)/&8//(10$5.- .$7+/((10 32%2;32&$66(70$&800,1*6(8*(1(( 6$1'5$- $1'526'51$3/(6)/&857,66)5$+0/,9,1*75867 -2<&(/)5$+0/,9,1*75867 '20,1,&$'51$3/(6)/&857,6678'255(+/'*6//& 6+$521678'255(+/'*6//& $5/(7&7%52$'9,(:+*762+&857,6.(,7+(6(7+&&857,60$5<$11&857,6/,9,1*75867 326&2$9(18(/(20,167(50$&867(5/211,(- .$7+<-/,*+7%2851:$<1$3/(6)/&<17+,$&252*,175867&277$*(&28570$5&2,6/$1')/' -1$3/(6,19(67256//&(035(66&71$3/(6)/'$1'/:22':257+5(975867 /$.(9,(:'51$3/(6)/'& .'+,&.6)$0,/<75867$1'526'51$3/(6)/'60,19(670(177586713($5<67$5/,1*7219$'$'$0,2*5(*25<- -($11(& 2$.9$//(<'59,(11$9$'$+0-26(3+ -26(3+,1(5(/,$1&(/$1(/,1&2/16+,5(,/'$+5,1*(5-2+1& 0$5<-$1( $0(1&251(56800(59,//(6&'$0%5$&$50,1( 125$&&28175<648,5(5'2/'7$33$11-'$9,'-52//(55(97586775(9,&28571$3/(6)/'$9,'1$921758673(0%52.(:$<1$3/(6)/'$9,(-$0(6:$/721+,*+%2851('51$3/(6)/'$9,/$-(686$7+20$6621/11$3/(6)/'$9,6/(2 $1*(/$675(9,&71$3/(6)/'($*8,55($1$0$5,$=(17(12 '$/($9(1$3/(6)/'()$5,$1257211(<%$//,621)$55$1'/$.(9,(:'5,9(%28/'(5&2'(/(21-562&5$7(666$1'5$6+8/7='(/(21$1'526'51$3/(6)/'(/(210$18(/&25,2$6+/(<1,&2/(&5800(777+20$6621'51$3/(6)/'($11125675206+$:.(<5(92&$%/(75867'20,1,&$'5,9(1$3/(6)/'(%(//,60$5.- .$7+5<1'(19(55'0$5/7211-'(%25$+//$:62175867&$625,$&71$3/(6)/'(%5$(3/$7775867:(67'(/$:$5(3/$&(&&+,&$*2,/'(%5$/28,6(+,5$.$:$$1&21$7586732720$&/$1((/.*529(9,//$*,/'(&.(5/$:5(1&($ /28,6(0 15,9(56,'('5%5,&.1-'(+$9(1-5-$0(653$75,&,$$11'(+$9(1'20,1,&$'51$3/(6)/'(/.0$5,$ ('*$57$0,$0,75$,/(1$3/(6)/'(/8&$5$1'<67(3+(1/$85$9(521,&$'(/8&$$17,*8$:$<1$3/(6)/'(/8&,$521$/'0$1'526'51$3/(6)/'(0$57,1,7+20$6&&/$8',$/'(0$57,1,+,//6,'(67:(//60('(0$6,/,6$07+(+(/0($67,6/,31<'(0(56'$9,'0'(1,6(686$10<(56:$5:,&.$9(1$3/(6)/'(01,&.,'(11,6- -2$11(0/,*+7%2851:$<1$3/(6)/'(11,65%$./,975867:+((/(5'525/$1'3$5.,/'(12)5,20,&+$(/(5,102+$5$'(12)5,2'8$1('51257+5('',1*0$'(3(5520$57,1-26(3+526(0$5,(&,$&&+,'(3(552 :675((7%25267+8'6212+'(33(57/$85$$$1(*$'$'51$3/(6)/'(5&2/((':$5' 686$17$1*/(:22'6+$0'(1&7'(5,9$/-26(3+$ -8/,(11( 0,1',$9(1$3/(6)/'(6$17,6-2+10$5.-8',7+$11'(6$17,6$1(*$'$'51$3/(6)/'(6+(7/(5686$1(72572/$&71$3/(6)/32/LVWBB3/9.A.2.d Packet Pg. 298 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann '(628=$&+$5/(66 0$5,$0$%(/'(628=$ 7+6,'(5'*(25*(72:1/*6&$1$'$ '(63$5'7+20$6(6+(/0$1 *$</((':$5'6'(63$5' ),''/(56*5((1/$1&$67(53$ '(67(1252%(57 0$5*$5(7 75(9,&28571$3/(6)/ '(9,773$75,&.- .$5(1$ &,217$5)5''8%/,1,5(/$1' '(:5(//75$&(< 0$5$ 6(63/$1$'($/3+$5(77$*$ ',785,$11$* &$<671$3/(6)/ ',$&21(6&8'$10,+1($ (/,6$%(7$9,&725,$',$&21(6&8 :$5:,&.$9(1$3/(6)/ ',$1$+'$0,$125(975867 $1'5(:6'$0,$1275867 %5,'/(:22'5'1257+%522.,/ ',$1(05,''/(75867 (/%2:$9(1$3/(6)/ ',$=<2/$,1($50(17(526 5,*2%(5720$57,1(=$*8(52 :$5:,&.+,//6'51$3/(6)/ ',%8212-26(3+* 75$&(<7$5$17,12',%8212 &29,1*721&72$.%522.,/ ',(8-867((00$186 52/$1'(25$1*( 526($9(1$3/(6)/ ',*,29$11,'20,1,&$ -26(3+,1(',*,29$11, .((/(675((7&21&25'/.%&$1$'$ ',0(11$3$8/0 :7+67%(5:<1,/ ',;21&+$3/,1( 75(9,&71$3/(6)/ '-%($5//& $5'6/(</$1(%5,'*(:$7(51- '2(3.(5(975867 =85,*2/11$3/(6)/ '2+$17,027+< 6+$:1$%(// $1'526'51$3/(6)/ '20,1*$)/2:(562)1$3/(6//& 5$77/(61$.(+$002&.5'1$3/(6)/ '2129$1-(11,)(5/(( 6+$:13$75,&.'2129$1 &+(67187&7&('$5/$.(,1 '28*/$6)$'$065(9/,975867 /,77/(+$5%285/$1(1$3/(6)/ '28*/$6)$'$065(9/,975867 /,77/(+$5%285/$1(1$3/(6)/ '280$6()./,'(6&/,))25' ',$1($1'(5621'280$6 &/$5(1'21'51$3/(6)/ '2</(52%(57- 0(/,66$-.$+1 $1'526'51$3/(6)/ '5$))(1'(11,6 526($9(1$3/(6)/ '5$*,&(9,&(0,/ 5$'0,/$ :+,63(5,1*:,//2:6&7%$//:,102 '5$.(-5&+$5/(6:(6/(< (//(13'5$.( $9(//,12:$<1$3/(6)/ '5(:6'(77/,1*/,9,1*75867 %522.6,'($9(%,50,1*+$00, '8))<7+20$63 -8/,( '20(1,&$'51$3/(6)/ '8**$15866(//$57+85 &25,11($11'8**$1 '20,1,&$'51$3/(6)/ '81&$1)$0,/<5(975867 '20,1,&$'51$3/(6)/ '85+$03$8/ +$=(/$ '20,1,&$'51$3/(6)/ '87&+'(11,6(//,277 -$&48(/<15$('87&+ '20,1,&$'51$3/(6)/ ':<(57+20$6& 0$5<$11 :(67025(/$1'$9(3+,/$'(/3+,$3$ (+ 0-+2515(9/,975867 &$<&28571$3/(6)/ (-0$''(10&*5$7+5(975867 :$55(1$9(:2//$67210$ (&+(0(1',$,,5$)$(/-26(3+ $1'5(:6$9(1$3/(6)/ (*$1'2527+<7 %(51$5'-)$5/(< $1'526'51$3/(6)/ (*$13$75,&,$0 /<)25',6/('51$3/(6)/ (+0$11'28*/$652%(57 )5$1&(6&$0$67$1'812(+0$11 6$:0,//&73+2(1,;0' (,/((1*$//$*+(575867 '20,1,&$'51$3/(6)/ (,6$0$1.$5/(':$5' &$50(17(,6$0$1 +($57+6721(&,5*5((16%85*3$ (/$,1(0*8,17$/,9,1*75867 $1'526'51$3/(6)/ (/$,1(67$1*/$1'5(975867 :$7(5%85<$9(0$',621&7 (/,=$%(7+$$&(725(975867 $17+21<$&(72,,,5(975867 75(9,&71$3/(6)/(//(50(<(5)5$1.*,1*(0$5,$(//(50(<(5/<)25',6/('51$3/(6)/(//,652%(57.%5(1'$'$32=(//,65('%$1.5':(6(59,//(2+(/0(1'25)5,&+$5':0$5,(<,%5,1(/0(1'25)/8&$<$:$<1$3/(6)/(0,',2/83,1,758670$5*$5(7$1'(5621/83,1,75867 %(48,$:$<1$3/(6)/(1'(5/(-21$7+21 .,0%(5/<&233(55,'*(5'/,77/()/2&.$5(1*/,6+,,,7+20$6$('*(:$7(5'5,9(48,1&<0$(3352%(57 1$1&<6$,17$1'5(:6%/9'1$3/(6)/(5,&-$5(1%(5*/,9,1*75867 0'(1,6($5(1%(5*/,9,1*75867 6($6+25(5'&$3(0$<1-(51677+20$6*5$+$0*$,/$(5167$1(*$'$'5,9(1$3/(6)/(5:,1-2+15$1'$//(9(/,1$7(5(6$(5:,1$/$0$1'$'51$3/(6)/(63(1+$,15$/3+'-$0,/$+27$.,%$57+(/(0<$9(1$3/(6'&(67,//52%(57,6287+48((1675((7<25.3$(776'28*/$6(686$1075$,125(776)850$13/$&(($67125:,&+1<(9$16-$1,&(/28,6(%/8(5,'*('5,9(1$3/(6)/(9$16.$7+/((1/28,6(($67/$.(5'0&'2128*+*$(9(5(771(,/ 1$1&<612:%5,'*(:$<%/8(02817$,16/<&$1$'$(;(&87,9(5($/7<0*07//&&25325$7('5:/$1*+251(3$(;,/+200(0(5(67%$<6+25('51$3/(6)/32/LVWBB3/9.A.2.d Packet Pg. 299 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann )$%,6,$.:$/7(5 /25,: 0$57,1,48('51$3/(6)/ )$+(<:$/7(5- 72572/$&71$3/(6)/ )$,5%$1.0,&+$(/-$0(6 +$11$+1,&2/(:2/. +,*+%2851('51$3/(6)/ )$5(6/6&253 7,0%(5:22'&,5&/(1$3/(6)/ )$52,17(51$7,21$/*5283//& +21(<%(('51$3/(6)/ )(/,&(5,&+$5' 0$51(// 75(9,&71$3/(6)/ )(51$1'(=0,&+$(/5 7+(5(6$))(51$1'(= $1(*$'$'51$3/(6)/ )(55(//-2,175(92&$%/(75867 75(9,&71$3/(6)/ )(55,-26(3+- .$5(17 $1(*$'$'51$3/(6)/ )(55,60$77+(:- '$1$ 72572/$&28571$3/(6)/ )(77(52/)0<5210 -$1(70 0$57,1,48('51$3/(6)/ ),)7+7+,5'%$1. 0'$7$&253)$& )2817$,1648$5(3/&,1&,11$7,2+ ),1/(<65-21$7+21(5,&. /,6$0),1/(< /,*+%2851:$<1$3/(6)/ ),25(17,12+(/(1(0 3$5.9,(:'5%521;9,//(1< ),25(17,12-26(3+$ 3+,/,33$;*,5/,1* $1'526'51$3/(6)/ ),6(5&2/(77( 5,**65'(5/$1*(5.< ),7=*(5$/'&$52/ $1'526'51$3/(6)/ ),7=:$7(50$77+(:6 (/,=$%(7+),7=:$7(5 '20,1,&$'51$3/(6)/ )/$1$*$1.$5(1/ :,/621%/9')$//6&+85&+9$ )/(,6+(5-5+$52/'/ $8'5(<+)/(,6+(5 3(0%52.(:$<1$3/(6)/ )/(0,1*7+20$60 &$1$/:$<+$03721%$<61< )/25(6-&58= /8&,$ 25&+$5'/11$3/(6)/ )/25,'$32:(5 /,*+7&203$1< 3523(57<7$;36;-% 81,9(56(%/9'-812%($&+)/ )0&2/(//& 7+(:$<+286(5('6+87(+,// +(50,7$*(7+$7&+$05*4+81,7('.,1*'20 )2/(<%5,$1( &$52//%52:1 &5$1%(55</$1(6($67210$ )2/.0$1%5,$1'$9,' 6721(%5,'*(5'6$,173$8/01 )2//,1:,//,$052%(57 -$&48(/,1(:,&.)2//,1 $1'526'51$3/(6)/ )255(67*$0$5$17+/$1'75867 32%2;%21,7$635,1*6)/ )255(67*$0$5$17+75867 $//,621'()225 32%2;%21,7$635,1*6)/ )256/81''(%%,($ 72572/$&28571$3/(6)/ )267(50$5.$ %$5%$5$6 %52$'%5$1&+&,55,&+021'9$ )27,3(7(5- )5$1&(6& 0(55,9$/('5,9(60,7+72:11< )2;+29(1&5$,*$ 5(%(&&$' '20,1,&$'5,9(1$3/(6)/ )5$1.$3529(1=$%75867 :22'+$5%25'5)257:257+7; )5$1.(/-867,1& &2/21,$/'51$3/(6)/ )5$6(5&+5,6723+(5 75(9,&71$3/(6)/ )5$8(1+2)(57+ '$:1/$0%5,; &/$5(1'21'51$3/(6)/ )5,('0$10,&+$(/$ /21$$ 7+67($6702/,1(,/ )80$1'2$1*(/$ $0%2<5'67$7(1,6/$1'1< )86$5252%(57- /$5$,1(/9,9,$1, %$/6$0'5',;+,//61< *)%,5&+0(,(575867 :,//2:6+25(6'5,9()(17210, *$))1(<,,,(':$5'-2+1 &/$5(1'21'51$3/(6)/ *$))1(<52%(57 .5,67(1$/,&(*$))1(< $1'526'51$3/(6)/ *$,/0',1.,1)$0,/<75867 63,&(:22''5$11$1'$/(9$ *$/$5=$--(686$*8,55( 0$'(/526$5,262/2-$5$0,//2 7+$9(6:1$3/(6)/ *$/,$1250$* 1250$1'<'51$3/(6)/ *$/,1'2)5$1&,6&2 '2*:22':$<1$3/(6)/ *$/,1'2)5$1&,6&2 '2*:22':$<1$3/(6)/ *$/,1'252*(/,2 5'/16:1$3/(6)/ *$/,272'(1,6($'$1,(//(0*$/,272&$%(//&70255,672:11-*$//$*+(552%(57-*(5758'(0*$//$*+(5-2+10$+$5+:<%5$,175((0$*$//$5'2,9$1- '2/25(6( &$552//$9(18(9$//(<675($01<*$//,65-26(3+$3$75,&,$0*$//,9(521,&$'5&+(67(5635,1*63$*$//,9$1+20(5)0/<75867 */$6*2:675((7.,7&+(1(5101&$1$'$*$//2:67(3+(1&$50(1&/$8',1(0$5&(//(*$//2: 6$92<&5(62$.9,//(//<&$1$'$*$1,0/$:5(1&(- ',$1(+ 3(0%52.(:$<1$3/(6)/*$5&,$-25*($1$/6(55$72*$5&,$25&+$5'/11$3/(6)/*$5&,$-26('2/25(67+$9(1(1$3/(6)/*$5&,$0,*8(/7+676(1$3/(6)/*$5&,$52%(57&/$5$(025$6$,17$1'5(:6%/9'$1$3/(6)/*$5((-$0(6+2//<$9(1$3/(6)/*$5((-$0(6.+2//<$9(18(1$3/(6)/*$570$1-21'$9,' /,/,$11$ $63(1635,1*6&28575('',1*&$32/LVWBB3/9.A.2.d Packet Pg. 300 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann *$5=$*8$'(/83(& /20%$5'</11$3/(6)/ *$66(5/85(1() +,*+%2851('51$3/(6)/ *$77-$0(60$5&(/ 3$8/,1('(1,6(*$77 /<)25',6/('51$3/(6)/ *$<6'(11,6 -$1,&( 1:$9(&25$/635,1*6)/ *(//(5'$9,'0 7,1$6 $1'526'51$3/(6)/ *(1(9,(9((+85/(<5(975867 -2+17+85/(<5(975867 $1'526'51$3/(6)/ *(129(6(&+5,6723+(5 9,&725,$5*(129(6( $9(//,12:$<1$3/(6)/ *(2))5(<7:(/&+/,975867 &$625,$&28571$3/(6)/ *(2))5(<7:(/&+/,975867 &$625,$&71$3/(6)/ *(25*($%5$1'(65(975867 %$5%$5$%5$1'(65(975867 :$5:,&.$9(1$3/(6)/ *(25*()$&&21(/,975867 5,7$)$&&21(/,975867 7+$9(11$3/(6)/ *(25*(.:,(*2/'5(975867 0$5<-:,(*2/'5(975867 )25(679,(:'5/$.(%/8)),/ *(25*(/3$8/(<75867 6&277+6&+0,'7.(75867(67 &$625,$&71$3/(6)/ *(25*(0$5,(17+$/5(9/,97586 &2167,787,21'51$3/(6)/ *(5+$5'77,027+<) 1$11(77(0.*(5+$5'7 %$<671$3/(6)/ *(50,1$5,2-26(3+ $'',6213/5,'*(:22'1- *(571(5$/)5('- 5$&+(/ $1'526'51$3/(6)/ *(57=0$5<$11 75(9,&28571$3/(6)/ *(<6/(+0$1167(3+$1 8568/$/(&+0$11 0$57,1,48('51$3/(6)/ *+((10,&+$(/ -,/// :(6725$1*(+,//&,5&/(&+$*5,1)$//62+ *,$11,12-5&+$5/(6-26(3+ /8&,$11(*,$11,12 )2;:22''5%$/':,169,//(1< *,$1128&+5,6726 7(5,$11( &81$5'67+$/,)$;%.%&$1$'$ *,$1128&+5,6726 7(5,$11( &81$5'67+$/,)$;%.&$1$'$ *,%1(<7,027+<- 7+20$6,1$$+</$1' 60,7+0$125%/9':(6725$1*(1- *,/%(573$0(/$% $9(//,12:$<1$3/(6)/ *,/&+5,67*$5<$ '20,1&$'51$3/(6)/ *,//(77,-2+1/ 7(03/(7(55$&(1257+)2570<(56)/ *,/0$1521$/'0 6+$521$ +(15<'5%$55,1*7215, *,/6213$8/- 0$;,1( :$5:,&.$9(1$3/(6)/ *,1'(5)5$1&,6- 686$1-$1(%/('$ 0$57,1,48('51$3/(6)/ *,1'(5)5$1&,6-2+1 686$1-$1(%/('$ &$<&28571$3/(6)/ *,16%(5*+$5/(1(3 /<)25',6/('51$3/(6)/ *,817$-2$11( %(48,$:$<1$3/(6)/ *,86,$1$-26(3+3 '211$0'25$1 )25(67$9(%8))$/21< */25,$$/%(57,5(92&$%/(75867 '20,1,&$'51$3/(6)/ */25<),1$1&,$/&253 &25325$7(6:81,71$3/(6)/ */2:$&.,-$167$1/(< &$52/($*/2:$&., &/$5(1'21'51$3/(6)/ */<11.(11(7+- %5(1'$. %(48,$:$<1$3/(6)/ *2')5(<6+$:00,&+$(/ '(/25(286&/$5(1&(*2')5(< 0,&+$(/$1'5(:7+20$6*2')5(< 9(1(723/1$3/(6)/*2('7(/0,&+$(/ /(125(&+$5/(6$9(0$66$3(48$3$5.1<*2*(70,&+(//8&5$<021' %,587$$11$*2*(73$5.*$5'(1/$1(5(67219$*2//,1*(5-$0(6$/(,&0((%(48,$:$<1$3/(6)/*20(=$5&$',26$17,$*2/8,6$&58='(6$17,$*2$1'5(:6$9(18(1$3/(6)/*20(=0,5<$0*/$'<67+676:1$3/(6)/*21=$/(6-8$1* 0$5,%(/%,6&$<1('5,9(1$3/(6)/*21=$/(=%527+(56,19(67//& )25(67/$.(6%/9'1$3/(6)/*21=$/(=6(5*,2'$1,(/27,/,$*21=$/(=%(48,$:$<1$3/(6)/*22&+)/2<':$51(.$7+/((1+$55,1*721*22&+ &/$5(1'21'51$3/(6)/*25$1672-.26., 1$1&<$672-.26.,5(92&$%/(758671,.2/&(0,/(96.,7+675((761$3/(6)/*25',1)$0,/<,55(975867.(55</$1(67$7(1,6/$1'1<*25'2167(3+(1/6255(/&,5&/(()$/0287+0$*250$15+,$11$/((&25(</((*250$1$1'5(:6$9(1$3/(6)/*277'$1.)5$1./,1':(1'</<11(*277'$1.6$0$17+$'5/(:(6'(*5$%2:6.,-$0(60(/,=$%(7+$*5$*2:6.,72572/$&71$3/(6)/*5$&((':$5'- 6$1'5$-$1'526'51$3/(6)/*5$(66(/(7$/.$5/7+20$6 75(9,&28571$3/(6)/*5$+$0'211$5 &+$5/(67 7857/(&5((.3,776)25'1<*5$+$0(,/((13(0%52.(:$<1$3/(6)/*5$+$00$5,(*+$,7,'51$3/(6)/*5$17//,1(%(55<7586766(%$67,$1/,1(%(55<75867 /,*+7%2851:$<1$3/(6)/*5$9(1*22'-5&+$5/(6&257/(< &28571(<%%(//$,5($1'526'51$3/(6)/*5$<-26(3+0 5,7$0+,&.25</12$.)25(67,/*5($7(51$3/(6),5(5(6&8(',675,&7&2//,(5%/9'1$3/(6)/32/LVWBB3/9.A.2.d Packet Pg. 301 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann *5(&20$57,1- 0$5&,$(:,17(56 6721(5'%(/02170$ *5((1),(/''$9,' 686$1 /,*+7%2851:$<1$3/(6)/ *5((1:$/'6(<0285 +$55,(7*5((1:$/' '20,1,&$'51$3/(6)/ *5(*253$75,&,$$ (/%2:$9(1$3/(6)/ *5,'(50,//$575867 72572/$&71$3/(6)/ *5,)),1'(%5$5 /$85$0$1*,1(//, 1'671(1$3/(6)/ *5,)),10$85((1 &2167,787,21'51$3/(6)/ *5220672'' 08//(7&71$3/(6)/ *52660$1/,9,1*75867 %(48,$:$<1$3/(6)/ *58&&,9,1&(17 -$1(0*58&&, 3(0%52.(:$<1$3/(6)/ *8(/,&$50(/23 */25,1'$ -2+1)5('(5,&.'5$1&$67(5/*(&$1$'$ *8(16&+'$9,') (/,=$%(7+ &/($5:$7(5&,5)2*(/69,//(3$ *8,'2)$0,/<75867 '20,1,&$'5,9(1$3/(6)/ *837$$581 *((7$ &2817</,1(52$'*$7(60,//2+ *837$6$1-$< 6$0((5$ &203$57,6/('51$3/(6)/ *87,(55(=$,'$/ /20%$5'</$1(1$3/(6)/ *87,(55(=&$5/260$5&(/2 5(%(&&$%($75,&(%$7,67$ '20,1,&$'5,9(81,71$3/(6)/*8<$77,5(1$=2),$6$,17$1'5(:6%/9'%1$3/(6)/*8==2.12:/(6(/,=$%(7+$ :$55(15.12:/(6%$<$9(2&($1&,7<1-*8==2$17+21<6 ',$1(932%2;7851(569,//(1-+ +($6775$,///&/$*221$9(18(1$3/(6)/+ +($6775$,///&/$*221$9(18(1$3/(6)/+$'/(<7+20$6: &$52/-2$1 $1(*$'$'51$3/(6)/+$)1(50,&+$(/$ -($10&$5/$/$1(/,77/(&$1$'$01+$/(;&25325$7,21*$//(5,$&767(1$3/(6)/+$//-(55<7 $'5,(11(*61<'(5$9(%(/0$51-+$//$&.-($11(0,&+$(/+$//$&.&<$&(1'$'5,9(0255,63/$,161-+$/3,11(,/ '(%25$+&$625,$&71$3/(6)/+$0,/721+$5%250$5,1$,1& *22'/(77(5'11$3/(6)/+$0,/721+$5%250$5,1$,1& *22'/(77(5'11$3/(6)/+$0,/721+$5%250$5,1$,1& *22'/(77(5'11$3/(6)/+$0,/721+$5%250$5,1$,1& *22'/(77(5'11$3/(6)/+$00(5%/$1( 0,&+(//(3529,'(1&(&859(0$3/(63/$,101+$002&.&29(//&6(:$5'$9(1$3/(6)/+$002&.&29(//&6(:$5'$9(1$3/(6)/+$11(77*$</( -2+162/':22':$5'$9(%,50,1*+$00,+$16(1+$52/'/((%$5%$5$/<',$:,16721'20,1,&$'51$3/(6)/+$160$1'21$/'-)/$*67$5&7)2817$,1,116&+$5021&+$5/(6%$55<*$,/'+$50210$57,1,48('51$3/(6)/+$50217+20$6' 0$5<775((/,1('5,9(&2/80%86,1+$532/,63$12 -2',0853+< *5(71$+,//65'3/($6$179$//(<1<+$55,0$1/2,6$9(//,12:$<1$3/(6)/+$55,1*7217,027+<0$5<-$1(+$55,1*721'20,1,&$'51$3/(6)/+$55,6&$50$6721(:$//'5%285%211$,6,/+$55,6210$5<$75(9,&28571$3/(6)/+$55,6215,&+$5'3 /,1'$- %2*$672:%522.5'6+(5%2510$+$57&$66$1'5$-((1'(-21*&6$/7'2&.5'81,73(55<6281'3$:&$1$'$+$57&+$5/(6: /,1'$-:+223,1*&5$1(:$<1$3/(6)/+$57*$,/$6:(67'5'(11,60$+$570$110,&+$(/+2:$5''257+(+$570$11%(48,$:$<1$3/(6)/+$5:22'-2+1'68=$11(/(&/(5&75(9,&28571$3/(6)/+$67,1*6-2+1- -2$11(+,*+%2851('51$3/(6)/+$7(57+20$6 6,/.(+$6(13)$''2567(1*(50$1<+$86,152%(57-+$:.671$3/(6)/+$86,152%(57-+$:.675((71$3/(6)/+$<(6$57+856 /,1'$.*5(<$9($//(13$5.0,+$<(6-$0(6:%$5%$5$060,7+$1'526'51$3/(6)/+$=$15,&+$5'- 75$&(</((3(0%52.(:$<1$3/(6)/+($9,6,'()5('(5,&.-'(%25$+)266+($9,6,'($1'526'51$3/(6)/+(,6(56+$521/$.(9,(:'51$3/(6)/+(1'(56210$5.' -,//$11 '20,1,&$'5,9(81,71$3/(6)/+(1'(56210(/,1'$0,1',$9(1$3/(6)/+(1'5,;)$0,/<75867&$<&28571$3/(6)/32/LVWBB3/9.A.2.d Packet Pg. 302 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann +(11(%5<%5,'*(7$11 +,*+%2851('5,9(1$3/(6)/ +(11,('$9,' .$5(1 0($'2:%522.'50(17252+ +(11,1*%5$1'7 0,&+$(/$5(,7(5(5 &+(55<:22''51$3/(6)/ +(15,.66216&277 $<6(121'(5 1250$1'<'51$3/(6)/ +(5%(57'28*/$6/ &25,11(/<$11(*22'0$1 1*/(1:22'$9(&+,&$*2,/+(5,7$*(1$3/(6//&&2.(17&203$1,(6,1&5287(+,*+/$1'0,//61<+(51$1'(=$*867,1(67+(56$17,$*2%$87,67$$1'5(:6$9(1$3/(6)/+(51$1'(=$1$$1'5(:6$9(1$3/(6)/+(51$1'(=('*$5 6$1'5$ +2//<$9(1$3/(6)/+(51$1'(=('*$5/6$1'5$+(51$1'(=%$<6+25('51$3/(6)/+(51$1'(=('*$5/6$1'5$+(51$1'(=+2//<$9(1$3/(6)/+(51$1'(=('*$5/6$1'5$+(51$1'(=+2//<$9(1$3/(6)/+(51$1'(=)5$1&,6&2 '$:10 .,1*6/$.(%/9'1$3/(6)/+(66/,9,1*75867&/$5(1'21'51$3/(6)/+(66(<('/ '$1$)'20,1,&$'51$3/(6)/+(7=1(50$5.67+5(6+(5'51$3/(6)/+,%%6021,&$75(9,&28571$3/(6)/+,//-57552%(57/ -2$152%(57/+,//-55(97586787'$0(1'('67$9(61$3/(6)/+,//'$9,'-$1'5(:6$9(1$3/(6)/+,//686$1 3$8/$/%5,*+7'5/29(/$1'2++,067('7+$/'21*,/%(57&$5(13$8/,1(+,067('7(/%2:$9(18(1$3/(6)/+,15,&+6(1(5.6,021.$5(1+,15,&+6(1:$5:,&.$9(1$3/(6)/+152'5,*8(=)0/<5(975867 '20,1,&$'51$3/(6)/+2))$&.(5-$<- -2$11(//,*+7%2851:$<1$3/(6)/+2))(5%(57+6552%(57'$9,' 3$75,&,$-($1+2))(5%(57+ 52%(57'$9,'+2))(5%(57+,, 3(0%52.(:$<1$3/(6)/+2/0(6.$5,10$57$$1(*$'$'51$3/(6)/+2/7*5(*25<5 '(%5$)32%2;&2.$7201+223'$5/(1(0$5,(+2//<$9(1$3/(6)/+23.,16(7$/5+(1((66$1'+,//5'/$69(*$619+25126.<-55$<021'.(11(7+ /(6/,($+25126.<:$5:,&.$9(1$3/(6)/+2567 ,5(1(667$1*(75867 /$.(%5((=(&2857/$.(=85,&+,/+259$7+.5,67,1( '$1,(/135$,5,(:22'6&767&+$5/(6,/+26(<7+20$6&$5/ 0$5<$11 1&(1785<2$.&,5&/(2$./$1'7:30,+2:$5'-0,//(50(',&,1(3& (/.67&28'(5632573$+2:$5'-681'5(97586775(9,&28571$3/(6)/+2:(167,1(75(9257$0,$0,75$,/($671$3/(6)/+2:(167,1(75(9257$0,$0,75$,/($671$3/(6)/+2<7%5,$16&277%,6&$<1('51$3/(6)/+8(77(0$15,&+$5'-2+1&$<&28571$3/(6)/+8*+(60,&+$(/-2+167$&(<*$//(1+8*+(6'20,1,&$'51$3/(6)/+817'(%%,(67+676:1$3/(6)/+8567$.'$1,(/-'$1$+3$/+86$,1,($67676781,7%267210$+8577(55<- $1*(/$*32%2;)7&$/+2811(+867$''$1,(/52%(57&<17+,$/28,6(08//(1+,*+%2851('51$3/(6)/+87&+,1621/$55<*+(,',(*$1-,1(++87&+,1621 &$625,$&28571$3/(6)/+<21-$/(($%52165(975867 *$/(21'51$3/(6)/,0+2)(7+$1'29(5/$1''5,9(-2+1672:1&2,1)$17(6*,/%(572,<$0,/(60,*2<$$1'5(:6$9(1$3/(6)/,11(60,&+$(/'9,9,$1:/(81*$1(*$'$'51$3/(6)/,66($1721,203,1(75(('51$3/(6)/,825,23$648$/,120$5,$,825,26$/9$725(3832:22'/$1'75/&7:22'%5,'*(//+&$1$'$,=$*8,55(,*1$&,2%5,&(/'$6,/9$526($9(1$3/(6)/-$ 0*$11$77,5(97586772572/$&71$3/(6)/-&.8&=,16.,5(92&$%/(75867 &+(/721/1&,1&,11$7,2+-'$//(*5,1,5(975867$0$//(*5,1,5(975867 -$&2%6/$1(125:(//0$-$%5,-$60,1()$%,2,$11,&&$75(9,&71$3/(6)/-$&2%6//&7$0,$0,75$,/(1$3/(6)/-$&2%6//&7$0,$0,75$,/(1$3/(6)/-$1$6'$1,(/$&+5,67,1(0%$),$3,12$.'5+20(5*/(1,/-$1(.6(,3/(75867.5$0(55'%2:/,1**5((12+-$1.(.$,0 6+$521/&$1'/(:22'/$1(%$55,1*721,/-$16(1+(50$1 -26(($1'526'51$3/(6)/-$3$7$//&7$0,$0,75/(1$3/(6)/32/LVWBB3/9.A.2.d Packet Pg. 303 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann -$5$0,//2$02'25 $1721,$ 25&+$5'/11$3/(6)/ -$5$0,//2-26( 0$5,$*8$'$/83(-$5$0,//2 323/$5:$<1$3/(6)/ -($1$1'5( :,//,$$77,/,6 $1'5(:6$9(1$3/(6)/ -($13,(55(-26(3+:,//,$0 0$5,(0$'(/(,1(6$,171(5*(5 323/$5:$<1$3/(6)/-())5(<'0$&21$*+<5(975867 &251(56721(&7'2</(672:13$-(/,1(.(':$5'5 0$5<:3(5.,1652:7236),(/'0$-(/,1(.(':$5'5 0$5<:3(5.,1652:7236),(/'0$-(1.,16&2'<32%2;1$3/(6)/-(11<*%$-$/&$/,(9.23375867 72572/$&71$3/(6)/-(16(1%5,$1( /$,/$$1'526'51$3/(6)/-)'1$3/(6//&%$/'($*/(:$<1$3/(6)/-,0$(**/2%$///&+2//<$9(18(1$3/(6)/-,0(1(=,,,5$)$(/32//<$9(1$3/(6)/-2&++(,0%(51+$5'',$1$'$+1=-2&++(,0/<1'+8567'57+251+,///77&$1$'$-2+(/'$9,'$57+850$5*8(5,7($11-2+(//8&$<$:$<1$3/(6)/-2+1%2*$57/,9,1*75867 5('21$:$<1$3/(6)/-2+1(%2*$57/,975867 5('21$:$<1$3/(6)/-2+1(78//(<,,5(975867%5(1'$/78//(<5(97586732%2;1$6+8$1+-2+1)(51$1'(= 7(5(6$)(51$1'(=5(9/,97586775(9,&71$3/(6)/-2+1-086725(92&$%/(75867 )8/721670$66$3(48$3$5.1<-2+1/<21/,9,1*75867($67$87801581&,568*$5/$1'7;-2+1621(':$5'+ .$7+/((1 26&(2/$'5%2&$5$721)/-2+1621-(55<* 6+$521/ :$5:,&.$9(1$3/(6)/-2+1621-,///(1'8$1(*$'$'5,9(1$3/(6)/-2+1621.$7+/((10$5,((':$5'+$52/'-2+162126&(2/$'5%2&$5$721)/-2+16217(5(6$'20,1,&$'5,9(1$3/(6)/-2+1621:,//,$0- (/(6$0 $1'526'51$3/(6)/-2+16721:,//,$0 -2&(/<1 $51277'5(11,6025(./7&$1$'$-2+<1(2+$05$5(975867/<)25',6/('51$3/(6)/-21(6.(9,16$+$50'$-$1,-21(6$1'526'51$3/(6)/-25'$1'$9,'- .$5(1(/<)25',6/('51$3/(6)/-26(3+-(11<&$5/60$5,(/*8(55,(5323/$5:$<1$3/(6)/-26(3+,1(-0$5.675867(67 5(38%/,&'51$3/(6)/-2670$5,$.&/$5$),1*$5$1'5(:6$9(1$3/(6)/-2<&(7+20$6 0(/$1,(5('21$:$<1$3/(6)/-2<&(7+20$6 0(/$1,(5('21$:$<1$3/(6)/-3025*$1&+$6(%$1.86 5$77/(61$.(+0&.&2,1'8675<&2168/7,1**5,1& 32%2;:,&+,7$)$//67;-8(5*(16)$0,/<5(975867+8(00/,1*:(*+$1129(5*(50$1<-8/,($+((/,9,1*758675,&+$5'$+((/,9,1*758670&&/(11$1'5,9((11,6025(./7&$1$'$-81*%$5%$5$5$(.,0%(5/<%(7+'(75,&./<)25',6/('51$3/(6)/-85<*$5< 0,&+(//($1'526'51$3/(6)/.$277(160(<(55(975867%5$')25'&7/$.()25(67,/.$,6(5686$1-3$75,&,$0+87&+,1621'20,1,&$'5,9(1$3/(6)/.$/(5*,66+,5/(<-($1:+$9(1670281735263(&7,/.$/,1($11$-(520(&.$/,1($1'5($0.$/,1(6:5'&73$/0(772%$<)/.$/0$167(3+(1,&;+5,67,1(&$172.$/0$1&5,67,1$ 60$,1675((7$1'29(50$.$0,16.,7+20$6'.$7+/((1(.$0,16.,%$57+(/(0<$9(1$3/(6)/.$1(/2328/26-5*(25*(-/$.('5<8.212..$5(1*($6/(<5(92&$%/(75867 :$5,&.$9(1$3/(6)/.$5(1+$0675$5(975867:67$7(5':$.(),(/',1.$5-(/&+5,67,1( (5,&3($5/$1(/$1&$67(51<.$50,60,&+$(/( 9,9,$1332%2;%/$&.6%85*9$.$63$5,$15,&+ /,6$$+,*+%2851('51$3/(6)/.$7+/((1(2/($5<)$0/975867.,&.$322'5)5,6&27;.&5($/(67$7(//&%,5*,77'$**((650<$..$&,7<)/.(/'(5+286(%58&(:/(,*+.(/'(5+286()2**,172:15'%5(:67(51<.(//<&+5,6723+(5 .$7+/((1 1(:3257+$5%25'5,9(325760287+5,.(//<0$57,13$75,&.0,&+(//(68(.(//<&$<&28571$3/(6)/.(//<3$75,&,$$-$0(6*9$1&/(()1,&+2/621.(<&2/761(&.1-.(11('<',$1(/$92,($1'526'51$3/(6)/.(11(7+(/(232/'4357($677+67$37$1(:<25.1<.(51'2527+<$6$,17$1'5(:6%/9'1$3/(6)/.(550,&+(/(6$,17$1'5(:6%/9'%1$3/(6)/32/LVWBB3/9.A.2.d Packet Pg. 304 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann .(9,100&$//,67(5 3$8/$- 0&$//,67(575867 '$:/(<'5),7&+%85*:, .(</,0(+286(//& /,*+7%2851:$<1$3/(6)/ .+$/,/0$+028') &/($5:$7(5'5,9(0$6212+ .,()(567(9(13$8/ 7(5(6$2523,//$.,()(5 '5<5,'*(52$'9(56$,//(6.< .,/(<-5:,//,$0/ /<)25',6/('51$3/(6)/ .,//((1:,//,$0( -2$11 $1'526'51$3/(6)/ .,/2&+$5/(6 /,1'$ 7(55$9,67$&28571$3/(6)/ .,1*%5,$17 ',$1(0 '20,1,&$'51$3/(6)/ .,1*3(7(5$ /,1'$' /<)25',6/('5,9(1$3/(6)/ ./$+0&$5621$ :22'6,'($9(1$3/(6)/ ./(,152<( 6+$5,/ 5,9(53/$&(52&.<5,9(52+ .1,&+(/72''5 0,&+(/(- $/%(57&28575$1'2/3+1- .12773(7(5/ .$7+/((10 '20,1,&$'5,9(81,71$3/(6)/ .2&,6,,:,//,$0 %(51$'(77( /,1'$68(/$1(&$3(0$<1- .2&,8%$.(11(7+.(,7+ 0,&+(//(/+$55,6 :$5:,&.$9(1$3/(6)/ .2'(,63523(57,(6//& %,6&$<1(&71$3/(6)/ .2'(,63523(57,(6//& %,6&$<1(&71$3/(6)/ .2(1,*$0$1'$.$7+5<1 -$11$686$1.2(1,* /,*+7%2851:$<1$3/(6)/ .2/7&+$*29.267$',1 3$9/,1$.2/7&+$*29$ &+$5/(92,;02175($/+.;&$1$'$ .21='$9,': &+$5,66$$ $1'526'51$3/(6)/ .22/(0((6- *(5/,1'( 75($685(&29(&,5&/(1$3/(6)/ .285,*(25*(6 '(%25$+0 (1',&277*/(13/<0287+0$ .2=$55866(//7 .$7+/((15 72572/$&71$3/(6)/ .5$*+5(%(&&$ $1'526'51$3/(6)/ .5(8=(5'$1,(/*(25*( 021$526(17+$/.5(8=(5 $1'526'51$3/(6)/ .5,(*60$115(,1+2/' $1*(/$ +877(1:(*$1,''(5$8*(50$1< .5,665,&+$5'/ 52%(57$5 $17,*8$:$<1$3/(6)/ .5,665,&+$5'/ 52%(57$5 :$5:,&.$9(1$3/(6)/ .52870$5<*(5$/<1 75(9,&71$3/(6)/ .6:)/+20(6,7(6//& ('*(0(5(:$<6287+1$3/(6)/ .8-%,'$-2+1& 1250$1'<'51$3/(6)/ .8/$-26(3+/ $17,*8$:$<1$3/(6)/ .817=2:(1% 0,&+(//( 5(38%/,&'51$3/(6)/ .:$1/$10$2 (/,=$%(7+3$7,(1&(60,7+ +2//</$1('$5,(1&7 /$0$5&$9,72 526$ '(&22.$9(3$5.5,'*(,/ /$%58==2&$50,1( '$1,(//( 75(9,&71$3/(6)/ /$&+2:6.,/$:5(1&( 9$/(5,( 1(:&+$5'21/$*81$1,*8(/&$ /$)5(1,(5(5,&+$5'- &$52/(/$)5(1,(5( $9(//,12:$<1$3/(6)/ /$*2&$3,7$/,19(670(176,1& :(67)/$*/(5675((7&25$/*$%/(6)/ /$/2**,$75867$*5((0(17 %(//,1*+$05'52&.)25',/ /$0%(57'$/(0 (/,=$%(7+$11/$0%(57 %(48,$:$<1$3/(6)/ /$1*((/,=$%(7+7 &2/21,$/'51$3/(6)/ /$3.(*(5$/'$ -$1,&($ $1'526'51$3/(6)/ /$5$721'$-5(8*(1() 6721(*$7('5+$55,621&,7<3$ /$5.,1:,//,$03 75,1$$11(//,6 %(48,$:$<1$3/(6)/ /$526$65-26(3+- /25(77$ &+5,67,$1-/$526$ &$625,$&28571$3/(6)/ /$6.(7+20$6)5$1&,6 (/$,1(/2,6/$6.( &/$5(1'21'51$3/(6)/ /$85$66&+2(1(0$1'(&/$5$7,21 2)75867 /,1'(1:22'/11257+%522.,/ /$85(1&(/(%$875(975867 %$57+(/(0<$9(1$3/(6)/ /$8529,&725,$ /,1'<%/$852 &5,0621&,5&/(1(:&$67/(3$/$9(&&+,$%(7+$&$<&28571$3/(6)//$:5(1&(**5$=,25(975867/251$%*5$=,25(9758673(0%52.(:$<1$3/(6)//$:5(1&(5./8(1(55(975867 3$75,&,$$./8(1(55(975867 )$50/$1''5+$55,6212+/$<(/'$11</(( 9,&.,/<11 '20,1,&$'5,9(81,71$3/(6)//$=25(,1$/'2 1$1&<+,*+%2851('51$3/(6)//(($(+<81**5$&(/((.(//80%(48,$:$<1$3/(6)//((-,//5%,6&$<1('51$3/(6)//((7,1$ 6+(50$1&:$55(1675((75$06(<1-/()(%95(*$5<) 1250$'20,1,&$'5,9(1$3/(6)//()7/<%5,$17 -($11(77(6$,17$1'5(:6%/9'$371$3/(6)//(+0$1167(3+$1*(<68568/$/(+0$11$1'526'51$3/(6)//(.$6-2$11(6%(9(5/<52$':(67<$50287+0$/(/,2-$621) 0(/$1,(-$1(*$'('51$3/(6)/32/LVWBB3/9.A.2.d Packet Pg. 305 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /(/<648$5(3$571(56+,3 7+(2'25(:(,1(5 :+,63(5,1*:,//2::$<)2570<(56)//(/<648$5(3$571(56+,37+(2'25(:(,1(5:+,63(5,1*:,//2::$<)2570<(56)//(02,1(&260,1$0$5,2$5$1250$1'<'51$3/(6)//(1+$570$5.$//(1'8))(5,1&76$9$*(01/(1,+$1)$0,/<75867&$<&71$3/(6)//(11$5+20(6//&%(1&35$770,/(&<35(663.:<)2570<(56)//(11$5+20(6//&%(1&35$770,/(&<35(663.:<)2570<(56)//(11$5+20(6//&%(1&35$770,/(&<35(663.:<)70<(56)//(112;,,$57+85+8%(57+,*+%2851('51$3/(6)//(21$5'-5*/(117 686$10 (9(5:22'&576($67$0+(5671</(30$152%(57$ &$52/6/8&$<$:$<1$3/(6)//(61,$.*5(*-($11,1(9$/(17$:+,63(5,1*3,1(/11$3/(6)//(81*(8*(1(52=$61*5,9(55'$37('*(:$7(51-/(9(648(5,&+$5' 9,&725,$ &<35(6632,175')2570<(56)//(9<-$<.$5(15,9(56'(5%<676$/(00$/(9<02,6(6 -$1,1$($1'526'51$3/(6)//(9<1$1%(50$10$5.%(50$10,&+$(/32%2;1$3/(6)//(:,652%(57--2$1)35,1(+$,7<'5,9(1$3/(6)//(<'(152%(57* .$<(0$57,1,48('51$3/(6)//,%(5,2,1&9,$0(=1(51$3/(6)//,%(572:,//,$0 '(%25$+%522.,16*5((1'525&+$5'3$5.1</,%(572:,//,$03'(%25$+5/,%(572%522.,16*5((125&+$5'3$5.1</,&$5(5,&+$5'/9$-($1$/,&$5(:22'6,'($9(1$3/(6)//,'(552%(57<$0,16 /,6$) 9(1(723/1$3/(6)//,1'$).(/-,.5(975867'20,1,&$'5,9(1$3/(6)//,1'$0'2/&(7725(975867 75(9,&28571$3/(6)//,7$%$5%$5$81,21675((7+$&.(16$&.1-/0&$1*(/63523(57,(6//&:,63(5%/8))75$,/+,1&./(<2+/2'*(1$1&<(/$17(51:$<$6+/$1'0$/2())/(5)$0,/<758676816(7+,//&,5/,77/(721&2/2*$165.(11(7+2',$11('$9,6/2*$13(0%52.(:$<1$3/(6)//2*$1(51(67%($75,&($//(1/2*$175(9,&71$3/(6)//2,6*5(*25<'20,1,&$'51$3/(6)//23(=)5$1&,6&2526($9($1$3/(6)//23(=5$8/<86(/<0(6$:22'6,'($9(1$3/(6)//25'-53$8/' +($7+(5$',5.6+,5(&70$563$/2:(1+$8373+,/,3-&$7+(5,1($/2:(1+$837&$625,$&71$3/(6)//8%%(1*$5</<119,&.,/<11/8%%(172572/$&71$3/(6)//8&$652%(57-:$5:,&.$9(1$3/(6)//8':,10$5.6'20,1,&$'51$3/(6)//81'<1$1&,(6$0(7$1'526'51$3/(6)//81,1*0$5<(//(175(9,&71$3/(6)//<(0$5.5 /,6$-/,*+7%2851:$<1$3/(6)//<110$5,(67(,17586712 %(48,$:$<1$3/(6)//<2163$75,&. $11(0$5,($9(//,12:$<1$3/(6)//<2167,027+<- -2$110$5*$5(768//,9$175867:(671(/62167&+,&$*2,/05 .-675$6025(5(975867 '20,1,&$'581,71$3/(6)/05 .-675$6025(5(975867 '20,1,&$'5,9(1$3/(6)/05 .0'2,5215(975867$17,*8$:$<1$3/(6)/0$&&/8*$*(6$1'5$//$*221$9(1$3/(6)/0$&'21$/'-())5(<6%$5%$5$-0$&'21$/'+2//<$9(1$3/(6)/0$&.,11210$5/(1(/25(77$'20,1,&$'51$3/(6)/0$&1($/'21$/'+ 0$85((1. $17,*8$:$<1$3/(6)/0$*(//$55<1($/ -2$1$:$5:,&.$9(1$3/(6)/0$*8,5(.$5(11:$5:,&.$9(1$3/(6)/0$+:$1,(6.</$5=((=-2$11($+,1*1257+(51'$1&(5%/9'72521720/=&$1$'$0$,7/$1''$9,'/28,607321<5'&8/3(3(59$0$/7='(5(.6 3$75,&,$'(5(.00$/7=/$%(//(3/$&($6+%8519$0$1&+(67(5*,/%(570'20,1,&$'51$3/(6)/0$1'5(6+67(3+$10'$1,(/-),6&+(575(9,&71$3/(6)/0$1,67,48(+2/',1*6//&0$1,67,48(:$<1(:32575,&+(<)/0$16621/$56$$1'526'5,9(1$3/(6)/0$17,//$+(/(1%1:7+670,$0,)/32/LVWBB3/9.A.2.d Packet Pg. 306 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 0$5$1267(9(1 &$7+(5,1( 1257+*$7('5,9(6<266(71< 0$5%21/$1'75867 *%21,1, ./(326$ /$5,12/223(67(52)/ 0$5&(/+/866,(5/,9,1*75867 3$0(/$&/866,(5/,9,1*75867 $1'526'51$3/(6)/0$5&,$10,&+$(/$1'5(:&$52/<1.$<0$5&,$1/$1.)25'5'+$5:22'0'0$5&,16.,'28*/$60,&+$(/ .$5(1520$120$5&,16.,$17,*8$:$<1$3/(6)/0$5&277(&+$5/(6/%(7+$110$5&277(/<)25',6/('51$3/(6)/0$5*8(5,7(')2/(<5(975867 *29(5125652$'*529(/$1'0$0$5.$67(9(1675867'(%5$/((67(9(1675867 7+67&+$5/(672:10$0$5.'),1.(/67(,175867/28,6($),1.(/67(,175867&+85&+67+$5%25635,1*60,0$5.+$1'(5(55(9758673,1(5,'*(52$'68,7(1$3/(6)/0$5..23(5$/,9,1*75867$1'526'51$3/(6)/0$5.(<'$1,(/3 .</($2/'(72:1(5'52&+(67(50,0$5.29,&+'$9,'0$+2*$1<5,'*('51$3/(6)/0$5/8//&7+$9(1:1$3/(6)/0$56+$//%(77<(6,/9(5*/(1%/9'&2//,1*:22'/<*&$1$'$0$56+$//0,&+$(/(51(67&+(5</1250$0$56+$//:$5:,&.$9(1$3/(6)/0$57,1'21$/'-26(3+-2$170$57,1&$<&28571$3/(6)/0$57,1.$7+/((1$11$17,*8$:$<1$3/(6)/0$57,11,.,7$0$+2//<$9(1$3/(6)/0$5<$1167(,1%,67586732,1765'6<&$025(,/0$5<%:$53,16.,75867 /$.(0$5<'53/$,1),('/,/0$5<-2%85)(,1'75867:,//,$0)%85)(,1',,,75867%877(518775$,/)5$1.)257,/0$5<.$<%8516'(&/2)75867 6287+6358&(&73$/26+(,*+76,/0$5<6$&&+(77$5(975867/,9,1*6721:22'6/11$3/(6)/0$5<6$&&+(77$5(975867/,9,1*6721:22'6/11$3/(6)/0$5<%(7+3+(/$1)$075867 $17,*8$:$<1$3/(6)/0$6&,,*,1,2 .$5(1785.+,//52$')$,532571<0$66$//(15'(%5$$*2:(1&/$5(1'21'51$3/(6)/0$66(5.(,7+(8*(1( +(/(1( 32%2;628'/$1(6$&5$0(1723$0$66(<0$5.%3$0(//$006$/'$1$7$0,$0,75$,/($671$3/(6)/0$6752&2/$-26(3+$ 0$5,$ 67675((71(:%85<0$0$68&&,$17+21<% /,6$$0$16),(/'*529(5'($67+$9(1&70$726/8,6$$1'526'51$3/(6)/0$77(5$-26(3+7%(48,$:$<1$3/(6)/0$77+(:60$77+(:7+20$6621/$1(1$3/(6)/0$7=$-())5(<6$1'526'51$3/(6)/0$<(5$1'5(:67$5%2$5'3$66$*(:$< %21,7$635,1*6)/0$<(5*(25*( /,1'$'20,1,&$'5,9(1$3/(6)/0$==8&$25/$1'2*,86(33,1$67$51,12:,167215'2$.9,//(//:&$1$'$0&*21$*/(:,//,$0-%,6&$<1('51$3/(6)/0&$57+85.$5(1$11'$5/(1(0$5,(0$+21(<:$5:,&.$9(1$3/(6)/0&&$))(57<0$57,17&2//((1&0&&$))(57<&/$5(1'21'51$3/(6)/0&&$57(50,&+$(/- */25,$& (1&+$17('675($0'5&2152(7;0&&$57+<'(11,60,&+$(/75(9,&285781,71$3/(6)/0&&2//800,&+$(/35,'(-($1*5((50&&2//80/<)25',6/('51$3/(6)/0&&2120<-2+1:$55(1-$&48(/,1(/((0&&2120<&$<&71$3/(6)/0&&8//28*+-5:,//,$00,&+$(/ /(*(1'$5<:$<&(17(59,//(2+0&'21$/'&$52/<1$1175(9,&28571$3/(6)/0&'21$/'52'(5,&.+ 7$1,$ $1'5(:6$9(1$3/(6)/0&'211(//-5-2+1) 0$5<(75(9,&71$3/(6)/0&'211(//-5-2+1) 0$5<( 75(9,&28571$3/(6)/0&'2:(//-2+1-$0(6-8/,(52%,10&'2:(//)$5*2%/9'*(1(9$,/0&*((%5,$10 /25,-60,/(<'5&$1$/:,1&+(67(52+0&*/27+,1-5&+$5/(6:$//$&( '$,5'5(686$10&*/27+,1+,*+%2851('51$3/(6)/0&*21$*/(:,//,$0-%,6&$<1('5,9(1$3/(6)/0&*8,5(:,//,$03 686$1- 6($10,&+$(/&2857)$50,1*'$/(1<0&,/:$,1'28*/$65 6$//<$ :$5:,&.$9(1$3/(6)/0&.$<$1'5(:5266'(%5$$87(15,(7+0&.$<$1'526'51$3/(6)/0&/$8*+/,13$8/) 0$5<$11( /<)25',6/('51$3/(6)/0&0$+$1-5521$/''$9,'.$5$0&0$+$11',&.(5621&+$3(/5'/(%$121710&0$+21'21$/'/.$5(1)(5*86211(/6215'6$,17&+$5/(60,0&1($/<120,1((5($/7<75867 3<7+,$6&,5&/(1(('+$00$0&625/(<(':$5'%(48,$:$<1$3/(6)/32/LVWBB3/9.A.2.d Packet Pg. 307 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 0(',1$&58= 526($9(81,7:1$3/(6)/ 0(',1$ 6+20(&253 7+$9(6(1$3/(6)/ 0('/,)((17(535,6(,1& 7$0,$0,75$,/($671$3/(6)/ 0('/,)((17(535,6(,1& 7$0,$0,75$,/($671$3/(6)/ 0('9(7=67(9(16 $11,(0$5,(0('9(7= /8&$<$:$<1$3/(6)/ 0(,1&.(*$,/- &2167,787,21'51$3/(6)/ 0(,50$5*,73$8/$ -2+$11(6+,57675$66($$8=8&+6:,7=(5/$1' 0(,61(5%/$,5:,//,$0 52%(57%0(,61(5 -$0(6$0(,61(5 (/,=$%(7+676%5$03721/<3&$1$'$0(,61(552%(57%3(7(5'/$,5'$5067521*$9(*(25*(72:1/*;&$1$'$0(/,1'$%52:15(975867+,*+%2851('51$3/(6)/0(/9,1-2+1% &$52/<160$57,1,48('51$3/(6)/0(1(1'(=)5$1&,6&2$ $/,&,$ 0,1',$9(1$3/(6)/0(5&,(5)(55$5$&+(5</05$<021'')(55$5$-56$/70$56+/1326$66(70$0(51(552%(57 -($11(6$/0$1675((7:(6752;%85<0$0(52//$0,&+$(/- /25,-6&+22/675(+2%27+0$0(6$/8&,$123$1'5(:6$9(18(1$3/(6)/0(7(//86-2&(/<1(323/$5:$<1$3/(6)/0(752.$/$85$$'20,1,&$'51$3/(6)/0,&+$(/$0&*((/1'6&3$5&+7 32%2;1$3/(6)/0,&+(/621-(11,)(5$5,7$0,&+(/621%/$&.%(55<'51$3/(6)/0,&+125,&+$5' 526(0$5< &$625,$&28571$3/(6)/0,*8(/*$5&,$,19(670(17//& 7+676(1$3/(6)/0,.(6%$,7+286(//&'$1)25'671$3/(6)/0,/(63$8/$-%,6&$<1('51$3/(6)/0,/(96.,1,.2/&( 1$1&<&$625,$&71$3/(6)/0,//$51$1&<$11526($9(1$3/(6)/0,//(5%58&(5,&+$5''($1'$1,(//$9,*1(+$,7,'5,9(1$3/(6)/0,//(5'(:$<1(' /,6$06$,17$1'5(:6%/9'$371$3/(6)/0,//(5'8/&(0/(2125$6$1&+(=$9(//,12:$<1$3/(6)/0,//(5-())5(</((%/$&.%(55<'51$3/(6)/0,//(50$5*$5(7&$1'526'51$3/(6)/0,//(56&277: /,1'$/$1(*$'$'51$3/(6)/0,/1(52%(57) ',$11(05(9(//'50$127,&..0.&$1$'$0,085$1$1$(/%2:$9(1$3/(6)/0,1',//&:$',1*%,5'&,5&/(1$3/(6)/0,1',//&:$',1*&,5&/(1$3/(6)/0,1726$%$/%$<//&+,*+/$1''5,9(67(7$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'568,7(7$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'568,7(7$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'568,7(7$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'57$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'57$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'57$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'57$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'57$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'57$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'57$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'57$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'57$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'57$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'57$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'57$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'57$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'57$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'567(7$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'567(7$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'567(7$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'567(7$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'567(7$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'567(7$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'567(7$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'567(7$03$)/0,1726$%$/%$<//&+,*+/$1'0$125'567(7$03$)/32/LVWBB3/9.A.2.d Packet Pg. 308 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 0,1726$%$/%$<//& +,*+/$1'0$125'57$03$)/ 0,1726$%$/%$<//& $$71/,//,$0&267(//293 :6$03/(5'67(&2&2187&5((.)/ 0,1726$%$/%$<//& $771/,//,$0&267(//293 :6$03/(5'67(&2&2187&5((.)/ 0,1726$%$/%$<//& $771/,//,$0&267(//293 :6$03/(5'67(&2&2187&5((.)/ 0,1726$%$/%$<//& $771/,//,$0&267(//293 :6$03/(5'67(&2&2187&5((.)/ 0,1726$%$/%$<//& $771/,//,$0&267(//293 :6$03/(5'67(&2&2187&5((.)/ 0,1726$%$/%$<//& $771/,//,$0&267(//293 :6$03/(5'67(&2&2187&5((.)/ 0,1726$%$/%$<//& $771/,//,$0&267(//293 :6$03/(5'67(&2&2187&5((.)/ 0,1726$%$/%$<//& $771/,//,$0&267(//293 :6$03/(5'67(&2&2187&5((.)/ 0,1726$%$/%$<//& $771/,//,$0&267(//293 :6$03/(5'67(&2&21287&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/32/LVWBB3/9.A.2.d Packet Pg. 309 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 0,1726$%$/%$<//& $771/,//,$0&267(//293 :6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/32/LVWBB3/9.A.2.d Packet Pg. 310 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 0,1726$%$/%$<//& $771/,//,$0&267(//293 :6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/32/LVWBB3/9.A.2.d Packet Pg. 311 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 0,1726$%$/%$<//& $771/,//,$0&267(//293 :6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/32/LVWBB3/9.A.2.d Packet Pg. 312 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 0,1726$%$/%$<//& $771/,//,$0&267(//293 :6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&&187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&&187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&2187&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293:6$03/(5'67(&2&218<7&5((.)/0,1726$%$/%$<//&$771/,//,$0&267(//293::$03/(5'67(&2&2187&5((.)/0,7&+(//$1'5(:/ 52;$11( '((5),(/'/1=,2169,//(,132/LVWBB3/9.A.2.d Packet Pg. 313 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 0,7&+(//-2+13$8/ 3$75,&,$68//,9$10,7&+(// 6(0,1$5<)$505'/87+(59,//(0'02&&,$5($/7<7586732,176+25(29(5%2.'5$0(6%85<0$02+167,027+< 5$&+(//($ +$,7,'51$3/(6)/02+55$<''20,1,&$'5,9(1$3/(6)/02,6(6$,17/28,67+20$6621/11$3/(6)/02/$-2+1'20,1,&$'51$3/(6)/02/,1$-26(26$1&+(=526($9(1$3/(6)/02/,7253(7(5& /,1'$/'20,1,&$'5,9(81,71$3/(6)/021$&+26/(210,&+$(/3$8/$0021$&+26+,*+%2851('51$3/(6)/021)5(*$5< &$52/:1($670281''5%:$8.(6+$:,0217*20(5<%,//<*7,027+<:&/,&.&$625,$&28571$3/(6)/0217,&(//2$17+21<-&+85&+671(:%5816:,&.1-0225(&+5,6723+(53.,0%(5/<30225(/,7&+),(/'/$1(+$16210$025$/(65,&+$5'0$5,(77$%$/':,1025$/(6$9(/,12:$<1$3/(6)/025$/(6<$',5$0,1',$9(1$3/(6)/025($83$75,&,$:22'6,'($9(1$3/(6)/025(+($'$57+85::22'6,'($9(1$3/(6)/025,1%2%(77(-($175(9,&71$3/(6)/0255,621/,9,1*7586775(9,&28571$3/(6)/028/721-26+8$/ $0$1'$ 1:5'&7$1.(1<,$02:/(652'1(< '$5/(1(.,1/2&+/16$/(09$08//$9(<6$5$+ 0,&+$(/+,*+/$1'67'8167$%/(0$08//(5+$55<-2+$11(6(5167 '$9(6:%2/6(11$3/(6)/08//,167,027+<:&$7$/,1$'51$3/(6)/08/52(-$0(6 &<17+,$%522.6,'('5*26+(11<08/52<.,0%(5/<526(/8&$<$:$<1$3/(6)/0853+<'211$-'20,1,&$'51$3/(6)/0853+<0$5.3 ,''$3&/,))&5(67&7%85/,1*721/5=&$1$'$0855$<-5:,//,$0+/<1'$60855$<$17,*8$:$<1$3/(6)/0855$<-26(3+0&,1',)$/)$123(0%52.(:$<1$3/(6)/0855$<0$5. .,0-$1'526'51$3/(6)/0855(//$//,621&$625,$&28571$3/(6)/0857$*+.(9,1-/(6/(<$11/(1121/(1$3(5'3($5/5,9(51<086.$0$57+$-$1($1'526'51$3/(6)/0867$5'25,&+$5'3 .$5(1 9,1(<$5':$<%$51(*$71-0<(56(1'2$66(70*07//& :(671257+(51/,*+76%/9' $1&+25$*($.0<(56&251(/,$$67$5/,*+75$1&+75+$6/(77;0<(56(//,277/ )$<'20,1,&$'5,9(1$3/(6)/0<(56:,//,$0 &$7+(5,1($1'526'51$3/(6)/0<586.,%(77<-$1(3,1(75(('51$3/(6)/1$1'73(75(',65(975867-(:(//$9(3$&,),&*529(&$1$'/(5-())5(<052:(6:+$5)81,7%267210$1$1&<-$1*/(:,&=,55(975867 :1:+,77$.(552$'2&21202:2&:,1$1&<-+$$&./,//(1%(5*75867 /$'8(*529(/$1(67/28,6021$1&<-+2))0$15(9758671/$.(6+25('5%&+,&$*2,/1$1&</*/2*296.<1210$5,7$/75867/<)25',6/('51$3/(6)/1$3/(6)$0,/<75867/8&$<$)$0,/<75867.(11('<675((7:(67$8525$/*/&$1$'$1$3/(6%27$1,&$/*$5'(1,1& %$<6+25('567('1$3/(6)/1$3/(6&29(1$17*5283//& 3$6(29(5'(3$5.:$<68,7(+(1'(5621191$3/(6&867$5'//&32%2;0$',621:,1$3/(6)5((1(7,1&7$0,$0,75/(1$3/(6)/1$3/(66287+5($/7<$662&//&$0(5,&$1&205&5($/7<&253 $9(18(2)7+(&+$03,216 67(3$/0%($&+*$5'()/1$32/,-26(3+' '25((1$ :(<0287+675((781,7*52&./$1'0$1$5$1-26,/9,2 0$5*+(5,7$ 5<$167:+,7(6721(1<1$621-2+15 1$1&<072572/$&28571$3/(6)/1$66,)*2/)9(1785(6//&%$1<$1%/9'67(1$3/(6)/1$7+$1.</(5'20,1,&$'5,9(81,71$3/(6)/1$9$552+8*2$'20,1,&$'5,9(1$3/(6)/1$<(5678$57 &<17+,$/<11( %(48,$:$<1$3/(6)/1($/&+$5/(6.323/$5:$<1$3/(6)/1($57+(/$.(/$1'758670<(56(1'2$66(70*07//& %5<1:22'/1)2570<(56)/1('%$/6.,3$0(/$6:22'6,'($9(1$3/(6)/1(/6215($/7<75867&$1121)25*('5)2;%2528*+0$32/LVWBB3/9.A.2.d Packet Pg. 314 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 1(0(7+3$75,&,$ -$0(6 75(9,&28571$3/(6)/ 1(9(1+29(10(5/(-2+1 &+(5</.$<1(9(1+29(1 &$<&28571$3/(6)/ 1,&+2/67(55< %211,( '28*/$67(5',;21,/ 1,&.(56213$8/$ 75(9,&28571$3/(6)/ 1,&2/(70$5*27 0$57,1,48('51$3/(6)/ 12%/(%5$'$ 6+$:1'$5 <$1.(((67$7(6'5/,%(57<7:32+ 12(3- 67$5*5$66/11$3/(6)/ 12(3$76<- 67$5*5$66/11$3/(6)/ 125'6752067(9(15 0$5,$$125'67520 :7(55$&(29(5/$1'3$5..6 125,5,12 -8/,$1$,/21$ 3(0%52.('567$0)25'&7 1257+&2$675($/7<+/'1*//& '$,6< 6:22'/$1(*$7(0,//62+ 1257+:$<'$9,'. %$5%$5$. &,0,1,&$'51$3/(6)/ 129271<657+20$63(7(5 $110$5<129271< 6:6815,'*('5:$8.(6+$:, 12:$.$57+855,&+$5' (/%2:$9(1$3/(6)/ 181(=5(0,*,2 526($9(1$3/(6)/ 1<$(0()$0,/<'(&2)75867 32%2;%$7$9,$,/ 2 72/(-1,./,9,1*75867 /$.(*(1(9$'5,9(5(1219 2 +$5$67(3+(1 0$5<0 /,*+7%2851:$<1$3/(6)/ 2$./(<7+20$6' 686$1: %$<6+25('51$3/(6)/ 2$6,62)1$3/(6,1& &+5,67,1($'$06 '$1)25'671$3/(6)/ 2$6,62)1$3/(6,1& &+5,67,1($'$06 '$1)25'671$3/(6)/ 2%(567.(11(7+& 0$5-25,(- $1(*$'$'51$3/(6)/ 2%5,(1&/(21$5' /,6(+ $1'526'51$3/(6)/ 2 %5,(10$57,1& 6$'21,( 0$1,72$9(2$./$1'1- 2%5,(17+20$6- '25((1 0$57,1$9(18(%(//025(1< 2 &21125.(11(7+ /,1'$* 526('$/('5*/(1%851,(.+6&$1$'$ 2&2112568=$11(2 1257+5,'*(5',36:,&+0$ 2&2112568=$11(2 :$/7(5- 15,'*(5',36:,&+0$ 2'(77(3$75,&,$$ 721,2'(77('(58%(,6 95((/$1'5':22'+$9(10, 2'2+(57<'(11,6- -$&48(/,1(02'2+(57< -8/,(6:$<25/$1'3$5.,/ 2*/(6%<.(,7+$1'5(: &+5,67,1(0$5,(2*/(6%< 3,1(%522.'51257+9,//(0, 2+($51$11( 9$/3$5$,62$9(0(1/23$5.&$ 2/'0$10$5<6 67$1'5(:6%/9'$1$3/(6)/ 2/,9,(5/8'*((00$18(/ 7$0/$$(5,62/,9,(5 +$,7,'5,9(1$3/(6)/ 2/8)810,/$<2$'(1,.( :,//,$06215(92&$%/(75867 +817(569,(:52$'(//,&277&,7<0'21(,//65:,//,$0/7+(5(6($11(/(9$1),5(7+2513/$&(/(;,1*721.<237,0865($/(67$7(//&6+817(5/1/$.()25(67,/25$1*(,'$/,1(/28,625$1',(825$1*(,'$/$/28,6,1(25$1*($1'5(:6$9(1$3/(6)/25&+$5'/$1(75867686$1$%(//757,.$3523(57,(6//&&2//,(5%/9'81,71$3/(6)/255'21$/'5$<021'$1'5(:6$9(1$3/(6)/27(520$5,$0677(56:1$3/(6)/2:(167,027+<- /$85((10 72572/$&71$3/(6)/30 -*3$5,6,5(975867'20,1,&$'51$3/(6)/32 0-0$+(5/,9,1*75867 $1'526'51$3/(6)/3: '(0&&/86.(</,975867 &21&25'9$//(<&285767/28,6023$*(*$5</((1250$1'<'51$3/(6)/3$/$==21(*$5<$.,0686$13$/$==21($1(*$'$'51$3/(6)/3$/28%,6$17+28/$/<)25',6/('51$3/(6)/3$1,5$+($/7+&$5(6(59,&(,1& (7$0,$0,75,$,/1$3/(6)/3$1,5$+($/7+&$5(6(59,&(6,1& (7$0,$0,75$,/1$3/(6)/3$1,5$+($/7+&$5(6(59,&(6,1&(7$0,$0,75$,/1$3/(6)/3$11(//)$0,/<75867'20,1,&$'51$3/(6)/3$172-$0$18(/ (8/$/,$526($9($1$3/(6)/3$1=(5$512/'' -($1(77( &$<&71$3/(6)/3$3$1,(5*(25*(7 -8/,($ $1'526'51$3/(6)/3$51(//%5,$13 1$',1(('$/<%/9'2&($16,'(1<3$52:6.,67(3+(1 6835,<$ :$5:,&.$9(1$3/(6)/3$562160$5<*/$85$3$56216$1'526'51$3/(6)/3$7(5621)/25,'$75867<21*(675((77+81'(5%$<3(7&$1$'$3$7(5621(5,&0:22'6,'($9(1$3/(6)/3$75,&,$$',))(1'(5)(575867 $1'526'51$3/(6)/3$75,&,$0,//6-$1(:$</97567 75(9,&28571$3/(6)/3$75,&.$%85.(5(975867526(0$5,(%85.(5(975867 :$5:,&.$9(1$3/(6)/32/LVWBB3/9.A.2.d Packet Pg. 315 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 3%$1$3//& %$5025$/'5,9(3,77672:11- 3($5621*5(*25<( /25$/((5 +$:.+2//2:'5%$57/(77,/ 3(&25$52%,$*2 )5$1&(6&$ &/,))5'+,*+/$1'3$5.,/ 3((7(565,&+$5'. &$7+(5,1(:3((7(56 67$1'5(:%/9'1$3/(6)/ 3(1$&$5,'$' 3(1$0$5,$( 7+20$6621/11$3/(6)/ 3(1&275867&203$1< '$1,(/526(/,(3,5$ '$9,6%/9'67(1$3/(6)/ 3(11,)2/'$1'5(:. (//(107$</253(11,)2/' 3(0%52.(:$<1$3/(6)/ 3(11,1*721:,//,$07 -2$1103(11,1*721 &+(9(51<'50(4821:, 3(17=&$52// $1'5(:6$9(1$3/(6)/ 3(5(,52('8$5'2 /8,6$3(5(,52 (/,=$%(7+35266 32%2; 1$3/(6)/3(5(='$9,'-$1(),7=3$75,&.%(5.,1'$/('5+$0,/721/(9&$1$'$3(5(=26&$53(1$,/,$1$526($9(1$3/(6)/3(5(=6$17$1$-8$150$5,$//(21%(1&202$1'5(:6$9(1$3/(6)/3(5,//20,&+(/($6+/(<&2<1(.(/6(<&2<1(0$5,$1$/$1(2&($1&,7<1-3(5.,1675$9,65$<+($7+(5'$:13(5.,16+,*+%2851('51$3/(6)/3(5/$6$/9$725( .(//(<2/'(7$9(515'/(20,167(50$3(55<6&277 1$7$/,($1*863$7+&,&(521<3(55<6&277 1$7$/,($1*863$7+&,&(521<3(56621%(1*7*(/,=$%(7+05285.(%(5$5', :(6767675((78%267210$3(7(5$'(0$5&2)$0,/<75867 6($%251'5:,//2:,&.2+3(7(56-2+1-&8/025(52$'3$/0(5672:1'8%/,1,5(/$1'3(7521($17+21< $11(77( ($679,(:&76$*+$5%251<3(77,79,&725,$/<10,1',$9(1$3/(6)/3)(,)(53(7(5+(,',3)(,)(55(('6'$/(5'0,/7210$3)(,)(53(7(5+(,',3)(,)(5($67/$:1$9(0$',621+(,*+760,3+$17+$1,921*6286$'$7+21*3+$17+$1,921*:22'6,'($9(1$3/(6)/3+$5,6,(1-2+1621+2//<$9(18(1$3/(6)/3+(/36:,//,$07 .,0%(5/<* $1'526'51$3/(6)/3+,/,3/0(<(575867'20,1,&$'51$3/(6)/3+<//,6-&2'27586767$1'5(:6%/9'1$3/(6)/3,(5&('(%5$672'')5$1./,13,(5&(3,1(75(('51$3/(6)/3,(5&((/,=$%(7+$/$85$$/7$5$7='29(53/$371$3/(6)/3,*$7/,6$-,00<08&&,//,12(/$9(72521720*%&$1$'$3,.(6+(//<)0,1',$9(1$3/(6)/3,//,1*67(3+(1&21/,1652$'6&$5%2528*+0&&&$1$'$3,12.(9,1 3$0/$75(9,&28571$3/(6)/3,7(5$:$/7(5)6$,17$1'5(:6%/9'1$3/(6)/3,==87,)$0,/<7586763,'(5/,/</$1(1$3/(6)/3,==87,)$0,/<7586763,'(5/,/</$1(1$3/(6)/3,==87,)$0,/<7586763,'(5/,/</$1(1$3/(6)/3,==87,)$0,/<7586763,'(5/,/</$1(1$3/(6)/3,==87,)$0,/<7586763,'(5/,/</$1(1$3/(6)/313523(57<+2/',1*6,1&9,67$0217$1$6$1-26(&$32,'20$1,.$5(1 .(9,1+23(:(//'56721<%522.1<32//$675,1,(7$/521$/'-+2:$5'$9(($67'81'((,/32//$675,1,&+5,6723+(5*/$85,($32//$675,1,$9(//,12:$<1$3/(6)/32//,(':$5'$ (/,=$%(7+$ :$5:,&.$9(1$3/(6)/320326,1,/$55< 0$5-,1+,*+/$1'$9(3,776%85*+3$3216/(5686$1.$+/67(3+(1'28*/$63216/(575(9,&71$3/(6)/326,0$72'(%25$+$6721(:$//&7<25.72:1+(,*+761<3277(5&/,172175(9,&71$3/(6)/32:(//.$7+/((1$/,*+7%2851:$<1$3/(6)/32=25(92&$%/(75867/$.(:22'%/9'1$3/(6)/32=25(92&$%/(75867/$.(:22'%/9'1$3/(6)/35(6&277-2167(3+(1125((135(6&277:(<%5,'*('5:(67/$.(2+35,&()5('0,1',$9(1$3/(6)/35,&()5('(0,1',$9(1$3/(6)/352&+$=.$.9(786(-72572/$&71$3/(6)/352(1=$5$8/$0$<'$/%$7,67$323/$5:$<1$3/(6)/3523+(7(2/$7(&+,/(1(3523+(7(5(0<$1'5(:6$9(1$3/(6)/358+$002&.&29(//&*,5$/'$)$5060$',6211-358,77/$55</(( &/$5(3&2167,787,21'51$3/(6)/38,'$.)$0,/<7586760$,1675((7*$/(1$,/32/LVWBB3/9.A.2.d Packet Pg. 316 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 386&$6'$1,(/ 0,1',$9(1$3/(6)/ 48,&.-())5(<5 -2$1) 72572/$&71$3/(6)/ 48,11,,,-26(3+' (,/((1* $//(152$'6$/732,171< 48,17$1,//$65$%(/$5'2 32%2;+$5/,1*(17; 48,52=$1$ 7+0$6621/11$3/(6)/ 5& 50*5,(66(55(975867 &/$5(1'21'51$3/(6)/ 5' 6/67(*(1*$/,975867 '20,1,&$'51$3/(6)/ 50,&+$(/.1$335(975867 (3$75,&(.1$335(975867 .0.,1/(<$9('(602,1(6,$5$))(57<67(3+(1 -8/,(58,7)$505':<&.2))1-5$+$/(7$/%5<$1&7+'59(52%($&+)/5$+$/(7$/52%(57)7+3/9(52%($&+)/5$,1%2/75(9758670$5&21,&71$3/(6)/5$-'$0,526/$: 0$/*25=$7$ 385&(// 6&29(5'+$/,)$;%3(&$1$'$5$/.(10$5.3523(57,(6//& 7+$9(61$3/(6)/5$0,5(=&$5/2696$$9('5$ +2//<$9(18(1$3/(6)/5$0,5(=&$5/2696$$9('5$ 67(//$$%(1,7(=+2//<$9(1$3/(6)/5$0,5(=9,1&(17(6$17,$*2 7+$9(1(1$3/(6)/5$06(<$//$1-$1'5($0&$6(<72572/$&71$3/(6)/5$7+7+20$65$<021'(/$,1(6&+8/7=5$7+'20,1,&$'51$3/(6)/5$7,6%21$5($/(67$7(//&%$85 ./(,13$%5,&.(//%$<'50,$0,)/5$76+,1-$0(63 68=$11(6287+2&($1$9(6($6,'(3$5.1-5$<52%(57% /,1'$&8%$5'0$1&+(67(50(5$==$12-26(3+7686$10$1'(5621$1'526'51$3/(6)/5($/3523(57<,19(670(1762/87,216//&6:7+/10,$0,)/5(%$1768=(77( &+5,675(9,&71$3/(6)/5(%(//2,9$1-&,1'<67$)),(5,5(%(//2)/,1752$'1257+<25.0--&$1$'$5(&&+,$.(9,1975(9,&28571$3/(6)/5(('-5-$0(6( $11('0$5.- '(%25$+$'811(325760287+'5&$50(/,15((6(5,&+$5'$1'(56213200(/3/$&(:(67'(602,1(6,$5()(5(1&(21/<%,6&$<1($3$570(176$&21'20,1,805()(5(1&(21/<&2$&++20(6,,$775(9,62%$< $3+$6(&21'20,1,805()(5(1&(21/<&<35(66*$7($&21'20,1,805()(5(1&(21/<'20,1,&$,6/($&21'20,1,805()(5(1&(21/<7(55$&(,;$775(9,62%$<$3+$6(&21'20,1,805()(5(1&(21/<7(55$&(9,,$775(9,62%$<$3+$6(&21'20,1,805()(5(1&(21/<7(55$&(9,,,$775(9,62%$<$3+$6(&21'20,1,805()(5(1&(21/<9(5$1'$,9$775(9,62%$<$3+$6(&21'20,1,805()(5(1&(21/<9,//$*()$//6$71$3/(67+( $&21'20,1,805()(5(1&(21/<5(+(55$1'$///((%$5%$5$5(33(57'25$/'5752<0,5(,''21$/'(8*(1((//(11221$15(,'(/($125/((/$1((5(+2%27+'(5(,1%(5*60$5&,//(3,1(75(('51$3/(6)/5(,1%2/')5$1.- &$7+,$)2;+2//2::$<$1'29(51-5(,1(56%5<$1+ -2$1&203$57,6/('51$3/(6)/5(..$6&$7+(5,1(0,//(5)$506'50,//(53/$&(1<5(/<($&+5,67,1('$/(0(<752775226(9(/7%/9')/25+$03$5.1-5(1.(/)5$1.3$575,'*(&28570$5&2,6/$1')/5(1.(/)5$1.-$60,1.$+$-'$5(9,&3$75,'*(&70$5&2,6/$1')/5(6&+1,&+2/$6&2/21,$/'51$3/(6)/5(6&+5$1'2/3+0$77+(:$8'5(<)6$1'(560$57,1,48('51$3/(6)/ 5(<12/'6(/,$6%85./( 0$85((126%251(5(<12/'6+$,7,'51$3/(6)/ 5,&&,87,0,&+$(/ /,1'$ :,1'<2$.'53,776%85*+3$ 5,&+%$5%$5$ 6$,17$1'5(:6%/9'1$3/(6)/ 5,&+$5'$3$6&$5(//,75867 :$5:,&.$9(1$3/(6)/ 5,&+$5'+(5=2*5(9/,975867 /2,6)+(5=2*5(9/,975867 25&+$5'0($'2:5'($67:,//,67211<5,&+$5'-6&2=$5(9758679,5*,1,$56&2=$5(9758672$./$:1'5&200$&.1<5,&+$5'3(9$165(9758670$5,(((9$165(975867/<)25',6/('51$3/(6)/5,&+$5'667(3+(1-/$85$.$<5,&+$5'6&$03%(//&2857*(1(9$,/5,&+$5'62152%(57.,0%(5/(<020$//(<*,/(65'&$/('21/.%&$1$'$5,7&+,(-5-$0(6&$5/&+(5</',$1(5,7&+,(/<)25',6/('51$3/(6)/5,78&&,521$/' 9$/(5,(%0$57,1,48('51$3/(6)/5,9(5$('*$5'29$5*$6/$1'<9$=48(=)$//6%/9':(6721)/5,9(5$0<51$%,6&$<1('51$3/(6)/32/LVWBB3/9.A.2.d Packet Pg. 317 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 5,==2686$1 3+,/,36&+$8(5 &$625,$&28571$3/(6)/ 52%(57&$5%8&./(/,975867 9,&725,$$$5%8&./(/,975867 6(8&/,'$9((/0+8567,/52%(57&&$00$5$12/,975867 686$1&$00$5$12/,975867 +817(565,'*('53(11,1*7211-52%(57&&$00$5$12/,975867 686$1&$00$5$12/,975867 +817(565,'*('5,9(3(11,1*7211-52%(57&&$00$5$12/,975867 686$1&$00$5$12/,975867 +817(565,'*('5,9(3(11,1*7211-52%(57&&$00$512/,975867 686$1&$00$5$12/,975,67 '2775,1$/28,6 0,&+(/(+817(565,'*('5,9(3(11,1*7211-52%(57-*$/$&7586775(9,&71$3/(6)/52%(5761$*(5/,9,1*75867 '20,1,&$'51$3/(6)/52%(576&+,&./,1* (/,=$%(7+ 6&+,&./,1*/,9,1*758677(55$==2/11$3/(6)/52%(576&+,&./,1* (/,=$%(7+ 6&+,&./,1*/,9,1*758677(55$==2/11$3/(6)/52%(576&+,&./,1* (/,=$%(7+ 6&+,&./,1*/,9,1*758677(55$==2/11$3/(6)/52%(576&+,&./,1* (/,=$%(7+ 6&+,&./,1*/,9,1*758677(55$==2/11$3/(6)/52%(576&+,&./,1* (/,=$%(7+ 6&+,&./,1*/,9,1*758677(55$==2/11$3/(6)/52%,1(60,7++,6/(575867*/(1&8//(1&2857'8%/,12+52'1<'$5(865(92&$%/(75867 02+$:.3/$&(1$3/(6)/52'5,*8(6-2+10$5,$752'5,*8(=&/,))'51$55$*$16(775,52'5,*8(=('8$5'2$//$',1/11$3/(6)/52'5,*8(=('8$5'2 0$5,$/ 323/$5:$<1$3/(6)/52'5,*8(=526$5%,6&$<1('51$3/(6)/52(6&+/,6$0$9(//,12:$<1$3/(6)/52*1(&25< 0(/,66$6$08(/'56)$5*21'52+5,1*-())5(<$ -$1(7/ ,'(52$':,/6211<521$/'-/,1'(15(9758676+,5$6/,1'(15(9758673(0%52.(:$<1$3/(6)/521',1,52%(57)0$5*$5(7$11521',1,75(9,&28571$3/(6)/522.-552%(57: -($1/:$5:,&.$9(1$3/(6)/526$'$5(//&1)$,59,(:671$=$5(7+3$526($9(18(//&/$.(9,(:'51$3/(6)/526(/28,6$&/$<3,77652$'($671257+32571<526(0$5<$0(1'2/$5(975867 75(9,&28571$3/(6)/526(1%(5*0$5&- +$5/(1(= %(48,$:$<1$3/(6)/52666$//<$&2/21,$/'51$3/(6)/527+0$13(7(5+ $0<3-$60,1(&70$/9(513$528/,6:,//,$07 0$5,1$'85+$05'1(:+<'(3$5.1<52:$1$1'5(:0&2//((1'211(//<52:$167$555'6,1.,1*635,1*3$52:/$1'6&2775$1'$//-8/,(7+20$672:/$1'1'3/$&(78/6$2.52;%528*+&$52/-$0(6&2//,(5*$,/(0217&7:22'%5,'*(9$58%,15$1'$/5 75$&(</3(%%/(9,(:'5$11$5%250,58%,1678$575$<:$/187581&7+$55,6%85*3$58%,2*867$929(*$67(3+$1,(9(*$526($9(1$3/(6)/58%<,,,3$8/+$57&+5,67,1$(/,=$%(7++$'/(< (/%2:$9(1$3/(6)/58))1(5*(25*() 0$5-21 /<)25',6/('51$3/(6)/58**,(5,3(7(5-:+,63(5&7:(67:$5:,&.5,5866(/52%(57-2+11$1&<$115866(/:(66.80:22'5'5,9(56,'(&75866(//-$<621 6800(5&2/21,$/'51$3/(6)/5866(//-26(3+(':$5'1$1&</255$,1(5866(//75(9,&71$3/(6)/586620,&+$(/- &+5,67,1(63(0%52.(:$<1$3/(6)/5<$1*$5<' ',$1(&48$57=:$<6<5$&86(1<5<$11($&8512:$1'5(:6$9(1$3/(6)/6' 7$+$506(1/,9,1*75867:1'8.(675((70(12021(()$//6:,6$'2:6:.,-$0(66',$1(06$'2:6.,/$.(9,(:7(55$&(02179,//(1-6$*$025(1$3/(6//&32%2;1(:<25.1<6$*0$10,&+$(/(//,63$75,&,$/28*+5$16$*0$1 %(48,$:$<1$3/(6)/6$,17/28,6-26(3+ 0$1<$ %$<6+25('51$3/(6)/6$/$=$5/,%25,2+2//<$9(1$3/(6)/6$/$=$5/,%25,2 0$*'$/(1$ +2//<$9(1$3/(6)/6$/(51252%(57+$5/((170$&5,1$($67:+,7(&/,)):$<)$50,1*'$/(1-6$/9$725(-72&&275867 (/'5('52$'520(20,6$/9,2-5-2+10$5,$)6$/9,2)255(67$/$9(18(67$7(1,6/$1'1<6$06(/,50$3(0%52.(:$<1$3/(6)/6$1&+(=$/(%,+2//<$9(1$3/(6)/6$1&+(=&(&,/,$3(5(=7+20$6621'51$3/(6)/6$1&+(=-26(/2<2/$0,5,$0/2<2/$67257(5$9(1$3/(6)/6$1&+(=-26(/8,6/2<2/$67257(5$9(1$3/(6)/32/LVWBB3/9.A.2.d Packet Pg. 318 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 6$1&+(=-8$1&$5/26 0$</(( &$<6'51$3/(6)/ 6$1&+(=-8$1&$5/26 0$</(( &$<6'51$3/(6)/ 6$1'21$7252%(570 /,6$$116$1'21$72 0,//(5'5,9(:(;)25'3$ 6$1)25'0,&+$(/. '$1)25'671$3/(6)/ 6$17265$)$(/& 7+20$6621'51$3/(6)/ 6$5$%$6$-5$/%(572 .$7+<6$5$%$6$ 0,//6(67$7(3/&+8/827$)/ 6$81'(56+8%(57- %(77</ 7$0,$0,75/(1$3/(6)/ 6$81'(56+8%(57- %(77</ 7$0,$0,75/(1$3/(6)/ 6$9$5(6(-2+1 0$5*$5(7 75(9,&71$3/(6)/ 6$92&$$//(1- 1,1$0 +,*+%2851('51$3/(6)/ 6&$1&$5(//$0,&+$(/- 3(0%52.(:$<1$3/(6)/ 6&$11(//67(3+(1-26 686$10$5,(6&$11(// :,1'+$03$5.:$<35263(&7.< 6&$53$7,0$5,/<1 -26(3+ 635,1*),(/'$9(%(5.(/(<+(,*+761- 6&+$//52%(576+(3+(1 3$0(/$6&+$// $1(*$'$'51$3/(6)/ 6&+(336.$7+/((1 75(9,&71$3/(6)/ 6&+/(6,1*(5686$1/ .$7+5<16&+/(6,1*(5+$+1 $1'526'51$3/(6)/ 6&+0(&+(/-())5(<- 3$8/$0 '20,1,&$'51$3/(6)/ 6&+1(,'(5,,,6$08(/- 0(5,'(($11()(55,1 $1(*$'$'51$3/(6)/ 6&+22/',675,&7$9( $9$/21(/(0(17$5< 683(5,17(1'(17 26&(2/$75/ 1$3/(6)/ 6&+22/',675,&7-- 683(5,17(1'(17 26&(2/$75/ 1$3/(6)/6&+8/'7.$5(19,&725,$+(1./(02*8/:$<,1',$1$32/,6,16&+:$57=-2$11%(48,$:$<1$3/(6)/6&,5(&+$5/(63 0$5&</3,1(:22'6&,51$3/(6)/6&,5(&+$5/(63 0$5&</3,1(:22'6&,51$3/(6)/6&25=,1,)5('(5,&.$1$9$52163$57$&27($.:22''51$3/(6)/6&8//<0$57,1- /,1'$(75(9,&28571$3/(6)/6&8/7+253(-$0(6$6$5$+'6&8/7+253(:,//2:%($&+5'3527+23(/$9&$1$'$6',&2//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/6',&3//&352)(66,21$/&,567(1$3/(6)/32/LVWBB3/9.A.2.d Packet Pg. 319 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,567(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//&352)(66,21$/&,5&/(68,7(1$3/(6)/6',&3//&352)(66,21$/&,5&/(68,7(1$3/(6)/6',&3//&352)(66,21$/&,5&/(68,7(1$3/(6)/6',&3//&352)(66,21$/&,5&/(68,7(1$3/(6)/6',&3//&352)(66,21$/&,5&/(68,7(1$3/(6)/6',&3//&352)(66,21$/&,5&/(68,7(1$3/(6)/6',&3//&352)(66,21$/&,5&/(68,7(1$3/(6)/6',&3//&352)(66,21$/&,5&/(68,7(1$3/(6)/6',&3//&352)(66,21$/&,5&/(68,7(1$3/(6)/6',&3//&352)(66,21$/&,5&/(68,7(1$3/(6)/6',&3//&352)(66,21$/&,5&/(68,7(1$3/(6)/6',&3//&352)(66,21$/&,5&/(68,7(1$3/(6)/6',&3//&352)(66,21$/&,5&/(68,7(1$3/(6)/32/LVWBB3/9.A.2.d Packet Pg. 320 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6',&3//& 352)(66,21$/&,5&/( 68,7(1$3/(6)/ 6($ /$1'75867 :$5:,&.$9(1$3/(6)/ 6($03/(60$5&(/* /$*29,//$**,2:$<1$3/(6)/ 6(%(6&+5,6723+(5$/$1 0(/,66$68($1'5,&.+8*+(6 &/$5(1'21'51$3/(6)/6(&2)+286,1* 85%$1'(9 ,1)26<6 17:.&2536+(3+(5'0$//2)),&(&203/(; 1:5'6768,7('2./$+20$&,7<2.6(&5(7$5<2)9(7(5$16$))$,56 2)),&(52)7+(81,7('67$7(6 /2$1:$55$17<6(59,&(:(67(1'$9(67(:1$6+9,//(716((1(<-26(3+0$17,*8$:$<1$3/(6)/6((6()$0,/<5($/(67$7(7586735(6&277/$1(67521*69,//(2+6(0%52:,&+:$/7(5/28,60$5<(/,=$%(7+6(0%52:,&+ +$,7,'51$3/(6)/6(1729,&+.</($323/$5:$<1$3/(6)/6(1729,&+0,7&+(//7 )$<(/ '2*:22':$<1$3/(6)/6(;721&$52/ -$0(65+,''(12$.5'6:52$12.(9$6+$',2)1$3/(6,1&9$/(:22''5,9(1$3/(6)/6+$+((10,&+$(/- 52%<1/ (',1%85*+:$<67&/$,569,//(2+6+$3,52750$5&/&$37$,16&29(75867'20,1,21'51$3/(6)/6+$5(('(1+(5'(575867&/$5(1'21'51$3/(6)/6+$5,/-$&2%62175867&52)721$9(62/212+6+$521$116,065(9758673(0%52.(:$<1$3/(6)/6+((+$1'(11,6 0$5<-$1( 0,//5,9(55'&+$33$48$1<32/LVWBB3/9.A.2.d Packet Pg. 321 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 6+((.6,,,3$8/3 '29(55'6,/9(5/$.(2+ 6+(33$5'.857$/ 7+(5(6$/<116+(33$5' (/%2:$9(18(1$3/(6)/ 6+,%(/)5('(5,&. ($67/$.(5'6.$1($7(/(61< 6+,5/(<$0,7&+(//5(975867 021$5&+&,51$3/(6)/ 6,%,/$0,.2/$- +,*+%2851('51$3/(6)/ 6,&,//$12)$0,/<,559/975867 75(9,&71$3/(6)/ 6,.256.,)5$1&,6 %$5%$5$&$+,//525,&. (/%2:$9(18(1$3/(6)/ 6,//,1$1'5(:% ,/(1(6*/,&.0$1 '20,1,&$'51$3/(6)/ 6,0.,16=$&.$5<6&277 /$85(1(/,6(6,0.,16 6:670,$0,)/ 6,00(1:,//,$06&277 75(9,&28571$3/(6)/ 6,02))0$5.:,//,$0 .</(0$5*8(5,7(6,02)) '20,1,&$'51$3/(6)/ 6,1&/$,5-$0(6: 3$75,&,$0 %5,'/(5,'*(52$'($*$101 6,52,652/$1') 0$85((1$ $1'526'51$3/(6)/ 6.(/721,6$$&1(:721 (/(1$&6.(/721 /<)25',6/('51$3/(6)/ 6/$12/$85$ 9,.,1*'5:(67,6/,31< 6/876.(567(3+(15 0$5/,(6( '20,1,&$'51$3/(6)/ 6/87=.<3$8/( $0<- 32%2;+817(51< 60$$*$$5'%5$'/(< -2$11 -())(5621$9(1$3/(6)/ 60,7+0,//$5'(59,1 $11 $17,*8$:$<1$3/(6)/ 60,7+6$1)25'- *$,/' 3(0%52.(:$<1$3/(6)/ 60,7+9(5$0 &2/21,$/'51$3/(6)/ 608*25=(:6.,(67)5$1&(60 -8$1,7$%2:(562; (*5$1'67+$67,1*61( 61+/7$3523(57,(675867 3523(57<7$;&2816(/256 32%2;0&.,11(<7; 61<'(5+2/',1*6//& %$<)52173/$&(1$3/(6)/ 62$9(/(2 0$5,$ &+(67187&,5/,921,$0, 62%('$9,'6 &<17+,$/ +(,*+76'5672:2+ 6272'20(1,&$*9$/'(= .$5(1'51$3/(6)/ 6272'20(1,&$9$/'(= .$5(1'51$3/(6)/ 6287+32,17($7:,1'67$50$5,1$ $662&,$7,21,1& 32%2;1$3/(6)/ 6287+:(67)/25,'$5(17$/6//& 5,'*(:22''51$3/(6)/ 63$*12/$6$/9$725(- *,1$5/8&&,63$*12/$ /<)25',6/('51$3/(6)/ 63$5.6-21$7+$1: 6$1'5$$&5$:6+$:63$5.6 /,*+7%2851:$<1$3/(6)/ 63(==$12*$5< 321'3/&26&2%&7 63,7=(5(5,&5 68=$11( '20,1,&$'5,9(81,71$3/(6)/ 67-($1&8/0(5 287(5'5,9(1$3/(6)/ 67/28,6-($13,(55( -$&48(/,1($02570$1 /,*+7%2851:$<1$3/(6)/ 67$+/0$152%(57 *5,6(/'$ &52:16%85<:$<)2570<(56)/ 67$,*5(*25</(( 5(1(($11(67$, 1257+:22'52$'1:35,25/$.(01 67$0321(-59,&725+ 9(17125$9($7/$17,&&,7<1- 67$17211(,/ /,6%21&2857&+$03,216*$7()/ 67$17211(,/ /,6%21&2857'$9(13257)/ 67$5=<.0$5&5 &+5,67,1$' /<)25',6/('51$3/(6)/ 67$7215(92&$%/(75867 7+6711$3/(6)/ 67$<,17+(/,1(65(975867 7$8586'50$6+3((0$ 67($&<0,&+$(/ -2$11( %(1-$0,1 /$85$67($&< :22'+$9(1'5.,1*6721.35&$1$'$67($516/,1'$%.$5,1$3$$3(:$5:,&.$9(1$3/(6)/67((/,,,-26(3+:$/.(5/<11(526(67((/&/$5(1'21'51$3/(6)/67()$129,&9(61$$0(7+<67/$1(3$7(56211-67())(167+20$6/ 1$1&<- '20,1,&$'5,9(1$3/(6)/67(,1(5&/$86',125,1*675:(+,1*(1*(50$1<67(,1,.67$1/(<'$9,'1$1&<(67(//(67(,1,.&/$5(1'21'51$3/(6)/67(51%(5*67(9(1-'20,1,&$'51$3/(6)/672&.-5-2+1 /<11%&29(&2857257/(<%($&+1-6721(5)5,7=$ 0,&+(/(5+,*+%2851('51$3/(6)/67276.<6$1'5$$9(//,1$:$<1$3/(6)/675$86.$7+/((1 $1'5(:5,'*('53203721/$.(61-675(,/(5-5-$0(652/$1'.$7+,526(675(,/(5(/%2:$9(1$3/(6)/6752+9,5*,1,$&$625,$&28571$3/(6)/6780%2*$5<:+2//<$9(1$3/(6)/6780%2*$5<:+2//<$9(1$3/(6)/6780%2521$/'5+2//<$9(1$3/(6)/6780%2521$/'5+2//<$9(1$3/(6)/68$5(=&25,11(($672+,267&+,&$*2,/32/LVWBB3/9.A.2.d Packet Pg. 322 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 68/.(6&+$'7 &2&2/$.(63/1$3/(6)/ 68//,9$1(7$/-(55<: +$:7+251('5/(0217,/ 681&2$67&5(',781,21 (+,//6%2528*+$9(7$03$)/ 6816(5-$0(60$57,1 526($11 +2<7)$50&,&(521< 6850$,7,6)$0,/<75867 $1'526'51$3/(6)/ 686$1&$00$5$12/,975867 52%(57&&$00$5$12/,975867 +817(565,'*('53(11,1*7211- 686$1&$00$5$12/,975867 52%(57&&$00$5$12/,975867 +817(565,'*('53(11,1*7211- 686$1&$00$5$12/,975867 52%(57&&$00$5$12/975867 +817(565,'*('53(11,1*7211- 686$1(3,(55(6/,9,1*75867 1(7+675((7 81,70,$0,)/ 686$13,(5621621'(5%<75867 $1'526'51$3/(6)/ 686$15287+/,9,1*75867 0217(*23/$=$'$//$67; 686$16$1'(56215(9/,975867 +$,7,'51$3/(6)/ 6867$&+(.-21* 6$,17$1'5(:6%/9'$371$3/(6)/ 687+(5/$1',,,-2+1( -$1(3$75,&,$6(,'/ '20,1,&$'51$3/(6)/ 6:((1(<3$75,&.- 1$1&<( 75(9,&28571$3/(6)/ 6:(,7=(5&,1'< %((&+:22'/$.('5,9(1$3/(6)/ 6</9,$0$;,1(<9211( 75(9,&71$3/(6)/ 6=&=(61<3$0(/$ $1'526'51$3/(6)/ 6=<0$16.,%5,$1$ .,0%(5/< +$67,1*6&2857*851((,/ 7/758(6'(//5(975867 &/$5(1'21'51$3/(6)/ 705,&+$5'6215(9/,975867 .,1*6/$.(%/9'1$3/(6)/ 7$1*-552*(5& $11(77(- 6811<6,'(5'),1'/(</$.(1< 7$17,//2-5-26(3+3 521$/'-&$51(9$/( 67($09,(:/1/$1&$67(51< 7$17,//2-5-26(3+3 521$/'-&$51(9$/( 675((09,(:/1/$1&$67(51< 7$773523(57,(675(9,62//& 1257+02817$9(72521720+1&$1$'$ 7$</250$5-25,(0 %(48,$:$<1$3/(6)/ 7$</257+20$6(':$5' 7+20$6586721*$55(77 $1(*$'$'5,9(1$3/(6)/ 7%73523(57,(6//& $9(//,12:$<1$3/(6)/ 7%73523(57,(6//& $9(//,12:$<1$3/(6)/ 7($56-5&/$5(1&(6801(5 5(,1$0$5*$5,7$92*(/(5 +,*+%2851('51$3/(6)/7(55$&(,;$775(9,62%$<&21'20,1,80$662&,$7,21,1& .(1:22'/$1(68,7()2570<(56)/7(55$&(9,,$775(9,62%$<&21'20,1,80$662&,$7,21,1& .(1:22'/$1(68,7()2570<(56)/7(55$&(9,,,$775(9,62%$<&21'20,1,80$662&,$7,21,1& 7523,&$/,6/(60$1$*(0(17 .(1:22'/$1(68,7()2570<(56)/7(55$&(;$775(9,62%$<&21'20,1,80$662&,$7,21,1& .(1:22'/$1(68,7()2570<(56)/7(55<*$/(*80 %5(1'$-2<*8075867:$5:,&.$9(1$3/(6)/7(612-,// +(15<$5(&$$9(1$3/(6)/7+20$6%63,//$1(-575867:$5:,&.$9(1$3/(6)/7+20$6.+(15<75867+,*+%2851('51$3/(6)/7+20$63+$/,1*75867'(%25$+),11(65(9/,975867 /<)25',6/('5,9(1$3/(6)/7+20$65(92&$%/(75867'20,1,&$'51$3/(6)/7+20$652%,1621,5$7+/111$3/(6)/7+20$6.(,7+. .$5(167$1'5(:6&7)$,5),(/'2+7+20$65,&+$5'. %5(1'$- .$1'$+$5&7:+($721,/7+203621%5$'/(<& &$7+5<15 /21*%2$7'51$3/(6)/7+203621%5$'/(<& &$7+5<15 /21*%2$7'51$3/(6)/7,,7)'(30$5,1(5(6285&(6 522.(5<%$<&20021:($/7+%/9'7$//$+$66(()/7,,7)'(30$5,1(5(6285&(6 522.(5<%$<&20021:($/7+%/9'7$//$+$66(()/7,,7)'(30$5,1(5(6285&(6 522.(5<%$<&20021:($/7+%/9'7$//$+$66(()/7,,7)'(30$5,1(5(6285&(6522.(5<%$<&20021:($/7+%/9'7$//$+$66(()/7,,7)'15522.(5<%$<1$7(676$1&'(3'28*/$6%/'*&20021:($/7+%/9'7$//$+$66(()/7,,7)'27672))/'28*/$6%/'*&20021:($/7+%/9'7$//$+$66(()/7,,7)'27672))/'28*/$6%/'*&20021:($/7+%/9'7$//$+$66(()/7,,7)5(& 3$5.6522.(5<%$<&20021:($/7+%/9'7$//$+$66(()/7,,7)5(& 3$5.6522.(5<%$<&20021:($/7+%/9'7$//$+$66(()/7,027+<)&21:$<5(975867 :+,63(5%/8))75$,/+,1&./(<2+7-$1&/$,5()3$5$',6(&5(6&(17:$7(5/2217-&$1$'$72''&+$30$1)$0,/<75867 %5<$1&$1<215':$6+2(9$//(<1972''-$0(67 ,5,6(2/'2$.75$&(&2/80%862+72)$175$11(77(3)5$1./3529(1=$75+(/(1$3529(1=$5(9,1775867 :22'+$5%25'5)257:257+7;72/621-$0(6( /,1'$,+$,7,'51$3/(6)/720$6,7+20$6-&<17+,$7($5(720$6,6721(+$5%285'581,7/$.(:257+)/7200$5(//26$/9$725(-/$85,('7200$5(//26$/9$725($7200$5(//2$1'526'51$3/(6)/721(77,)5('(5,&.:-$&48(/,1($721(77,'20,1,&$'51$3/(6)/32/LVWBB3/9.A.2.d Packet Pg. 323 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 721,/=,1*$/(675867 72572/$&28571$3/(6)/ 7255(6-8$1& 0$5,$, $//$',1/11$3/(6)/ 7255(65$)$(/62/$12 <$,0$8548,2/$/('2 526($9(1$3/(6)/ 725812+2/'(1(5,&-$9,(5 -$1,60$5,(+2/'(1725812 +,*+%2851('51$3/(6)/ 75$1482& 7+8<1*8<(1 25&+$5'/11$3/(6)/ 75$1482&+ 7+8<01*8<(1 25&+$5'/11$3/(6)/ 75(0%/$<0$8'( %,6&$<1('51$3/(6)/ 75(9,12-55$<1$/'2 75(9,12'(/,$ 7+20$6621'51$3/(6)/ 75(9,62%$<5($/7<75867 2/<03,$52$'0$56+),(/'0$ 75(9,62%$<3523(57<2:1(56 0$67(5$662&,$7,21,1& 75(9,62%$<%/9'1$3/(6)/75(9,62%$<3523(57<2:1(56 0$67(5$662&,$7,21,1&75(9,62%$<%/9'1$3/(6)/75(9,62%$<3523(57<2:1(56 0$67(5$662&,$7,21,1&75(9,62%$<%/9'1$3/(6)/75(9,62%$<3523(57<2:1(56 0$67(5$662&,$7,21,1&75(9,62%$<%/9'1$3/(6)/75(9,62%$<3523(57<2:1(56 0$67(5$662&,$7,21,1&75(9,62%$<%/9'1$3/(6)/75(9,62%$<3523(57<2:1(56 0$67(5$662&,$7,21,1&75(9,62%$<%/9'1$3/(6)/75(9,62%$<3523(57<2:1(56 0$67(5$662&,$7,21,1&75(9,62%$<%/9'1$3/(6)/75,&&$5$<021'$ /,1'$$'20,1,&$'5,9(1$3/(6)/75,385$1(1,$6+2..3$9,7+5$75,385$1(1,$1(*$'$'51$3/(6)/76 27+(2'25(<8(7$.$1$67$6,$/((48$1'73/($6$17670(')25'0$8&&,7+20$6 0$85((1(+(1'5,&.6&76$<5(9,//(1-803,(55(5$021$1721,2*/25,$(67+(5803,(55('20,1,&$'51$3/(6)/81&+2/',1*6//&25&+$5'/$1(%52$'9,(:+(,*+72+81&+2/',1*6//&25&+$5'/$1(%52$'9,(:+762+81,7('7(/(3+21(&22))/(0%$54&253$7713523(57<7$;32%2;29(5/$1'3$5..6855($$/(-$1'52&$5/266$%$=$5,1$855($6$,17$1'5(:6'535(6723$86$%5,$1&2/(0$1&+,()/$1'5(6285&(6352*5$02)),&( 1$7,21$/3$5.6(59,&(6 +256(6+2('5667( 1$3/(6)/8=83(69$1(66$',$1$$9(18(1$3/(6)/9$&&$5(//25,&+$5'+%$5%$5$-&$03,6,:$5:,&.$9(1$3/(6)/9$'(%21&2(851$1&<0,&+(/'(9($8/7(0,/(1(//,*$1752,65,9,(5(6*<&&$1$'$9$--+$/$5$9, %+$5$7,75(9,&28571$3/(6)/9$/'(=2/,9$5 0$5&(/,1$+2//<$9(1$3/(6)/9$/(17$-($11,1(*5(*/(61,$.$1'5(:6$9(18(1$3/(6)/9$/(5$(/,=$%(7+ 52$0<5$8/ 75(9,&71$3/(6)/9$1'(&.(5-2+1(':$5'0,&+(//(/,6$9$1'(&.(5/<)25',6/('5,9(1$3/(6)/9$17,1(0$5,/((:22'6,'($9(1$3/(6)/9$1'(5+$*(10$5.' '(1,6(5 3(0%52.(:$<1$3/(6)/9$1=2)$0,/<75867%$55(77321'5'&2/'635,1*61<9$51$'2(*(25*(/ 686$1$ $1'526'51$3/(6)/9$648(=*867$927+20$6621/11$3/(6)/9$648(=-8$1.$5$0$57,175(9,&28571$3/(6)/9(/(=&255($-26(5526($9(1$3/(6)/9(1'(77$-26(3+) .$5(1' $17,*8$:$<1$3/(6)/9(5%26(':$5'$/(;,$9(5%261257+(51/,*+7&,5&/(+,1&./(<2+9(67-(5(0<1,&2/(58662&$625,$&28571$3/(6)/9)//&:,//2:&70$5&2,6/$1')/9,$9(1(72$775(9,62%$<1(,*+%25+22'$662&,$7,21,1& %(1&35$770,/(&<35(663.:<)70<(56)/9,$9(1(72$775(9,62%$<1(,*+%25+22'$662&,$7,21,1&%(1&35$770,/(&<35(663.:<)70<(56)/9,$9(1(72$775(9,62%$<1(,*+%25+22'$662&,$7,21,1& %(1&35$770,/(&<35(663.:<)70<(56)/9,*( 0((6215(92&$%/(75867 &$<&28571$3/(6)/9,//$*()$//66(9(1,1&7$0,$0,75/(1$3/(6)/9,//$17,52%(571,&+2/$6/$*5(*$&$17(5%85<&72$.'$/(1<:$'(521$/'$17+21<'20,1,&$'51$3/(6)/:$/'521$867,1-667$7(67&+,&$*2,/:$/.(5678$575,&+$5'.$5(1(/,=$%(7+:$/.(5$%%(<$9(67$/%$16+(576$/%-81,7('.,1*'20 :$//(1&('21$/'0 -2$1/ 6&+8</.,//5'635,1*&,7<3$:$5'.$7+/((1$&2167,787,21'51$3/(6)/:$5=,1,$.$1*(/,1('2527+</$:5(1&(6$,17$1'5(:6%/9'%1$3/(6)/:$<1(3-2+1621)/5(675867 *5$1'$9(18(63(1&(5,$:$=)25'5($/7<75867$9(//,12:$<1$3/(6)/:($7+(5621*$5< :$1'$$1'526'51$3/(6)/:($9(51$7+$1 )$/,6&,$52&.%$<'5/28,69,//(.<:(%%.(11(7+5.$7+5<1052//,16$1'526'51$3/(6)/:(%(53$75,&.&+$5/(6-(11,)(5/<11:(%(5&$625,$&28571$3/(6)/32/LVWBB3/9.A.2.d Packet Pg. 324 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann :(%(5/(,1'$9,'0 &<17+,$/ $1'526'51$3/(6)/ :(,%(/(5:,//,$0) .$7+///(13:(,%(/(5 +$,7,'51$3/(6)/ :(,5&$52/($ '20,1,&$'51$3/(6)/ :(,66'$1,(/( %$5%$5$$ &$<&28571$3/(6)/ :(17:257+(67$7(6&'' 1257+($677+7(55$&( 68,7(2$./$1'3$5.)/ :(17:257+(67$7(6&'' 1257+($677+7(55$&( 68,7(2$./$1'3$5.)/ :(17:257+(67$7(6&'' 1257+($677+7(55$&( 68,7(2$./$1'3$5.)/ :(17:257+(67$7(6&'' 1257+($677+7(55$&( 68,7(2$./$1'3$5.)/ :(17:257+(67$7(6&'' 1257+($677+7(55$&( 68,7(2$./$1'3$5.)/ :(17:257+(67$7(6&'' 1257+($677+7(55$&( 68,7(2$./$1'3$5.)/ :(17:257+(67$7(6&'' 1257+($677+7(55$&( 68,7(2$./$1'3$5.)/ :(51(5%5$1'210 0,1',$9(1$3/(6)/ :(51(57+(2'25( -2$11( 5$<021'675((752&.9,//(&(175(1< :(6775867 '(11,621'5*/(1'$/(+(,*+76,/ :+(/$1',$11(7(55,2 &/$,5(07(55,2 '20,1,&$'51$3/(6)/ :+,''(15$<$ %,6&$<1('51$3/(6)/ :,$1(':$5' *,1$ :<1'(0(5('5-2+1672:13$ :,(*(3523(57,(6//& 3$/$&,27(55$&(61$3/(6)/ :,(52:6.,-$0(69,1&(17 1$1&<.:,(52:6., 6&$5%2528*+3$5.52&+(67(51< :,//,$05&/$<32/(75867 (//,621'5:(67(59,//(2+ :,//,$0&($8-2+1< 0,1',$9(18(1$3/(6)/ :,//,$06'(%25$+* 3$8/+:,//,$06 (0,/<$:,//,$06 :,17(567 5(+2%27+0$:,//28*++($/7+&$5(,1&32%2;&/($5:$7(5)/:,//28*+%<-$621$/(;$1'(5 /$85$'(1,6(:,//28*+%<+,*+%2851('51$3/(6)/:,/621'$9,'/ .$7+/((10 75(9,&71$3/(6)/:,/62152%(57 686$132-$&32,175'1.,1*672:15,:,1'+$0'$55</0,1',$9(1$3/(6)/:,1'86-5-26(3+35(6721*<'$5:,1'86(/%2:$9(1$3/(6)/:,1)25',7851(56575867/,%(57</11$3/(6)/:,17(5%27720$/$1-$1,&((//(17(55<'20,1,&$'5,9(81,71$3/(6)/:,77672&.7,027+<-$0(66$1'5$/<1167$1'(/'20,1,&$'51$3/(6)/:2/)580)$0,/<-2,175(975867 5(1$7( 0,.(7+$9(61$3/(6)/:2/67(1+2/0($/$1 $8'5(< %526(/(<$9(18(:$55,1*721:$++81,7('.,1*'20 :22'-$1((/($125(/%2:$9(1$3/(6)/:2=1<*(2))5(<$//$1(/,=$%(7+$/0$67521*$1(*$'$'51$3/(6)/:5,*+73$8/,1(9(7(5$16/$1('2</(672:13$<$1&(<,,/(:,65$1'2/3+-(:(/6+$1121<$1&(<6287+'29(532,17(5'+(15,&29$<(5*(55,&+$5'(1$1&<0$5,$%25.<(5*(575(9,&71$3/(6)/<2/7$<(/$,1(/28,6(-26+68&$<2/7$<75(9,&28571$3/(6)/<281*&+5,6723+(5'0,&+(//(0<281*)$/&21632,179,&7251<<281*'$9,'*5,(50$5,$11$%52:1<281*&$<&28571$3/(6)/<281*'(%25$+/ 0,&+$(// :(676287++(%521,1<281**5(*25< 6$1'5$%/8(+(521'5,9((1257+9,//(0,<281*0,&+$(/3 3$75,&,$$ $1'526'51$3/(6)/<281*67(3+(10 '211$0 $1'526'51$3/(6)/<286,)7+$,5)$',$+(50,=75(9,&28571$3/(6)/<85,&+$5'$ 6$1'5$$)$,5),(/'$9(:(673257&7=$%$/$0$5,20$5,$)(51$1'$=$%$/$526($9(18(1$3/(6)/=$&&2/,$17+21<*(5,$11$'$0252$12.(675((76($)25'1<=$'52=1<7+20$63$8/&$52/$11=$'52=1<&$<&28571$3/(6)/=$+1$1'5(:-)(51$1'$6&+8&+$1'526'51$3/(6)/=$3$7$)5$1&,6&2-2&,17,$$552<2-,0(1(=&$50(1')/25(60,1',$9(1$3/(6)/=$33$-5/(2-2+1 686$10 )2;),5(&7635,1*),(/',/=$5$*2=$(/($=$5'8$57(+2//<$9(1$3/(6)/=$:2/'$1$ -26(3+/<',$/$1(%(//025(1<=(*5$60$5</+$,7,'5,9(1$3/(6)/=(/',1(5,&0 $11(77()7$//75((75$,/&+$*5,1)$//62+=(/0$12:3+,//,3 6$0$17+$ 7+20$6:$,7(5'2/'/<0(&7=(3('$6$/9$'25=(3('$526$/,1'$+(51$1'(= +2//<$9(1$3/(6)/=,(*(/0$,(5-(11,)(5/08//(5 7$0,$0,75/(+1$3/(6)/=,00(50$16$1'5$-75(9,&28571$3/(6)/=<*1(5:$//$&(-67$1'5(:6%/9'%1$3/(6)/32/LVWBB3/9.A.2.d Packet Pg. 325 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann &ŝƌƐƚEĂŵĞ >ĂƐƚEĂŵĞ KƌŐĂŶŝǌĂƚŝŽŶĚĚƌĞƐƐϭĚĚƌĞƐƐϮŝƚǇ ^ƚĂƚĞ WŽƐƚĂůŽĚĞŚƵĐŬ tĂůƚŽŶ /ƐůĞƐŽĨĂƉƌŝŝǀŝĐƐƐŽĐŝĂƚŝŽŶϭϮϰ,ŝůŽ^ƚ͘EĂƉůĞƐ &>ϯϰϭϭϯ<ŝƌŬW͘ ŽůǀŝŶ/ƐůĞƐŽĨĂƉƌŝŝǀŝĐƐƐŽĐŝĂƚŝŽŶϯϯϴĂƉƌŝůǀĚ͘EĂƉůĞƐ &>ϯϰϭϭϯĂǀŝĚ dĂƚĞ>ĞůǇŽƵŶƚƌǇůƵďWƌŽƉĞƌƚǇKǁŶĞƌƐƐƐŽĐ͘ ϭϴϭDƵŝƌĨŝĞůĚŝƌĐůĞEĂƉůĞƐ &>ϯϰϭϭϯŶĚƌĞǁ ,ĂũĚƵĐŬǇ dĂŶŐůĞǁŽŽĚWƌŽƉĞƌƚǇKǁŶĞƌƐƐƐŽĐŝĂƚŝŽŶ ϭϬϴYƵĂŝů,ŽůůŽǁŽƵƌƚEĂƉůĞƐ &>ϯϰϭϭϯdĞĚĞĐŬĞƌ /ƐůĞƐŽĨĂƉƌŝŝǀŝĐƐƐŽĐŝĂƚŝŽŶϰϮϱ^ĂŶ:ƵĂŶǀĞŶƵĞEĂƉůĞƐ &>ϯϰϭϭϯŝůůtĂůďƌŝĚŐĞ &ŽƌĞƐƚ'ůĞŶ'ŽůĨĂŶĚŽƵŶƚƌǇůƵďͲͲ:ƵŶŐůĞWůƵŵĂƐƚϯϳϲϬ:ƵŶŐůĞWůƵŵƌŝǀĞĂƐƚ EĂƉůĞƐ &>ϯϰϭϭϯ'ĞŽƌŐĞ͘ ZĂŵƐĞǇ >ĞůǇŝǀŝĐƐƐŽĐŝĂƚŝŽŶ͕/ŶĐ͘Ϯϳϱ&ŽƌĞƐƚ,ŝůůƐŽƵůĞǀĂƌĚEĂƉůĞƐ &>ϯϰϭϭϯZŝĐŚĂƌĚ ƐŬƌŝĚŐĞ ,ŝƚĐŚŝŶŐWŽƐƚŽͲŽƉ/ŶĐ͘ϯϮŚĞǇĂŶŶĞdƌĂŝůEĂƉůĞƐ&>ϯϰϭϭϯdĂůůKĂŬƐŽĨEĂƉůĞƐϱϮϱĂƌĞĨŽŽƚtŝůůŝĂŵƐZŽĂĚ EĂƉůĞƐ &>ϯϰϭϭϯtŚŝƐƚůĞƌΖƐŽǀĞƉĂƌƚŵĞŶƚƐϭϭϰϬϬtŚŝƐƚůĞƌΖƐŽǀĞůǀĚ͘ EĂƉůĞƐ &>ϯϰϭϭϯ<ĞŶƌƵŵ>ĞůǇ/ƐůĂŶĚƐƚĂƚĞƐ,ŽŵĞŽǁŶĞƌƐƐƐŽĐŝĂƚŝŽŶ ϴϰϬϰDĂůůŽǁ>ĂŶĞEĂƉůĞƐ &>ϯϰϭϭϯ&ŝĚĚůĞƌΖƐƌĞĞŬ,ŽŵĞŽǁŶĞƌΖƐƐƐŽĐŝĂƚŝŽŶ ĐͬŽĂƌĚŝŶĂůDĂŶĂŐĞŵĞŶƚ'ƌŽƵƉ ϱϬϲϳdĂŵŝĂŵŝdƌĂŝůĂƐƚ EĂƉůĞƐ &>ϯϰϭϭϯ:ĞŶŶŝĨĞƌ dĂŶŶĞƌ >ĞůǇŝǀŝĐƐƐŽĐŝĂƚŝŽŶϮϵϳĂǇDĞĂĚŽǁƐƌŝǀĞEĂƉůĞƐ &>ϯϰϭϭϯ^ĂŵƵƌƐŽ,ĂďŝƚĂƚĨŽƌ,ƵŵĂŶŝƚǇϭϭϱϱϬdĂŵŝĂŵŝdƌĂŝůĂƐƚEĂƉůĞƐ &>ϯϰϭϭϯ'ĂƌǇ ZŽŐĞƌƐ >ĞůǇZĞƐŽƌƚ'ŽůĨΘŽƵŶƚƌǇůƵďϳϵϴϵ'ƌĂŶĚ>ĞůǇƌŝǀĞEĂƉůĞƐ &>ϯϰϭϭϯ^ƵƐĂŶD͘ ^ǁŝŚĂƌƚ sŝĐƚŽƌŝĂ&ĂůůƐ,ŽŵĞŽǁŶĞƌƐƐƐŽĐŝĂƚŝŽŶ,ĂďŝƚĂƚĨŽƌ,ƵŵĂŶŝƚǇϭϭϭϰϱdĂŵŝĂŵŝdƌĂŝůĂƐƚ EĂƉůĞƐ &>ϯϰϭϭϯƌŝĂŶĂ &ƌŝĞĚůĂŶĚĞƌ sŝĐƚŽƌŝĂ&ĂůůƐ,ŽŵĞŽǁŶĞƌƐƐƐŽĐŝĂƚŝŽŶ,ĂďŝƚĂƚĨŽƌ,ƵŵĂŶŝƚǇϭϭϭϰϱdĂŵŝĂŵŝdƌĂŝůEĂƉůĞƐ &>ϯϰϭϭϯƌŝĂŶĂ &ƌŝĞĚůĂŶĚĞƌ ŚĂƌůŝĞƐƚĂƚĞƐ,ŽŵĞŽǁŶĞƌƐƐŽĐŝĂƚŝŽŶ,ĂďŝƚĂƚĨŽƌ,ƵŵĂŶŝƚǇϭϭϭϰϱdĂŵŝĂŵŝdƌĂŝůEĂƉůĞƐ &>ϯϰϭϭϯ<ĞŝƚŚ dŽŵƉŬŝŶƐ YƵĞĞŶΖƐWĂƌŬϭϮϳϬϵdĂŵŝĂŵŝdƌĂŝůĂƐƚEĂƉůĞƐ &>ϯϰϭϭϯ>ŝŶĚĂ DŽƌƌŝƐDĂƌĐŽͬEĂƉůĞƐ,ŝƚĐŚŝŶŐWŽƐƚZsZĞƐŽƌƚϭϬϬĂƌĞĨŽŽƚtŝůůŝĂŵƐZŽĂĚ EĂƉůĞƐ &>ϯϰϭϭϯŶŶ ,Ăůů/ƐůĞŽĨĂƉƌŝŝǀŝĐƐƐŽĐ͕͘/ŶĐ͘ϯϯϴĂƉƌŝůǀĚ͘EĂƉůĞƐ&>ϯϰϭϭϯ,ŽǁĂƌĚ >ƵƌŝĞ/ŶĚŝĂŶtĞůůƐͲ>ĞůǇZĞƐŽƌƚϴϰϰϵ/ŶĚŝĂŶtĞůůƐtĂǇEĂƉůĞƐ&>ϯϰϭϭϯŽďDƵƌƌĂǇ ^ƵŶƐƚŽŶĞŽŶƚŚĞ&ĂŝƌǁĂǇƐ>ĞůǇZĞƐŽƌƚϵϬϴϳDŝĐŚĂĞůŝƌĐůĞηϭEĂƉůĞƐ &>ϯϰϭϭϯ^ƵƐĂŶD͘ ^ǁŝŚĂƌƚ ŚĂƌůĞĞƐƚĂƚĞƐ,ŽŵĞŽǁŶĞƌƐƐƐŽĐŝĂƚŝŽŶ ,ĂďŝƚĂƚĨŽƌ,ƵŵĂŶŝƚǇϭϭϭϰϱdĂŵŝĂŵŝdƌĂŝůĂƐƚ EĂƉůĞƐ &>ϯϰϭϭϯĂƌĞǇ ZĞĂůďƵƚŽ DƵƐƚĂŶŐ/ƐůĂŶĚ,ŽŵĞŽǁŶĞƌƐƐƐŽĐŝĂƚŝŽŶ ϴϴϵϳDƵƐƚĂŶŐ/ƐůĂŶĚŝƌĐůĞEĂƉůĞƐ &>ϯϰϭϭϯDĂƌĐŝ ^ĞĂŵƉůĞƐ ĂƐƚEĂƉůĞƐŝǀŝĐƐƐŽĐŝĂƚŝŽŶϯϴϮϯdĂŵŝĂŵŝdƌĂŝů͕WDηϮϳϰEĂƉůĞƐ &>ϯϰϭϭϮdĞĚĞŝƐůĞƌĂƐƚEĂƉůĞƐŝǀŝĐƐƐŽĐŝĂƚŝŽŶ͕/ŶĐ͘ϰϳϴϰ/ŶǀĞƌŶĞƐƐůƵďƌŝǀĞEĂƉůĞƐ &>ϯϰϭϭϮdĂŵŝ ^ĐŽƚƚĂǇƐŚŽƌĞ'ĂƚĞǁĂǇdƌŝĂŶŐůĞZϯϮϵϵdĂŵŝĂŵŝdƌĂŝů͕^ƵŝƚĞϭϬϯEĂƉůĞƐ &>ϯϰϭϭϮ,K^E/s/^^K/d/KE^ͲD/>/E'>/^d;W>ϮϬϭϵϬϬϬϮϯϬϱͿ9.A.2.d Packet Pg. 326 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 2271 McGregor Boulevard • Fort Myers, Florida 33901 Phone (239) 461-3170 • Fax (239) 461-3169 Sabal Bay MPUD (aka Fleischmann Parcel) NIM Procedures A.Notifications 1.Send Zoom information with https link and meeting ID. No password. 2.Include Zoom dial-in numbers with meeting ID. 3.Provide an email allowing residents to send their questions prior to the meeting. 4.Provide a process to allow residents to RSVP to the in-person meeting. 5.Create an out-of-office email auto reply in the hours before and during the NIM with instructions to the Zoom meeting. B.Safety measures for in-person meeting 1.Meet in a large enough location to social distance. 2.Limit attendance to local and state guidelines at the time of the meeting. If gathering size is exceeded hold a second meeting after the first. 3.Provide individual sign-in sheets and pens and place on each chair. Provide a container for attendees to deposit pens and sign-in sheets. 4.Wear masks. If the attendees agree to the request and space allows, the presenter may remove their mask while they are presenting. 5.Provide hand sanitizer and a few disposable courtesy masks. C.Meeting process 1.At the start of the presentation provide an email and phone number to allow those attending via Zoom to provide their contact information. 2.Presentation in chief from the development team. 3.Read and respond to questions received via email prior to the meeting. Do not paraphrase questions. Do not present their address or name to the public. Keep a record of who each question came from in the notes portion of powerpoint, which will convert to notes in pdf format. 4.Take questions and respond to Zoom and in-person attendees. Alternate between Zoom and in-person. If those on Zoom are unable to hear the questions of the in-person attendees, repeat the question into the microphone and confirm the repeated question was correctly stated. 5.Keep all Zoom attendees on mute until it is their turn to speak. Answer questions in the order they ‘raised their hand’. 6.Request those asking a question to state their name and address. 9.A.2.d Packet Pg. 327 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 2271 McGregor Boulevard • Fort Myers, Florida 33901 Phone (239) 461-3170 • Fax (239) 461-3169 D.Information provided to Collier County 1.Zoom recording of the meeting, which shows the powerpoint presentation. 2.List of meeting attendees, in all forums, to Collier County with the best known contact information. 3.Written meeting summary, which may be brief due to Zoom recording. 4.Copy of sign-in sheets and any handouts that were distributed at the meeting showing the proposed change. 5.Copy of emails received by residents prior to the meeting. 6.Copies of any plans or boards that were displayed during the meeting. 9.A.2.d Packet Pg. 328 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 329 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 1HLJKERUKRRG,QIRUPDWLRQ0HHWLQJJuly 16th, 2020PL201900023059.A.2.d Packet Pg. 330 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann &DUO$%DUUDFR3(%DUUDFRDQG$VVRFLDWHV,QF9.A.2.d Packet Pg. 331 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann INTRODUCTION7KDQN\RXIRUWLPHDQGDWWHQWLRQGXULQJXQXVXDOWLPHV6DIHW\PHDVXUHV6RFLDOGLVWDQFLQJ=RRPPHHWLQJ,PPHGLDWHWHFKQLFDOGLIILFXOWLHV:HDQG&RXQW\QHHG\RXUFRQWDFWLQIRUPDWLRQ6LJQLQSDJHV=RRPDQGSKRQHSURYLGH\RXUFRQWDFWLQIRUPDWLRQODWHUWR'DZQ5XVVHOOGDZQU#EDUUDFRQHW9.A.2.d Packet Pg. 332 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann PROJECT TEAM&DUO$%DUUDFR3(a%DUUDFRDQG$VVRFLDWHV,QF-HQQLIHU6DSHQ$,&3a%DUUDFRDQG$VVRFLDWHV,QF0LNH(OJLQa0LQWR&RPPXQLWLHV 86$5LFK<RYDQRYLFK(VTa&ROHPDQ<RYDQRYLFK.RHVWHU:HV.D\QH3(a%DUUDFRDQG$VVRFLDWHV,QF$QG\:RRGUXIIa3DVVDUHOOD $VVRFLDWHV,QF7UHELOFRFN&RQVXOWLQJ6ROXWLRQV3$9.A.2.d Packet Pg. 333 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann -HQQLIHU6DSHQ$,&3%DUUDFRDQG$VVRFLDWHV,QF9.A.2.d Packet Pg. 334 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann AERIAL LOCATION9.A.2.d Packet Pg. 335 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann CURRENT MASTER PLAN9.A.2.d Packet Pg. 336 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann CURRENT MASTER PLAN9.A.2.d Packet Pg. 337 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann PROPOSED MASTER PLAN9.A.2.d Packet Pg. 338 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann CURRENT MASTER PLANPROPOSED MASTER PLAN9.A.2.d Packet Pg. 339 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 1RFKDQJHV$FFHVV8VHV([LVWLQJSUHVHUYHPROPOSED MASTER PLAN&KDQJHVDFDGGHGWRSURMHFWDGGLWLRQDOXQLWV)URPWRGXDFNo multifamilyDFDGGLWLRQDORSHQVSDFHDFDVSUHVHUYH0HHWVSUHVHUYHUHTXLUHPHQWVVWDQGDORQH9.A.2.d Packet Pg. 340 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann ICP HOA INCREASE 143 UNITSCurrent PUD1999 unitsProposed increase230 unitsProposed PUD total2229 units9.A.2.d Packet Pg. 341 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann ICP HOA INCREASE 143 UNITSCurrent PUD1999 unitsProposed increase230 unitsProposed PUD total2229 unitsControlledby others437 unitsControlled by Minto1792 units9.A.2.d Packet Pg. 342 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann ICP HOA INCREASE 143 UNITSCurrent PUD1999 unitsProposed increase230 unitsProposed PUD total2229 unitsControlledby others437 unitsControlled by Minto1792 unitsCurrent units within ICP HOA 1649 unitsUnits to be added to ICP HOA 143 units 9.A.2.d Packet Pg. 343 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann CURRENT PLAN$SSURYHG$FFHVV866DED'U WR7KRPDVVRQ'U%D\VKRUH'U+DPLOWRQ$Y&RUULGRUFRQQHFWLRQDFURVV%D\VKRUH9.A.2.d Packet Pg. 344 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 866DED'U7KRPDVVRQ'U%D\VKRUH'U+DPLOWRQ$YPROPOSED PLAN$FFHVV8QFKDQJHGCURRENT PLAN9.A.2.d Packet Pg. 345 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann %D\VKRUH'U$FFHVVWR%D\VKRUHXQFKDQJHGWZRVHSDUDWHJDWHGHQWULHV$FFHVVWRQHZSDUFHOZLWKLQLQWHUQDOURDGZD\V\VWHP9.A.2.d Packet Pg. 346 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann %D\VKRUH'U7ZRVHSDUDWHJDWHGHQWULHV%D\VKRUHULJKWRIZD\WRUHPDLQ$FFHVVXQFKDQJHGWR+ROO\$YH+2//<'59.A.2.d Packet Pg. 347 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann &DUO$%DUUDFR3(%DUUDFRDQG$VVRFLDWHV,QF9.A.2.d Packet Pg. 348 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann TRAFFIC ANALYSIS 7KHWUDIILFLPSDFWVWDWHPHQW7,6ZDVSUHSDUHGLQDFFRUGDQFHZLWK&RXQW\JXLGHOLQHV 7KH7,6DGGUHVVHVWKHSURMHFW¶VWULSJHQHUDWLRQWULSGLVWULEXWLRQDVVLJQPHQWEDFNJURXQGWUDIILFH[LVWLQJIXWXUHURDGZD\QHWZRUNFRQGLWLRQVWUDQVSRUWDWLRQLPSDFWVWRWKHDUHDURDGZD\QHWZRUNVLWHDFFHVVWXUQODQHDQDO\VLVLPSURYHPHQWDQDO\VLVDQGPLWLJDWLRQRILPSDFW 7UHELOFRFN&RQVXOWLQJXVHGWKHODWHVWHGLWLRQRIWKH,QVWLWXWHRI7UDQVSRUWDWLRQ(QJLQHHUVWULSJHQHUDWLRQPDQXDOWKHGLWLRQWRDQDO\]H 'HWDLOHG7,6LVDYDLODEOHRQWKHFRXQW\¶VRQOLQHUHFRUGVIRUWKHSURMHFW9.A.2.d Packet Pg. 349 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann TRAFFIC ANALYSIS 7KH%D\VKRUH 'ULYHVHJPHQWORFDWHGVRXWKRI7KRPDVVRQ'ULYHLVQRWD&ROOLHU&RXQW\PRQLWRUHGURDGZD\EXWLVDORFDOSXEOLFVWUHHW7RGHWHUPLQHWUDIILFEDFNJURXQGFRQGLWLRQVRQWKLVOLQN7UHELOFRFN&RQVXOWLQJWRRNDQDGGLWLRQDOVWHSDQGREWDLQHGWUDIILFFRXQWVLQ-DQXDU\RIWKLV\HDU7KH\DOVRDQDO\]HGIXWXUH,VOHVRI&ROOLHU3UHVHUYHIND 6DEOH%D\WUDIILFRQ6%D\VKRUH 'UDVUHTXHVWHGE\WKHFRPPXQLW\DQGVWDII %DVHGRQ7UHELOFRFN&RQVXOWLQJ¶VDQDO\VLVWKHSURSRVHGSURMHFWLVDVLJQLILFDQWWUDIILFJHQHUDWRURQ%D\VKRUH DQG7KRPDVVRQEXWWKHUHLVDGHTXDWHDQGVXIILFLHQWURDGZD\FDSDFLW\RQDOODQDO\]HGURDGZD\VHJPHQWVWRDFFRPPRGDWHWKHSURSRVHGGHYHORSPHQW 7KHSURMHFWGRHVQRWFUHDWHDGYHUVHLPSDFWV9.A.2.d Packet Pg. 350 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann -HQQLIHU6DSHQ$,&3%DUUDFRDQG$VVRFLDWHV,QF9.A.2.d Packet Pg. 351 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann =RQLQJSODQIRU7UDFW5HVWDEOLVKHV3UHVHUYHRSHQVSDFH%XIIHUV$FFHVV9.A.2.d Packet Pg. 352 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann RESIDENTIAL LAND PLAN&21&(378$/$1'68%-(&772&+$1*((53SHQGLQJ9.A.2.d Packet Pg. 353 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann RESIDENTIAL LAND PLAN&21&(378$/$1'68%-(&772&+$1*(No multifamily9.A.2.d Packet Pg. 354 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann ,IQRWGHYHORSHGZLWK,VOHVRI&ROOLHU3UHVHUYH&XUUHQW]RQLQJ1RUWK56)6RXWK$J6LWHSODQFRPSOLHVZLWK56)UHJXODWLRQV$FFHVVRQO\RQ%D\VKRUHFRQVWUXFWLRQDQGUHVLGHQWV,QDGHTXDWHILOOEDODQFHPRUHGXPSWUXFNVRQ%D\VKRUH9.A.2.d Packet Pg. 355 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann ([LVWLQJ%D\VKRUH'ULYH'HQVLWLHV%D\VKRUH 'ULYH5HVLGHQWLDO3URMHFWV6RXWKRI7KRPDVVRQ 'ULYH+ROO\$YHGXDF&RWWDJH*URYH$YHGXDF.DUHQ 'UGXDF3LQH $QGUHZV:RRGVLGH GXDF&RQVWLWXWLRQ&RORQLDO5HSXEOLFGXDF3URSRVHG$PHQGPHQW$UHD GXDF 9.A.2.d Packet Pg. 356 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann $'',7,21$/48(67,2165(&(,9('9,$(0$,/9.A.2.d Packet Pg. 357 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4XHVWLRQ:KDWLVWKHFXUUHQWPD[LPXPQXPEHURIGZHOOLQJVWKDW0LQWRLVDOORZHGWREXLOGRQWKHSURSHUW\H[FOXGLQJ)OHLVFKPDQQ":KDWZLOOEHWKHPD[LPXPQXPEHURIGZHOOLQJWKDW0LQWRZLOOEHDOORZHGWREXLOGRQWKHSURSHUW\LQFOXGLQJ)OHLVFKPDQQ",UHDOL]HWKDWWKH38'FRYHUVPRUHWKDQ,&36SULQJVHWFVR,NQRZWKDWVRPHRIWKHGZHOOLQJVDUHDOORFDWHGWR6SULQJV%XWLWDSSHDUVWKDW0LQWRZLOOEHDOORZHGWREXLOGXSWRPRUHGZHOOLQJVFRUUHFW",DOVRXQGHUVWDQGWKDWUHDOORFDWLRQRIGHQVLW\DQGRWKHUIDFWRUVPD\PDNHWKHGLIIHUHQFHEHWZHHQZKDWLVFXUUHQWO\DOORZHGTXHVWLRQDQGZKDWZLOOEHDOORZHGTXHVWLRQOHVVWKDQ+RZPXFKOHVVDQGKRZZDVWKLVFDOFXODWHG"9.A.2.d Packet Pg. 358 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann ICP HOA INCREASE 143 UNITSCurrent PUD1999 unitsProposed increase230 unitsProposed PUD total2229 unitsControlledby others437 unitsControlled by Minto1792 unitsCurrent units within ICP HOA 1649 unitsUnits to be added to ICP HOA 143 units 9.A.2.d Packet Pg. 359 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4XHVWLRQ, PLQWHUHVWHGWRNQRZKRZPDQ\YLOODVFRDFKKRPHVDQGVLQJOHIDPLO\UHVLGHQFHVRXUFXUUHQWSODQDQGWKHQHZSODQHQWDLO&RXOG\RXSOHDVHVHQGPHWKHEUHDNGRZQRIWKRVHQXPEHUV", PRQO\LQWHUHVWHGLQWKHQXPEHUVWKDWDUHSHUWDLQLQJH[FOXVLYHO\WR,&3ZLWKRXW6SULQJV4XHVWLRQ,GLGQRWVHHDORWVSHFLILFGUDZLQJIRUWKHVLWHQRUDURDGSODQ$UHWKH\DSDUWRIWKHVXEPLVVLRQDYDLODEOHRQOLQH"9.A.2.d Packet Pg. 360 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann ICP PRODUCT MIX0DVWHU6LWH3ODQ6LQJOHIDPLO\ XQLWV 3DLUHG YLOODV XQLWV 0XOWLIDPLO\ XQLWV TOTAL: 1792 units&RQFHSWXDOVXEMHFWWRIXUWKHUSHUPLWWLQJ,QFOXGHVIXWXUHYLOODXQLWVDORQJ869.A.2.d Packet Pg. 361 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4XHVWLRQ,DOVRZRXOGOLNHWRNQRZZKHUHZKHQDQGKRZPLQXWHVRIWKH1,0ZLOOEHFRPHDYDLODEOH$QVZHU$XGLRUHFRUGLQJRIWKLVPHHWLQJDORQJZLWKDZULWWHQV\QRSVLVZLOOEHLQWKH&RXQW\¶VSXEOLFUHFRUGVDORQJZLWKWKHQH[WVXEPLWWDO7KHQH[WVXEPLWWDOLVDQWLFLSDWHGLQRQHZHHN9.A.2.d Packet Pg. 362 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4XHVWLRQ&DOOHURQ:RRGVLGH$YHDVNHGWZRTXHVWLRQV:LOOWKHZRRGVEHKLQGKLVKRXVHUHPDLQ":KDWLVWKHWLPHIUDPHIRUFRQVWUXFWLRQ"$QVZHU6HYHUDOSHUPLWVDUHFXUUHQWO\XQGHUUHYLHZ&RQVWUXFWLRQZLOOQRWEHJLQEHIRUH-DQXDU\DWWKHHDUOLHVW9.A.2.d Packet Pg. 363 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4XHVWLRQ, PDKRPHRZQHURQ:RRGVLGH$YH,UHFHLYHG\RXUOHWWHUVUHFHQWO\DERXWWKHLVOH VH[SDQGLQJDQGMXVWKDYHDTXHVWLRQ7KHEDFNRIP\KRPHIDFHVWKHZRRGVZKHUH\RXUFOLHQWLVZDQWLQJWREXLOG, NQRZODVW\HDUWKH\FXWZKDWVHHPVWREHDURDGIURPWKH,VOHVWR%D\VKRUH 'U :LOOWKH\EHEXLOGLQJFRQGRVULJKWEHKLQGP\KRXVH"RUZLOOWKHUHEHWKDWVSDFHWKHUHDQGWKHQEHEXLOGLQJDFURVVWKHURDGWKH\MXVWFXWWKURXJK",KRSHWKDWPDNHVVHQVH,ERXJKWP\KRXVHLQMXVWEHFDXVHLWEDFNHGXSWRWKHZRRGVDQGZHZRXOGKDYHDQLFHYLHZ, MXVWZDQWWREHVXUHWKH\DUHQRWEXLOGLQJGLUHFWO\EHKLQGP\KRXVHDQGREVWUXFWLQJP\YLHZ9.A.2.d Packet Pg. 364 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann $QVZHU1HZSDUFHOLV¶VRXWK$EXWWLQJXVHVXQFKDQJHGaRSHQVSDFHIROORZHGE\URDGZD\+2//<$9(9.A.2.d Packet Pg. 365 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann $QVZHU/RFDODQG6WDWHUHJXODWLRQVUHTXLUHUHPRYDORIH[RWLFYHJHWDWLRQ( LQIHVWDWLRQ( LQIHVWDWLRQ9.A.2.d Packet Pg. 366 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4XHVWLRQ7KH)OHLVFKPDQQSDUFHOLVKRPHWRQXPHURXVJRSKHUWRUWRLVHV0LQWR¶VSODQVDVVXEPLWWHGLQFOXGHDVWUXFWXUDOEDUULHUWRSUHYHQWPRYHPHQWRIWKHVHWRUWRLVHVLQWRDUHDVRIWKHSDUFHOWKH\LQWHQGIRUKRPHFRQVWUXFWLRQ%DVHGRQDUHYLHZRIWKRVHVXEPLVVLRQVLWLVXQFOHDUZKRZLOOEHUHVSRQVLEOHIRUDQ\RQJRLQJILQDQFLDOUHVSRQVLELOLWLHVIRUWKHPDLQWHQDQFHRIWKHVHEDUULHUV\VWHPVEXULHGFKDLQOLQNIHQFHVRUDQ\LQFUHPHQWDOH[SHQVHVVKRXOGWKHUHORFDWLRQSODQVSURYHLQDGHTXDWH,WZRXOGEHLGHDOLIWKHREOLJDWLRQVDUHFODULILHGLQWKHVXEPLVVLRQVWRWKH&RXQW\DQGDOVRUHIOHFWHGLQDPHQGPHQWVWRWKH+2$GRFXPHQWV9.A.2.d Packet Pg. 367 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann $QVZHUSURYLGHGE\3DVVDUHOODDQG$VVRFLDWHV%XULHGFKDLQOLQNIHQFHVKRXOGQRWUHTXLUHPDLQWHQDQFHSRVWFRQVWUXFWLRQ6WUXFWXUDOEDUULHUVDVVRFLDWHGZLWKJRSKHUWRUWRLVHSUHVHUYHVDW,&3DUHLQWHQGHGDVWHPSRUDU\IHDWXUHVWKDWDUHPDLQWDLQHGE\WKHGHYHORSHUWRDVVLVWZLWKWKHUHOHDVHSURFHVVLQWRWKHSUHVHUYHVDQGSUHYHQWWRUWRLVHVIURPHQWHULQJWKHFRQVWUXFWLRQVLWH,QDFFRUGDQFHZLWKFXUUHQWPDQDJHPHQWSUDFWLFHVWKH\VKRXOGEHYLHZHGDVVKRUWWHUPSURWHFWLRQPHDVXUHV9.A.2.d Packet Pg. 368 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4XHVWLRQ7KHHQYLURQPHQWUHYLHZDQGDVVRFLDWHGVXEPLVVLRQVPD\QHHGDGGLWLRQDOFODULILFDWLRQ:KLOHEDOGHDJOHDVVHVVPHQWVKDYHEHHQFRQGXFWHGIRUVHYHUDO\HDUVWKHµLQFRQFOXVLYH¶ILQGLQJVRIDHULDOUHYLHZVRIUHOHYDQWDGMDFHQWHDJOHQHVWLQJVLWHVVHHPVDWRGGVZLWKFXUUHQWUHVLGHQWREVHUYDWLRQVRIHDJOHVLQWKHSURSRVHGGHYHORSPHQWDUHD9.A.2.d Packet Pg. 369 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann $QVZHUSURYLGHGE\3DVVDUHOODDQG$VVRFLDWHV7KH)OHLVFKPDQQ3DUFHODQGSHULPHWHUKDYHEHHQWKRURXJKO\VXUYH\HGDQGGRQRWFRQWDLQDEDOGHDJOHQHVWLQJVLWH7KHDSSOLFDQWVVXEPLVVLRQVWRWKHFRXQW\LQFOXGHGDOOKLVWRULFDQGFXUUHQWUHFRUGVRIHDJOHWHUULWRULHVLQSUR[LPLW\WRWKH,VOHVRI&ROOLHUSURMHFWDSSUR[LPDWHO\DFUHVWKDWKDYHEHHQPRQLWRUHGIRUGHFDGHV6RPHRIWKHVHQHVWVDUHUHPRWHRUH[LVWRQSULYDWHSURSHUWLHVZHOORXWVLGHRIDQ\SURWHFWLRQEXIIHUWRWKHSURSRVHGDFWLYLW\6LQFHGHOLVWLQJWKHVWDWHQRORQJHUFRQGXFWVDQGUHSRUWVRQDHULDOVXUYH\VRIWKHVHUHPRWHORFDWLRQV7KHDSSOLFDQWLVQRWREOLJDWHGWRWU\DQGFROOHFWFXUUHQWLQIRUPDWLRQRQUHPRWHQHVWLQJVLWHVWKDWDUHQRWDIIHFWHGE\WKHSURSRVHGSURMHFW,QWKHVHLQVWDQFHVRQO\WKHKLVWRULFUHFRUGVUHPDLQDQGWKH\DUHUHSRUWHGRQDVXQGHWHUPLQHGLQWKHDQQXDOUHSRUWVSUHSDUHGE\WKHDSSOLFDQWVFRQVXOWDQW9.A.2.d Packet Pg. 370 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4XHVWLRQ7KHHQYLURQPHQWDOUHYLHZVXEPLVVLRQVDOVRGRQ¶WDSSHDUWRDGGUHVVZKHWKHU(DVWHUQ,QGLJRVQDNHVDOVRRFFXS\WKHJRSKHUWRUWRLVHGHQVRQWKHSDUFHO7KLVLVDFRPPRQSKHQRPHQRQ7KHJRSKHUWRUWRLVHGHQVVXSSRUWV\PELRWLFLQWHUGHSHQGHQFLHVZLWKGR]HQVRIRWKHUVSHFLHV(DVWHUQ,QGLJRVQDNHVDUHHQGDQJHUHGQRQYHQRPRXVVQDNHVWKDWKHOSWRFRQWURORWKHUVQDNHSRSXODWLRQV6RPHRIWKHVHVQDNHVDUHYHQRPRXVDQGGDQJHURXVWRKXPDQV$WPLQLPXPDQDVVHVVPHQWZKHWKHUWKHVH,QGLJRVQDNHVDUHSUHVHQWLQWKH)OHLVFKPDQQSDUFHOZRXOGDSSHDUZDUUDQWHG9.A.2.d Packet Pg. 371 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann $QVZHUSURYLGHGE\3DVVDUHOODDQG$VVRFLDWHV$OWKRXJKQRQHKDYHEHHQREVHUYHGHDVWHUQLQGLJRVQDNHVDVZHOODVRWKHUOLVWHGFRPPHQVDOVSHFLHVDUHSUHVXPHGSUHVHQWE\WKHSHUPLWWLQJDJHQFLHV6WDWHDQGIHGHUDOSHUPLWVZLOOUHTXLUHVWDQGDUGSURWHFWLRQSUHFDXWLRQVEHIROORZHGGXULQJFRQVWUXFWLRQDQGZKHQUHORFDWLQJJRSKHUWRUWRLVHV6XFKUHORFDWLRQVDUHFRQGXFWHGE\DXWKRUL]HGJRSKHUWRUWRLVHDJHQWV2YHUVHYHUDO\HDUVDQGVHYHUDOKXQGUHGJRSKHUWRUWRLVHUHORFDWLRQVFRQGXFWHGDW,VOHVRI&ROOLHUUDWWOHVQDNHVKDYHEHHQIRXQGDVFRPPHQVDOEXWQRHDVWHUQLQGLJR9.A.2.d Packet Pg. 372 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann &DUO$%DUUDFR3(%DUUDFRDQG$VVRFLDWHV,QFIRU7UHELOFRFN&RQVXOWLQJ6ROXWLRQV3$7&$9.A.2.d Packet Pg. 373 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4XHVWLRQ$UH\RXSUHVHQWLQJXSGDWHG UHYLVHG³7ULS*HQHUDWLRQ´WUDIILFFRXQWSHUWKH&RXQW\¶VUHTXHVW WKDWZRXOGEHVSHFLILFWRWKH)OHLVFKPDQQ3DUFHO"$QVZHU7KHWUDIILFLPSDFWVWDWHPHQW7,6ZDVSUHSDUHGLQDFFRUGDQFHZLWKFRXQW\JXLGHOLQHVDQGDPHQGHGVSHFLILFDOO\WRDGGUHVV6WDII VFRPPHQWVUHJDUGLQJWKHSURMHFW7KH%D\VKRUH 'ULYHVHJPHQWORFDWHGVRXWKRI7KRPDVVRQ'ULYHLVQRWD&ROOLHU&RXQW\PRQLWRUHGURDGZD\EXWLVDORFDOSXEOLFVWUHHW7RGHWHUPLQHWUDIILFEDFNJURXQGFRQGLWLRQVRQWKLVOLQN7&$WRRNDQDGGLWLRQDOVWHSDQGREWDLQHGWUDIILFFRXQWVLQ-DQXDU\RIWKLV\HDU7&$DOVRDQDO\]HGIXWXUH,VOHVRI&ROOLHUIND 6DEDO%D\WUDIILFRQ6%D\VKRUH 'U DVUHTXHVWHGE\WKHFRPPXQLW\DQGVWDII 9.A.2.d Packet Pg. 374 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4XHVWLRQ:RXOG\RXSOHDVHSUHVHQWD³7ULS*HQHUDWLRQ´FRXQWWKDWLQFOXGHVERWKWKDWRIWKH)OHLVFKPDQQSURSHUW\DQGWKHH[LVWLQJ6DEDO%D\SDUFHOWKDWOLHV:HVWRI6R%D\VKRUH 'U",WZRXOGKHOSIXODQGIDLUIRUHYHU\RQHWREHDZDUHRIWKHSURMHFWHGWRWDOQXPEHURIYHKLFOHVEHLQJJHQHUDWHGE\WKLVFRPELQDWLRQ9.A.2.d Packet Pg. 375 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann $QVZHU7KHPRVWUHFHQW7,6VXEPLWWHGIRUWKHSURMHFWGRHVLQFOXGHWKHEDFNJURXQGWUDIILFIURP6DEDO%D\WKDWZLOOEHRQ6%D\VKRUH 'UZKLFKKDVUHFHLYHGSULRU]RQLQJDSSURYDO7KHSHDNKRXUSHDNGLUHFWLRQYROXPHLVYSKIRU6DEDO%D\DWEXLOGRXW7KLVYDOXHLQFOXGHVDUHDVHDVWDQGZHVWRI6%D\VKRUH DQGSURYLGHVDFRQVHUYDWLYHWULSFRXQWKLJK6HSDUDWHO\WKH)OHLVFKPDQQSURSHUW\ZLOOKDYHDSHDNKRXUSHDNGLUHFWLRQYROXPHRIYSK7KHUHLVVXIILFLHQWFDSDFLW\RQ6%D\VKRUH WRDFFRPPRGDWHWKHIXWXUHJURZWKLQFOXGLQJ6DEDO%D\DQGWKHSURSRVHGSURMHFW9.A.2.d Packet Pg. 376 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4XHVWLRQ:RXOG\RXH[SODLQKRZ\RXDUULYHDWD³3HDN+RXU´YROXPHRIWUDIILFIRUDOX[XU\OLIHVW\OHFRPPXQLW\YVDVWDQGDUGPXOWLIDPLO\FRPPXQLW\"$QVZHU$VUHTXLUHGE\&ROOLHU&RXQW\WUDIILFJXLGHOLQHVDQGSURFHGXUHV7&$XVHWKHODWHVWYHUVLRQRIWKH,QVWLWXWHRI7UDQVSRUWDWLRQ(QJLQHHUV7ULS*HQHUDWLRQ0DQXDOWKHGLWLRQWKDWSURYLGHVSHDNKRXUWULSVGDWD7KH,7(ODQGXVHFRGHVGRQRWGLVWLQJXLVKOX[XU\YHUVXVVWDQGDUGLQWKHVLQJOHDQGPXOWLIDPLO\ODQGXVHFDWHJRULHVXVHGLQWKHSURMHFW VDQDO\VLV9.A.2.d Packet Pg. 377 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4XHVWLRQ:KHQWKHRULJLQDO6DEDO%D\FRPPXQLW\ZDVDSSURYHGE\WKH&RXQW\WKHEDVLVIRUWKHLQWHUQDOURDGOLQNIURPZKDWLVQRZ$QWLJXD:D\WR6R%D\VKRUH ZDVWRDOORZ,VOHUHVLGHQWV(DVWRI6R%D\VKRUHWRFURVVHDVLO\RYHUWRWKH,VOHFRPPXQLW\:HVWRI6R%D\VKRUHDQGFRQWLQXHWRWKH+DPLOWRQ+DUERU<DFKW&OXE7KHUHIRUHWKHSODQQHGURDGZD\H[LWLQJRXWWKH,VOH¶VRQWR+DPLOWRQ$YHFRPSOHWHVWKHRULJLQDOUHTXHVWIRUDFFHVVWRDQDWWUDFWLYHORFDODPHQLW\0\SRLQWKHUHLVWKDWUHVLGHQWVLQWKH%D\VKRUH DQG6R%D\VKRUHFRPPXQLW\ZHUHJLYHQWKHLPSUHVVLRQSHU6DEDO%D\WKDWWKHLQWHUQDOURDGOLQNZDVQRWLQWHQGHGWRSXWGDLO\WUDIILFIURPWKH,VOHVRQWR6R%D\VKRUH 'U7KHUHTXHVWIRUUH]RQLQJGRHVWKHRSSRVLWHLWWXUQV6R%D\VKRUH VSHFLILFDOO\LQWRD³FXWWKURXJK´VWUHHW:KDWYDOXHGRHVKDYLQJWKLVQHZWUDIILFEULQJWRWKHQHLJKERUKRRG"9.A.2.d Packet Pg. 378 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4XHVWLRQFRQWLQXHG7KLVLVLPSRUWDQWEHFDXVHWKHSURSRVHGUH]RQLQJDQGLWVDVVRFLDWHGWUDIILFQRZSXWVWKH%D\VKRUH DQG6R%D\VKRUHQHLJKERUKRRGTXDOLW\RIOLIHSURSHUW\YDOXHVUHFHQWLPSURYHPHQWVLQFULPHUHGXFWLRQSURSRVHGQHZFRPPXQLW\DVVHWVDQGVHQVHRISODFHLQTXHVWLRQ'R\RXWKLQNDXWRPRELOHVXVLQJ6R%D\VKRUH'UGXULQJDSHDNKRXULVDJRRGLGHD"7KLVQXPEHUGRHVQRWLQFOXGHH[LVWLQJW\SLFDOQHLJKERUKRRGWUDIILF9.A.2.d Packet Pg. 379 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann $QVZHU7KHRULJLQDO7,6IRU6DEDO%D\DQGFXUUHQWO\DSSURYHGDFFHVVSRLQWVDQWLFLSDWHGWULSVWRXWLOL]H%D\VKRUH 'U%D\VKRUH 'U&RUULGRUFRQQHFWLRQDFURVV%D\VKRUH 'U 9.A.2.d Packet Pg. 380 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4XHVWLRQ,IWKHUH]RQLQJUHTXHVWLVDSSURYHGDQGFRQVWUXFWLRQEHJLQVZLOOWKH,VOH¶VRQFHDJDLQXVH³:,'(/2$'´VHPLWUDLOHUWUXFNVWKDWPHDVXUH¶LQZLGWKRQ6R%D\VKRUH ZLWKURDGODQHVRI¶WRUHPRYHWUHHGHEULVIURPWKHLUZRUNLQJVLWH",IVRZLOOWKH,VOH¶VFRPPLWWRZRUNLQJZLWKWKH&RXQW\7UDQVSRUWDWLRQ5RDGV %ULGJHV'HSDUWPHQWWRGRFXPHQWWKHURDGVWDWXVRI6R%D\VKRUH'UEHIRUHDQGDIWHUVXFKXVHE\KHDY\WUDQVSRUWDWLRQHTXLSPHQW"$QVZHU0LQWRLVFRPPLWWHGWRZRUNZLWK&RXQW\6WDIIWRPLWLJDWHDQ\LPSDFWVWRWKHH[LVWLQJURDGZD\GXULQJFRQVWUXFWLRQ9.A.2.d Packet Pg. 381 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4XHVWLRQ,IDWDQ\SRLQWLQWLPHWKHGDLO\WUDIILFFRXQWJHQHUDWHGE\WKH,VOH¶VUHVLGHQWVRQ6R%D\VKRUH UHVXOWVLQDKLJKHUWULSJHQHUDWLRQWKDQH[SHFWHGRUDQXQPDQDJHDEOHWUDIILFFRQGLWLRQHYROYHV KRZZRXOGWKH,VOHFRPPXQLW\EHZLOOLQJWRKHOSWKH%D\VKRUH &5$DQGWKH&RXQW\WRUHVROYHWKHSUREOHP"$QVZHU7KHWULSFDSLVXVHGWRGHWHUPLQHQXPEHURIGZHOOLQJVWKDWFDQEHDSSURYHGE\SODWDQGRU6'3DQGLVEDVHGRQ,7(7KHUHLVQRPRQLWRULQJRIDFWXDOWULSV9.A.2.d Packet Pg. 382 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4XHVWLRQ:LOOWKH6R%D\VKRUH UHVLGHQWVHYHUEHH[SRVHGWRGDLO\FRQVWUXFWLRQWUDIILFGXULQJWKHVWDUWXSDQGFRPSOHWLRQRIHLWKHUWZRSURMHFWV )OHLVFKPDQQDQGWKHGZHOOLQJXQLW,VOHFRPPXQLW\:HVWRI6R%D\VKRUH 'U",IQRWSOHDVHH[SODLQKRZWKLVZLOOEHDFFRPSOLVKHG LI\HVSOHDVHH[SODLQDVZHOO 9.A.2.d Packet Pg. 383 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann $QVZHU0LQWRLVFRPPLWWHGWRPDQDJHPHQWRIFRQVWUXFWLRQWUDIILFDVORJLVWLFDOO\SRVVLEOH0LQWRGHYHORSLQJWKLVSURSHUW\LQVWHDGRIDVHSDUDWHLQGHSHQGHQWGHYHORSHUZKLFKZRXOGUHTXLUHRIFRQVWUXFWLRQWUDIILFWRXWLOL]H%D\VKRUH 'UWRDFFHVVWKHSURSHUW\KDVWKHDELOLW\WRLQWHUQDOL]HSRUWLRQVRIWKHFRQVWUXFWLRQWUDIILF0LQWRXWLOL]HVDVHOHFWJURXSRIYHQGRUVRQDOOKRPHVDQGSURYLGHVRQVLWHVWDJLQJDUHDVWRDVVLVWLQHIILFLHQF\RIFRQVWUXFWLRQZKLFKOLPLWVH[WHUQDOGDLO\WULSV7KHUHZLOOEHRYHUODSEHWZHHQGHYHORSPHQWDQGFRQVWUXFWLRQRIWKLVSDUFHOZKLOHVWLOOFRPSOHWLQJRWKHUSDUFHOVLQWHULRUWRWKH,VOHV7KLVZLOODOORZWUDGHWUDIILFWRLQWHUQDOL]HDQGWRPLQLPL]HXWLOL]DWLRQRIH[WHULRUURDGQHWZRUNWRDFFHVVWKHSURMHFW9.A.2.d Packet Pg. 384 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 0LNH(OJLQ'LUHFWRURI&RPPXQLW\'HYHORSPHQW0LQWR&RPPXQLWLHV 86$ 9.A.2.d Packet Pg. 385 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4XHVWLRQ:KDWZRXOGEHWKHLPSDFWRQXVHDQGFDSDFLW\RIH[LVWLQJDPHQLWLHVLIWKHVHXQLWVDUHDGGHGWRWKH38'"$OVRXVHDQGFDSDFLW\RIWKHH[LVWLQJ,&3HQWU\H[LWV",DPDVLQJOHIDPLO\KRPHRZQHULQ3KDVH,GRQRWZDQWPRUHWUDIILFRQWKHVWUHHWVRUDPHQLWLHV/HW¶VSUHVHUYHWKLVEHDXWLIXOSODFHDQGGRQRWDGGWRGHYHORSPHQW9.A.2.d Packet Pg. 386 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4XHVWLRQ7KHSURSRVHGH[SDQVLRQH[SDQGVWKHQXPEHURIUHVLGHQFHVZLWKRXWDQ\FRUUHVSRQGLQJLQFUHDVHLQFRPPXQLW\ZLGHDPHQLWLHV,IWKLVEHFRPHVWKHFDVHWKHVDPHDPHQLWLHVZLOOQHHGWRVXSSRUWPRUHUHVLGHQWVDQGFXUUHQWKRPHRZQHUVPD\UHVXOWDQWO\UHFHLYHSURSRUWLRQDOO\OHVVDFFHVVWRWKRVHDPHQLWLHVWKDQWKH\FXUUHQWO\HQMR\9.A.2.d Packet Pg. 387 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann $QVZHU75$)),&7KHDGGLWLRQDOSURSRVHGXQLWLPSDFWWRWKH+2$LQFRQMXQFWLRQZLWKWKHDGGLWLRQDODFFHVVSRLQWRQ%D\VKRUH 'UZLOOKDYHDQHJOLJLEOHHIIHFWRQDQ\WUDIILF$GHWDLOHG7UDIILF,PSDFW6WDWHPHQW7,6KDVEHHQGHYHORSHGDQGUHYLHZHGE\6WDIIDVSDUWRIWKHDSSOLFDWLRQSURFHVV$0(1,7,(67KHDPHQLWLHVDUHFRQVWDQWO\PRQLWRUHGIRUXVDJHDQGFDSDFLWLHVDVEXLOGRXWRIWKHFRPPXQLW\SURJUHVVHV8SRQGHWHUPLQDWLRQRIWKHILQDOXQLWVGHYHORSHGZLWKLQ,&3RUDVSDUWRIWKH)OHLVFKPDQQ3DUFHODFTXLVLWLRQ0LQWRZLOOHYDOXDWHWKHFDSDFLWLHVDQGWKHXVDJHRIWKHIDFLOLWLHVDWWKDWWLPH0LQWRKDVUHDIILUPHGWKHFRPPLWPHQWIRUWKH6DOHV&HQWHU3DUFHOWREHFRQYH\HGWRWKH+2$DVDQH[SDQVLRQRIWKH$PHQLW\VSDFHIRUWKH&RPPXQLW\WRVXSSOHPHQWWKHH[LVWLQJIDFLOLWLHV9.A.2.d Packet Pg. 388 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann $QVZHU'LVFRYHU\&HQWHU3ODWWHG± ,VOHVRI&ROOLHU3UHVHUYH3KDVH7UDFW$$FUHV'HGLFDWHWRWKH+2$9.A.2.d Packet Pg. 389 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4XHVWLRQ7KHSURSRVHGH[SDQVLRQRIWKH,&3038'VHHPVWRFRQYH\PRVWRIWKHEHQHILWVRIWKHGHYHORSHU0LQWR:KHQGHYHORSPHQWLVFRPSOHWHSRVVLEOHH[SHQVHVDVVRFLDWHGZLWKWKHSURSRVHGH[SDQVLRQPD\EHFRPHWKHUHVSRQVLELOLW\IRUWKHFROOHFWLYHKRPHRZQHUV6LQFHLWVSRVVLEOHVRPHRIWKRVHH[SHQVHVPD\IDOOWRFXUUHQWQRQ)OHLVFKPDQQSDUFHOUHVLGHQWVWKLVPD\DIIHFWWKHVHQRQ)OHLVFKPDQQSDUFHOKRPHRZQHUV\HWWKHEHQHILWVRIWKHSURSRVHGH[SDQVLRQODUJHO\DSSHDUWREHQHILWWKHGHYHORSHUDQGWKHIXWXUH)OHLVFKPDQQSDUFHOKRPHRZQHUV,IWUXHWKLVZRXOGQRWEHVRPHWKLQJFXUUHQWUHVLGHQWVZRXOGUHDVRQDEO\KDYHH[SHFWHGZKHQWKH\SXUFKDVHGWKHLUKRPHV9.A.2.d Packet Pg. 390 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann $QVZHU7KH&RQFHSWXDO/DQG3ODQGRHVQRWSURYLGHIRUDQ\GLVSURSRUWLRQDWHDGGLWLRQVWRWKH+2$EXGJHW$GGLWLRQDODUHDVGHYHORSHGDVSDUWRIWKH)OHLVFKPDQQSDUFHOZLOOEHIXQGHGWKURXJKWKHSURSRUWLRQDODVVHVVPHQWRIWKHQHZXQLWV%\ZD\RIH[DPSOH$Q\FRVWDVVRFLDWHGZLWKLQWHUQDOURDGVVHUYLFLQJQHZXQLWVZLOOEHSURSRUWLRQDOO\IXQGHGE\WKRVHXQLWV&RPPRQ$UHDFRVWVWRH[LVWLQJ,&3UHVLGHQWVZRXOGKDYHDQHWEHQHILW%\H[DPSOH0DLQWHQDQFHDQGRSHUDWLRQRIWKHIXWXUHURDGZD\VDQGJDWHVWRDFFHVV3DUFHO7ZRXOGEHGLYLGHGE\WKHFXUUHQW+2$EXLOGRXWRI7KHFRPPRQFRVWVDVVRFLDWHGZLWKWKHVDPHURDGZD\DQGJDWHFRVWVDUHQRZGLYLGHGE\ZLWKWKHDGGLWLRQRIWKLVSDUFHO9.A.2.d Packet Pg. 391 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4XHVWLRQ7KHFXUUHQW,VOHVFRPPXQLW\ZLWKRXWWKH)OHLVFKPDQQSDUFHODGGLWLRQLVRXWVLGHRIWKHVSHFLDOWD[LQJGLVWULFWDVVRFLDWHGZLWKWKH%D\VKRUH 5HGHYHORSPHQWGLVWULFWZKHUHDVWKHSURSRVHGH[SDQVLRQOLHVLQVLGHWKLVVSHFLDOWD[LQJGLVWULFW([SDQGLQJWKLVWD[LQJDXWKRULW\WRWKHHQWLUH,VOHVRI6DEDO%D\038'LQFOXVLYHRIWKHSURSRVHGH[SDQVLRQFRXOGSRWHQWLDOO\VXEMHFWFXUUHQWKRPHRZQHUVWRDQHZDQGXQZHOFRPHDGGLWLRQDOILQDQFLDOREOLJDWLRQ9.A.2.d Packet Pg. 392 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4XHVWLRQ7KHGHYHORSHUVXEPLVVLRQVVXJJHVWRQJRLQJFRPPLWPHQWVIRUWUDIILFUHODWHGLPSURYHPHQWVLQFRRUGLQDWLRQZLWKWKH%D\VKRUH &5$DQGWKH0678,W¶VXQFOHDUZKHWKHUDQ\RIWKRVHH[SHQVHVZRXOGEHWKHUHVSRQVLELOLW\RIFXUUHQWQRQ)OHLVFKPDQQSDUFHOSURSHUW\RZQHUV$PRUHHTXLWDEOHDSSURDFKFRXOGEHIRUDVVLJQPHQWRIWKHVHWUDIILFUHODWHGH[SHQVHVWRWKHUHVLGHQWVRIWKH)OHLVKPDQQSDUFHO0LQWRRUERWKEXWQRWFXUUHQW,VOHVRI&ROOLHU3UHVHUYHUHVLGHQWVZKRDUHQRWSDUWRIWKHSURSRVHG)OHLVFKPDQQSDUFHO9.A.2.d Packet Pg. 393 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann $QVZHU$SRUWLRQRIWKHDFTXLVLWLRQSDUFHOLVZLWKLQWKHERXQGDU\IRUWKH&5$7KHUH]RQLQJHIIRUWSURYLGHVQRDGGLWLRQDOFRPPLWPHQWWREULQJH[LVWLQJUHVLGHQFHVZLWKLQWKH038'LQWRDVSHFLDOWD[LQJGLVWULFWWKDWZDVDOUHDG\HVWDEOLVKHG7KHWUDIILFUHODWHGFRPPLWPHQWVDUHGHYHORSHUIXQGHGLPSURYHPHQWVDVSDUWRIWKHGHYHORSPHQWRIWKHSDUFHOLHLPSDFWIHHSD\PHQWVWUDIILFLPSURYHPHQWVLQFOXGLQJWXUQODQHVH[LVWLQJWXUQODQHH[SDQVLRQDVH[DPSOHVDQGDUHWKHILQDQFLDOUHVSRQVLELOLW\RIWKHGHYHORSHU9.A.2.d Packet Pg. 394 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann dZ&&//DWd^ddDEd 9.A.2.d Packet Pg. 395 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Ȃ ȋȌ ŽůůŝĞƌŽƵŶƚǇ͕&> ϬϯͬϭϴͬϮϬϮϬ WƌĞƉĂƌĞĚĨŽƌ͗WƌĞƉĂƌĞĚďǇ͗ DŝŶƚŽŽŵŵƵŶŝƚŝĞƐͲh^ ϰϮϴϬdĂŵŝĂŵŝdƌĂŝůĂƐƚ͕^ƵŝƚĞϮϬϯͬϮϬϰ EĂƉůĞƐ͕&>ϯϰϭϭϮ WŚŽŶĞ͗Ϯϯϵ͘ϴϵϲ͘ϭϰϬϮ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕W ϮϴϬϬĂǀŝƐŽƵůĞǀĂƌĚ͕^ƵŝƚĞϮϬϬ EĂƉůĞƐ͕&>ϯϰϭϬϰ WŚŽŶĞ͗Ϯϯϵ͘ϱϲϲ͘ϵϱϱϭ ŵĂŝů͗ŶƚƌĞďŝůĐŽĐŬΛƚƌĞďŝůĐŽĐŬ͘ďŝǌ ŽůůŝĞƌŽƵŶƚǇdƌĂŶƐƉŽƌƚĂƚŝŽŶDĞƚŚŽĚŽůŽŐǇ&ĞĞʹΨϱϬϬ͘ϬϬ ŽůůŝĞƌŽƵŶƚǇdƌĂŶƐƉŽƌƚĂƚŝŽŶZĞǀŝĞǁ&ĞĞʹDĂũŽƌ^ƚƵĚǇʹΨϭ͕ϱϬϬ͘ϬϬ&ĞĞ 9.A.2.d Packet Pg. 396 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϮ /ĐĞƌƚŝĨǇƚŚĂƚƚŚŝƐdƌĂĨĨŝĐ/ŵƉĂĐƚ^ƚĂƚĞŵĞŶƚŚĂƐďĞĞŶƉƌĞƉĂƌĞĚďǇŵĞŽƌƵŶĚĞƌŵǇŝŵŵĞĚŝĂƚĞƐƵƉĞƌǀŝƐŝŽŶ ĂŶĚƚŚĂƚ/ŚĂǀĞĞǆƉĞƌŝĞŶĐĞĂŶĚƚƌĂŝŶŝŶŐŝŶƚŚĞĨŝĞůĚŽĨdƌĂĨĨŝĐĂŶĚdƌĂŶƐƉŽƌƚĂƚŝŽŶŶŐŝŶĞĞƌŝŶŐ͘ EŽƌŵĂŶ:͘dƌĞďŝůĐŽĐŬ͕/W͕W͘͘ &>ZĞŐŝƐƚƌĂƚŝŽŶEŽ͘ϰϳϭϭϲ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕W ϮϴϬϬĂǀŝƐŽƵůĞǀĂƌĚ͕^ƵŝƚĞϮϬϬ EĂƉůĞƐ͕&>ϯϰϭϬϰ ŽŵƉĂŶǇĞƌƚ͘ŽĨƵƚŚ͘EŽ͘Ϯϳϳϵϲ 7KLVLWHPKDVEHHQHOHFWURQLFDOO\VLJQHGDQGVHDOHG E\1RUPDQ-7UHELOFRFN$,&33( 6WDWHRI)ORULGD OLFHQVH XVLQJ D SHA-1 DXWKHQWLFDWLRQFRGH 3ULQWHGFRSLHVRIWKLVGRFXPHQWDUHQRWFRQVLGHUHG VLJQHGDQGVHDOHGDQGWKHSHA-1 DXWKHQWLFDWLRQ FRGHPXVWEHYHULILHGRQDQ\HOHFWURQLFFRSLHV Digitally signed by Norman Trebilcock DN: c=US, st=Florida, l=Naples, o=Trebilcock Consulting Solutions, PA, cn=Norman Trebilcock, email=ntrebilcock@trebilcock.biz Date: 2020.03.18 16:41:20 -04'00' 9.A.2.d Packet Pg. 397 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϯ Table of Contents WƌŽũĞĐƚĞƐĐƌŝƉƚŝŽŶ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰ dƌŝƉ'ĞŶĞƌĂƚŝŽŶ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϱ dƌŝƉŝƐƚƌŝďƵƚŝŽŶĂŶĚƐƐŝŐŶŵĞŶƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϳ ĂĐŬŐƌŽƵŶĚdƌĂĨĨŝĐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϭ ǆŝƐƚŝŶŐĂŶĚ&ƵƚƵƌĞZŽĂĚǁĂǇEĞƚǁŽƌŬ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϮ WƌŽũĞĐƚ/ŵƉĂĐƚƐƚŽƌĞĂZŽĂĚǁĂǇEĞƚǁŽƌŬ>ŝŶŬŶĂůǇƐŝƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϯ ^ŝƚĞĐĐĞƐƐdƵƌŶ>ĂŶĞŶĂůǇƐŝƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϱ /ŵƉƌŽǀĞŵĞŶƚŶĂůǇƐŝƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϲ DŝƚŝŐĂƚŝŽŶŽĨ/ŵƉĂĐƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϲ ƉƉĞŶĚŝĐĞƐ ƉƉĞŶĚŝǆ͗WƌŽũĞĐƚDĂƐƚĞƌ^ŝƚĞWůĂŶ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϳ ƉƉĞŶĚŝǆ͗/ŶŝƚŝĂůDĞĞƚŝŶŐŚĞĐŬůŝƐƚ;DĞƚŚŽĚŽůŽŐǇDĞĞƚŝŶŐͿ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϵ ƉƉĞŶĚŝǆ͗dƌŝƉ'ĞŶĞƌĂƚŝŽŶĂůĐƵůĂƚŝŽŶƐ/dϭϬ ƚŚĚŝƚŝŽŶ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘Ϯϱ ƉƉĞŶĚŝǆ͗dƌĂĨĨŝĐŽƵŶƚǆŚŝďŝƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϭ ƉƉĞŶĚŝǆ͗WƌŽũĞĐƚdƵƌŶŝŶŐDŽǀĞŵĞŶƚƐǆŚŝďŝƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϰ 9.A.2.d Packet Pg. 398 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϰ Project Description dŚĞ/ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞͲ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůƉƌŽũĞĐƚŝƐĂƉƌŽƉŽƐĞĚƌĞƐŝĚĞŶƚŝĂůĚĞǀĞůŽƉŵĞŶƚůŽĐĂƚĞĚ ĞĂƐƚŽĨĂǇƐŚŽƌĞƌŝǀĞĂŶĚƐŽƵƚŚŽĨdŚŽŵĂƐƐŽŶƌŝǀĞŝŶ^ĞĐƚŝŽŶϮϯͬϮϲ͕dŽǁŶƐŚŝƉϱϬ^ŽƵƚŚ͕ZĂŶŐĞϮϱĂƐƚ͕ ŝŶŽůůŝĞƌŽƵŶƚǇ&ůŽƌŝĚĂ;ƌĞĨ͘&ŝŐƵƌĞϭʹ/ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞ>ŽĐĂƚŝŽŶDĂƉͿ͘ &ŝŐƵƌĞϭʹ/ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞ>ŽĐĂƚŝŽŶDĂƉ dŚĞ/ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞͲ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞů;&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůͿWhƉƌŽũĞĐƚŝƐƉƌŽƉŽƐĞĚƚŽďĞ ĐŽŵďŝŶĞĚǁŝƚŚƚŚĞĞǆŝƐƚŝŶŐĂƉƉƌŽǀĞĚ^ĂďůĞĂǇDŝǆĞĚͲƵƐĞWůĂŶŶĞĚhŶŝƚĞǀĞůŽƉŵĞŶƚ;DWhͿ͕ƉƵƌƐƵĂŶƚ ƚŽŽůůŝĞƌŽƵŶƚǇKƌĚŝŶĂŶĐĞEŽ͘ϮϬϭϮͲϭϮ͕ĂƐŵĂǇďĞĂŵĞŶĚĞĚ͘dŚĞ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůƐŝƚĞŝƐĐŽŵƉƌŝƐĞĚ ŽĨŵƵůƚŝƉůĞƉĂƌĐĞůƐǁŚŝĐŚĂƌĞĐƵƌƌĞŶƚůǇǀĂĐĂŶƚĂŶĚǌŽŶĞĚĂŐƌŝĐƵůƚƵƌĂů;Ϳ͕ĂŐƌŝĐƵůƚƵƌĂůͲƐƉĞĐŝĂůƚƌĞĂƚŵĞŶƚ ŽǀĞƌůĂǇ;Ͳ^dͿĂŶĚƌĞƐŝĚĞŶƚŝĂůƐŝŶŐůĞͲĨĂŵŝůǇZ^&Ͳϯ͕ĂƐĂƉƉůŝĐĂďůĞ͘ dŚĞ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůƉƌŽũĞĐƚƉƌŽƉŽƐĞƐƚŽĂůůŽǁƚŚĞĚĞǀĞůŽƉŵĞŶƚŽĨϵϬƐŝŶŐůĞĨĂŵŝůǇĚĞƚĂĐŚĞĚĚǁĞůůŝŶŐ ƵŶŝƚƐĂŶĚϭϰϬŵƵůƚŝĨĂŵŝůǇĚǁĞůůŝŶŐƵŶŝƚƐ͘ dŚĞ ƉƌŽƉŽƐĞĚ WůĂŶŶĞĚ hŶŝƚ ĞǀĞůŽƉŵĞŶƚ ŵĞŶĚŵĞŶƚ ;WhͿ ŵĂƐƚĞƌ ƐŝƚĞ ƉůĂŶ ŝƐ ŝůůƵƐƚƌĂƚĞĚ ŝŶ ƉƉĞŶĚŝǆ͗WƌŽũĞĐƚDĂƐƚĞƌ^ŝƚĞWůĂŶ͘ &ŽƌƉƵƌƉŽƐĞƐŽĨƚŚŝƐĞǀĂůƵĂƚŝŽŶ͕ƚŚĞƉƌŽũĞĐƚďƵŝůĚͲŽƵƚǇĞĂƌŝƐĂƐƐƵŵĞĚƚŽďĞĐŽŶƐŝƐƚĞŶƚǁŝƚŚƚŚĞŽůůŝĞƌ ŽƵŶƚǇϮϬϮϱƉůĂŶŶŝŶŐŚŽƌŝǌŽŶ͘ dŚĞƉƌŽũĞĐƚƉƌŽǀŝĚĞƐĂŚŝŐŚĞƐƚĂŶĚďĞƐƚƵƐĞƐĐĞŶĂƌŝŽǁŝƚŚƌĞƐƉĞĐƚ ƚŽ ƚŚĞ ƉƌŽũĞĐƚ͛Ɛ ƉƌŽƉŽƐĞĚ ƚƌŝƉ ŐĞŶĞƌĂƚŝŽŶ͘dŚĞĂƐƐŽĐŝĂƚĞĚĐŽŵŵŽŶƌĞĐƌĞĂƚŝŽŶĂŵĞŶŝƚŝĞƐĂƌĞĐŽŶƐŝĚĞƌĞĚƉĂƐƐŝǀĞŝŶĐŝĚĞŶƚĂůƚŽƌĞƐŝĚĞŶƚŝĂů ůĂŶĚƵƐĞ͕ĂŶĚĂƌĞŶŽƚŝŶĐůƵĚĞĚŝŶƚŚĞƚƌŝƉŐĞŶĞƌĂƚŝŽŶĂŶĂůǇƐŝƐ͘dŚĞƉƌŽƉŽƐĞĚĚĞǀĞůŽƉŵĞŶƚƉƌŽŐƌĂŵŝƐ ŝůůƵƐƚƌĂƚĞĚŝŶdĂďůĞϭ͘ 9.A.2.d Packet Pg. 399 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϱ dĂďůĞϭ ĞǀĞůŽƉŵĞŶƚWƌŽŐƌĂŵ ĞǀĞůŽƉŵĞŶƚ /d>ĂŶĚhƐĞ΀^/ŽĚĞƐŝŶƌĂĐŬĞƚƐ΁ /d>ĂŶĚhƐĞ ŽĚĞdŽƚĂů^ŝǌĞ ǆŝƐƚŝŶŐ^ĂďůĞĂǇ DWh ^ŝŶŐůĞͲ&ĂŵŝůǇĞƚĂĐŚĞĚ,ŽƵƐŝŶŐ΀EŽƚ ƉƉůŝĐĂďůĞ΁ϮϭϬϭ͕ϯϮϳĚǁĞůůŝŶŐƵŶŝƚƐ ǆŝƐƚŝŶŐ^ĂďůĞĂǇ DWh DƵůƚŝĨĂŵŝůǇ,ŽƵƐŝŶŐ;>ŽǁͲZŝƐĞͿ΀EŽƚ ƉƉůŝĐĂďůĞ΁ϮϮϬ ϲϳϮĚǁĞůůŝŶŐƵŶŝƚƐ ǆŝƐƚŝŶŐ^ĂďůĞĂǇ DWh,ŽƚĞů;ϳϬϭϭͿϯϭϬϭϬϬŽĐĐƵƉŝĞĚƌŽŽŵƐ ǆŝƐƚŝŶŐ^ĂďůĞĂǇ DWh 'ĞŶĞƌĂůKĨĨŝĐĞ΀ϳϯϭϭ͕ϳϯϳϭͲϳϯϳϵ͕ϳϯϴϰ͕ϴϳϭϭͲ ϴϳϰϴ͕ϲϯϭϭͲϲϯϵϵ͕ϲϰϭϭ͕ϴϭϭϭ͕ϴϳϰϭͲϴϳϰϯ͕ ϴϳϰϴ͕ϴϲϭϭͲϴϲϵϵ͕ϵϭϭϭͲϵϭϵϵ͕ϵϯϭϭ͕ϵϰϭϭͲ ϵϰϱϭ͕ϵϱϭϭͲϵϱϲϮ͕ϵϲϭϭͲϵϲϲϭ͕ϲϱϭϮ͕ϲϱϯϭͲ ϲϱϰϭ͕ϲϮϭϭͲϲϮϴϵ΁ ϳϭϬ ϰϴ͕ϬϬϬƐƋƵĂƌĞĨĞĞƚ ǆŝƐƚŝŶŐ^ĂďůĞĂǇ DWh ^ŚŽƉƉŝŶŐĞŶƚĞƌ;ĂůůWhƉƌŝŶĐŝƉĂůƵƐĞƐ ƉŽƐƐŝďůĞʹƚǇƉŝĐĂůĨŽƌĂƐŚŽƉƉŝŶŐĐĞŶƚĞƌʹĂƐ ĂŶŝŶůŝŶĞͬŽƵƚƉĂƌĐĞůƵƐĞͿ ϴϮϬϭϳϲ͕ϭϵϵƐƋƵĂƌĞĨĞĞƚ WƌŽƉŽƐĞĚ&ůĞŝƐĐŚŵĂŶŶ WĂƌĐĞůWh ^ŝŶŐůĞͲ&ĂŵŝůǇĞƚĂĐŚĞĚ,ŽƵƐŝŶŐ΀EŽƚ ƉƉůŝĐĂďůĞ΁ϮϭϬ ϵϬĚǁĞůůŝŶŐƵŶŝƚƐ WƌŽƉŽƐĞĚ&ůĞŝƐĐŚŵĂŶŶ WĂƌĐĞůWh DƵůƚŝĨĂŵŝůǇ,ŽƵƐŝŶŐ;>ŽǁͲZŝƐĞͿ΀EŽƚ ƉƉůŝĐĂďůĞ΁ϮϮϬϭϰϬĚǁĞůůŝŶŐƵŶŝƚƐ ŵĞƚŚŽĚŽůŽŐǇŵĞĞƚŝŶŐǁĂƐŚĞůĚǁŝƚŚƚŚĞŽůůŝĞƌŽƵŶƚǇdƌĂŶƐƉŽƌƚĂƚŝŽŶWůĂŶŶŝŶŐƐƚĂĨĨŽŶEŽǀĞŵďĞƌϭ͕ ϮϬϭϵ͕ǀŝĂĞŵĂŝů;ƌĞĨĞƌƚŽƉƉĞŶĚŝǆ͗/ŶŝƚŝĂůDĞĞƚŝŶŐŚĞĐŬůŝƐƚͿ͘/ŶĂĚĚŝƚŝŽŶ͕ĂƌĞǀŝƐĞĚŵĞƚŚŽĚŽůŽŐǇƌĞƉŽƌƚ ǁĂƐƉƌŽĚƵĐĞĚŽŶEŽǀĞŵďĞƌϳ͕ϮϬϭϵďĂƐĞĚŽŶŽůůŝĞƌŽƵŶƚǇ^ƚĂĨĨƌĞǀŝĞǁĐŽŵŵĞŶƚƐ͘ dŚĞ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůWhƉƌŽũĞĐƚƉƌŽƉŽƐĞƐĂĨƵůůŵŽǀĞŵĞŶƚĐŽŶŶĞĐƚŝŽŶƚŽĂǇƐŚŽƌĞƌŝǀĞǀŝĂĂŶĞǁ ŝŶƚĞƌŶĂůƌŽĂĚǁĂǇ͘/ŶĂĚĚŝƚŝŽŶ͕ƚŚĞƉƌŽũĞĐƚǁŝůůƵƚŝůŝǌĞĞǆŝƐƚŝŶŐŝŶƚĞƌŶĂůƌŽĂĚǁĂǇƐǁŝƚŚŝŶƚŚĞďŽƵŶĚĂƌŝĞƐŽĨ ƚŚĞ^ĂďůĞĂǇWhƚŽĐŽŶŶĞĐƚƚŽdŚŽŵĂƐƐŽŶƌŝǀĞĂƚƚŚĞĞǆŝƐƚŝŶŐĨƵůůŵŽǀĞŵĞŶƚĂĐĐĞƐƐ͘ Trip Generation dŚĞ ƉƌŽũĞĐƚ͛Ɛ ƐŝƚĞ ƚƌŝƉ ŐĞŶĞƌĂƚŝŽŶ ŝƐ ďĂƐĞĚ ŽŶ ƚŚĞ /ŶƐƚŝƚƵƚĞ ŽĨ dƌĂŶƐƉŽƌƚĂƚŝŽŶ ŶŐŝŶĞĞƌƐ ;/dͿ dƌŝƉ 'ĞŶĞƌĂƚŝŽŶDĂŶƵĂů͕ϭϬ ƚŚĚŝƚŝŽŶ͘dŚĞƐŽĨƚǁĂƌĞƉƌŽŐƌĂŵKd/^^;KŶůŝŶĞdƌĂĨĨŝĐ/ŵƉĂĐƚ^ƚƵĚǇ^ŽĨƚǁĂƌĞ͕ŵŽƐƚ ĐƵƌƌĞŶƚǀĞƌƐŝŽŶͿŝƐƵƐĞĚƚŽĐƌĞĂƚĞƚŚĞƌĂǁƵŶĂĚũƵƐƚĞĚƚƌŝƉŐĞŶĞƌĂƚŝŽŶĨŽƌƚŚĞƉƌŽũĞĐƚ͘dŚĞ/dĞƋƵĂƚŝŽŶƐ ĂƌĞƵƐĞĚĨŽƌƚŚĞƚƌŝƉŐĞŶĞƌĂƚŝŽŶĐĂůĐƵůĂƚŝŽŶƐ͘dŚĞ/dʹKd/^^ƚƌŝƉŐĞŶĞƌĂƚŝŽŶĐĂůĐƵůĂƚŝŽŶǁŽƌŬƐŚĞĞƚƐĂƌĞ ƉƌŽǀŝĚĞĚŝŶƉƉĞŶĚŝǆ͗dƌŝƉ'ĞŶĞƌĂƚŝŽŶĂůĐƵůĂƚŝŽŶƐ/dϭϬƚŚĚŝƚŝŽŶ͘ dŚĞŝŶƚĞƌŶĂůĐĂƉƚƵƌĞĂĐĐŽƵŶƚƐĨŽƌĂƌĞĚƵĐƚŝŽŶŝŶĞǆƚĞƌŶĂůƚƌĂĨĨŝĐďĞĐĂƵƐĞŽĨƚŚĞŝŶƚĞƌĂĐƚŝŽŶďĞƚǁĞĞŶƚŚĞ ŵƵůƚŝƉůĞůĂŶĚƵƐĞƐŝŶĂƐŝƚĞ͘WĞƌŽůůŝĞƌŽƵŶƚǇd/^'ƵŝĚĞůŝŶĞƐĂŶĚWƌŽĐĞĚƵƌĞƐ͕ƚŚĞŝŶƚĞƌŶĂůĐĂƉƚƵƌĞƚƌŝƉƐ ƐŚŽƵůĚďĞƌĞĂƐŽŶĂďůĞĂŶĚƐŚŽƵůĚŶŽƚĞǆĐĞĞĚϮϬйŽĨƚŚĞƚŽƚĂůƉƌŽũĞĐƚƚƌŝƉƐ͘dŚĞƌĞƐƵůƚŝŶŐŝŶƚĞƌŶĂůĐĂƉƚƵƌĞ ƌĂƚĞƐĂƌĞďĞůŽǁƚŚĞĐŽƵŶƚǇůŝŵŝƚƐ͘ 9.A.2.d Packet Pg. 400 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϲ dŚĞƉĂƐƐͲďǇƚƌŝƉƐĂĐĐŽƵŶƚĨŽƌƚƌĂĨĨŝĐƚŚĂƚŝƐĂůƌĞĂĚǇŽŶƚŚĞĞǆƚĞƌŶĂůƌŽĂĚǁĂǇŶĞƚǁŽƌŬĂŶĚƐƚŽƉƐĂƚƚŚĞ ƉƌŽũĞĐƚŽŶƚŚĞǁĂǇƚŽĂƉƌŝŵĂƌǇƚƌŝƉĚĞƐƚŝŶĂƚŝŽŶ͘/ƚƐŚŽƵůĚďĞŶŽƚĞĚƚŚĂƚƚŚĞĚƌŝǀĞǁĂǇǀŽůƵŵĞƐĂƌĞŶŽƚ ƌĞĚƵĐĞĚĂƐĂƌĞƐƵůƚŽĨƚŚĞƉĂƐƐͲďǇƌĞĚƵĐƚŝŽŶ͕ŽŶůǇƚŚĞƚƌĂĨĨŝĐĂĚĚĞĚƚŽƚŚĞƐƵƌƌŽƵŶĚŝŶŐƐƚƌĞĞƚƐĂŶĚ ŝŶƚĞƌƐĞĐƚŝŽŶƐ͘ƐƐƵĐŚ͕ƉĂƐƐͲďǇƚƌŝƉƐĂƌĞŶŽƚĚĞĚƵĐƚĞĚĨŽƌŽƉĞƌĂƚŝŽŶĂůͲĂĐĐĞƐƐĂŶĂůǇƐŝƐ;ĂůůĞǆƚĞƌŶĂůƚƌĂĨĨŝĐ ŝƐĂĐĐŽƵŶƚĞĚĨŽƌͿ͘ ŽŶƐŝƐƚĞŶƚǁŝƚŚŽůůŝĞƌŽƵŶƚǇd/^'ƵŝĚĞůŝŶĞƐĂŶĚWƌŽĐĞĚƵƌĞƐ͕ƐŚŽƉƉŝŶŐĐĞŶƚĞƌƉĂƐƐͲďǇƌĂƚĞƐƐŚŽƵůĚŶŽƚ ĞǆĐĞĞĚϮϱйĨŽƌƚŚĞƉĞĂŬŚŽƵƌĂŶĚƚŚĞĚĂŝůǇĐĂƉƚƵƌĞƌĂƚĞƐĂƌĞĂƐƐƵŵĞĚϭϬйůŽǁĞƌƚŚĂŶƚŚĞƉĞĂŬŚŽƵƌ ĐĂƉƚƵƌĞƌĂƚĞ͘dŚŝƐĂŶĂůǇƐŝƐĐĂůĐƵůĂƚĞƐ^ŚŽƉƉŝŶŐĞŶƚĞƌ>hϴϮϬƉĂƐƐͲďǇĚĂŝůǇƌĂƚĞƐĂƚϭϱйĂŶĚDĂŶĚWD ƉĞĂŬŚŽƵƌƌĂƚĞƐĂƚϮϱй͘ dŚĞƚƌŝƉŐĞŶĞƌĂƚŝŽŶĨŽƌƚŚĞĂƉƉƌŽǀĞĚ^ĂďůĞĂǇDWhŝƐŝůůƵƐƚƌĂƚĞĚŝŶdĂďůĞϮ͕ĂŶĚƚŚĞƉƌŽũĞĐƚĞĚƚƌŝƉ ŐĞŶĞƌĂƚŝŽŶĂƐƐŽĐŝĂƚĞĚǁŝƚŚƚŚĞƉƌŽƉŽƐĞĚ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůWhĐŽŶĚŝƚŝŽŶƐŝƐŝůůƵƐƚƌĂƚĞĚŝŶdĂďůĞϮ͘ dĂďůĞϮ dƌŝƉ'ĞŶĞƌĂƚŝŽŶ;^ĂďůĞĂǇDWhƵŝůĚŽƵƚŽŶĚŝƚŝŽŶƐͿʹǀĞƌĂŐĞtĞĞŬĚĂǇ ƉƉƌŽǀĞĚDWhĞǀĞůŽƉŵĞŶƚϮϰ,ŽƵƌ dǁŽͲ tĂǇ sŽůƵŵĞ DWĞĂŬ,ŽƵƌWDWĞĂŬ,ŽƵƌ >ĂŶĚhƐĞ^ŝǌĞŶƚĞƌǆŝƚdŽƚĂůŶƚĞƌǆŝƚdŽƚĂů ^ŝŶŐůĞͲ&ĂŵŝůǇĞƚĂĐŚĞĚϭ͕ϯϮϳĚƵ;ϭͿϭϭ͕ϮϮϬϮϯϳϳϭϬϵϰϳϳϲϲϰϱϬϭ͕Ϯϭϲ DƵůƚŝĨĂŵŝůǇ,ŽƵƐŝŶŐ;DŝĚͲZŝƐĞͿϲϳϮĚƵ;ϭͿϰ͕ϵϭϵϲϳϮϮϰϮϵϭϮϬϯϭϭϵϯϮϮ ,ŽƚĞůϭϬϬŽƌ;ϮͿϭ͕ϮϮϯϯϲϮϲϲϮϯϲϯϳϳϯ 'ĞŶĞƌĂůKĨĨŝĐĞϰϴ͕ϬϬϬƐĨ;ϯͿϱϮϭϲϮϭϬϳϮϵϰϴϱϳ ^ŚŽƉƉŝŶŐĞŶƚĞƌϭϳϲ͕ϭϵϵƐĨ;ϯͿϴ͕ϴϯϳϭϰϵϵϭϮϰϬϯϵϲϰϯϬϴϮϲ dŽƚĂůǆƚĞƌŶĂůϮϲ͕ϳϮϬϱϱϭϭ͕Ϭϲϭϭ͕ϲϭϮϭ͕ϰϭϬϭ͕ϬϴϰϮ͕ϰϵϰ /ŶƚĞƌŶĂůĂƉƚƵƌĞϴϳϬϯϬϯϬϲϬϭϳϬϭϳϬϯϰϬ EĞƚǆƚĞƌŶĂůϮϱ͕ϴϱϬϱϮϭϭ͕Ϭϯϭϭ͕ϱϱϮϭ͕ϮϰϬϵϭϰϮ͕ϭϱϰ WĂƐƐͲďǇϭ͕ϮϲϰϯϯϮϭϱϰϴϳϴϭϭϲϴ EĞƚǆƚĞƌŶĂů;EŽŶͲWĂƐƐͲďǇͿϮϰ͕ϱϴϲϰϴϴϭ͕ϬϭϬϭ͕ϰϵϴϭ͕ϭϱϯϴϯϯϭ͕ϵϴϲ EŽƚĞ;ƐͿ͗;ϭͿǁĞůůŝŶŐhŶŝƚƐ͘ ;ϮͿKĐĐƵƉŝĞĚZŽŽŵƐ ;ϯͿ^ƋƵĂƌĞ&ĞĞƚ 9.A.2.d Packet Pg. 401 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϳ dĂďůĞϮ dƌŝƉ'ĞŶĞƌĂƚŝŽŶ;WƌŽƉŽƐĞĚ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůWhŽŶĚŝƚŝŽŶƐͿʹǀĞƌĂŐĞtĞĞŬĚĂǇ WƌŽƉŽƐĞĚWhĞǀĞůŽƉŵĞŶƚϮϰ,ŽƵƌ dǁŽͲ tĂǇ sŽůƵŵĞ DWĞĂŬ,ŽƵƌWDWĞĂŬ,ŽƵƌ >ĂŶĚhƐĞ^ŝǌĞŶƚĞƌǆŝƚdŽƚĂůŶƚĞƌǆŝƚdŽƚĂů ^ŝŶŐůĞͲ&ĂŵŝůǇĞƚĂĐŚĞĚϵϬĚƵ;ϭͿϵϰϰϭϳϱϮϲϵϱϴϯϰϵϮ DƵůƚŝĨĂŵŝůǇϭϰϬĚƵ;ϭͿϭ͕ϬϭϴϭϱϱϭϲϲϱϬϯϬϴϬ dŽƚĂůdƌĂĨĨŝĐϭ͕ϵϲϮϯϮϭϬϯϭϯϱϭϬϴϲϰϭϳϮ EŽƚĞ;ƐͿ͗;ϭͿǁĞůůŝŶŐhŶŝƚƐ͘ /ŶĂŐƌĞĞŵĞŶƚǁŝƚŚƚŚĞŽůůŝĞƌŽƵŶƚǇdƌĂĨĨŝĐ/ŵƉĂĐƚ^ƚƵĚǇ;d/^Ϳ ŐƵŝĚĞůŝŶĞƐ͕ƐŝŐŶŝĨŝĐĂŶƚůǇŝŵƉĂĐƚĞĚƌŽĂĚǁĂǇƐ ĂƌĞŝĚĞŶƚŝĨŝĞĚďĂƐĞĚŽŶƚŚĞƉƌŽƉŽƐĞĚƉƌŽũĞĐƚŚŝŐŚĞƐƚƉĞĂŬŚŽƵƌƚƌŝƉŐĞŶĞƌĂƚŝŽŶ;ŶĞƚĞǆƚĞƌŶĂůƚƌĂĨĨŝĐͿĂŶĚ ĐŽŶƐŝƐƚĞŶƚǁŝƚŚƚŚĞƉĞĂŬŚŽƵƌŽĨƚŚĞĂĚũĂĐĞŶƚƐƚƌĞĞƚƚƌĂĨĨŝĐ͘ĂƐĞĚŽŶƚŚĞŝŶĨŽƌŵĂƚŝŽŶĐŽŶƚĂŝŶĞĚŝŶŽůůŝĞƌ ŽƵŶƚǇϮϬϭϵŶŶƵĂůhƉĚĂƚĞĂŶĚ/ŶǀĞŶƚŽƌǇZĞƉŽƌƚ;h/ZͿ͕ƚŚĞƉĞĂŬŚŽƵƌĨŽƌĂĚũĂĐĞŶƚƌŽĂĚǁĂǇŶĞƚǁŽƌŬŝƐ WD͘ dŚĞƐŝƚĞĂĐĐĞƐƐƚƵƌŶůĂŶĞĂŶĂůǇƐŝƐŝƐĐĂůĐƵůĂƚĞĚďĂƐĞĚŽŶƚŚĞĞƐƚŝŵĂƚĞĚWhdŽƚĂůdƌĂĨĨŝĐĚƵƌŝŶŐƚŚĞ ǁĞĞŬĚĂǇDĂŶĚWDƉĞĂŬŚŽƵƌĂƐƐŚŽǁŶŝŶdĂďůĞϮ͘/ŶĂĚĚŝƚŝŽŶ͕ƚŚĞǁĞĞŬĚĂǇDĂŶĚWDƉĞĂŬŚŽƵƌ EĞƚǆƚĞƌŶĂůƚƌĂĨĨŝĐĨƌŽŵƚŚĞ^ĂďůĞĂǇDWhƚŚĂƚǁŝůůƵƚŝůŝǌĞƚŚĞĂĐĐĞƐƐŽŶĂǇƐŚŽƌĞƌŝǀĞŝƐƐŚŽǁŶŝŶ dĂďůĞϮ͘ dŚĞŵĂǆŝŵƵŵƚŽƚĂůĚĂŝůǇƚƌŝƉŐĞŶĞƌĂƚŝŽŶĨŽƌƚŚĞ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůƐŚĂůůŶŽƚĞǆĐĞĞĚϭϳϮƚǁŽͲǁĂǇWD ƉĞĂŬŚŽƵƌŶĞƚŶĞǁƚƌŝƉƐďĂƐĞĚŽŶƚŚĞƵƐĞĐŽĚĞƐŝŶƚŚĞ/dŵĂŶƵĂůŽŶƚƌŝƉŐĞŶĞƌĂƚŝŽŶƌĂƚĞƐŝŶĞĨĨĞĐƚĂƚƚŚĞ ƚŝŵĞŽĨĂƉƉůŝĐĂƚŝŽŶĨŽƌ^Wͬ^WŽƌƐƵďĚŝǀŝƐŝŽŶƉůĂƚĂƉƉƌŽǀĂů͘ Trip Distribution and Assignment dƌĂĨĨŝĐŐĞŶĞƌĂƚĞĚďǇƚŚĞ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůĚĞǀĞůŽƉŵĞŶƚŝƐĂƐƐŝŐŶĞĚƚŽƐƵƌƌŽƵŶĚŝŶŐƌŽĂĚǁĂǇŶĞƚǁŽƌŬ ƵƐŝŶŐƚŚĞŬŶŽǁůĞĚŐĞŽĨƚŚĞĂƌĞĂĂŶĚĂƐĐŽŽƌĚŝŶĂƚĞĚǁŝƚŚŽůůŝĞƌŽƵŶƚǇdƌĂŶƐƉŽƌƚĂƚŝŽŶWůĂŶŶŝŶŐƐƚĂĨĨ͘Ɛ ƐƵĐŚ͕ƚŚĞƚƌĂĨĨŝĐĚŝƐƚƌŝďƵƚŝŽŶĨŽƌƚŚŝƐƉƌŽũĞĐƚŝƐĂƐƐƵŵĞĚĂƐϱϬйƚŽͬĨƌŽŵĂǇƐŚŽƌĞƌŝǀĞĂŶĚϱϬйƚŽͬĨƌŽŵ dĂŵŝĂŵŝdƌĂŝůĂƐƚ͘ dŚĞ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞů͛ƐWhƐŝƚĞͲŐĞŶĞƌĂƚĞĚƚƌŝƉĚŝƐƚƌŝďƵƚŝŽŶŝƐƐŚŽǁŶŝŶdĂďůĞϯʹWhdƌĂĨĨŝĐ ŝƐƚƌŝďƵƚŝŽŶĨŽƌWDWĞĂŬ,ŽƵƌĂŶĚŝůůƵƐƚƌĂƚĞĚŝŶ&ŝŐƵƌĞϮʹWhWƌŽũĞĐƚŝƐƚƌŝďƵƚŝŽŶďǇWĞƌĐĞŶƚĂŐĞ ĂŶĚďǇWDWĞĂŬ,ŽƵƌ͘ /ŶĂĚĚŝƚŝŽŶ͕ŝƚŝƐƌĞĐŽŐŶŝǌĞĚƚŚĂƚŽŶĐĞƚŚĞƉƌŽũĞĐƚĂĐĐĞƐƐŽŶƚŽ ĂǇƐŚŽƌĞƌŝǀĞŝƐĂǀĂŝůĂďůĞ͕ƐŽŵĞƚƌĂĨĨŝĐĨƌŽŵ ƚŚĞĞǆŝƐƚŝŶŐĂƉƉƌŽǀĞĚ^ĂďůĞĂǇDWhǁŝůůƵƚŝůŝǌĞƚŚŝƐĐŽŶŶĞĐƚŝŽŶĂƐĂŶĂůƚĞƌŶĂƚĞĂĐĐĞƐƐƚŽƚŚĞƌŽĂĚǁĂǇ ŶĞƚǁŽƌŬ͘ĂƐĞĚŽŶƚŚĞϮϬϭϭWhǌŽŶŝŶŐd/^ƚƌŝƉĚŝƐƚƌŝďƵƚŝŽŶ͕ϭϳйŽĨƚŚĞDWhƚƌĂĨĨŝĐ;ϭϵϲWDƉĞĂŬ ŚŽƵƌ͕ƉĞĂŬĚŝƌĞĐƚŝŽŶƚƌŝƉƐͿŝƐĂŶƚŝĐŝƉĂƚĞĚƚŽƵƐĞƚŚŝƐĐŽŶŶĞĐƚŝŽŶ͘dŚĞƚƌĂĨĨŝĐĂƐƐŽĐŝĂƚĞĚǁŝƚŚƚŚĞĂƉƉƌŽǀĞĚ DWhƚŚĂƚǁŝůůƵƚŝůŝǌĞƚŚĞŶĞǁĐŽŶŶĞĐƚŝŽŶŝƐƐŚŽǁŶŝŶdĂďůĞϯʹDWhdƌĂĨĨŝĐŝƐƚƌŝďƵƚŝŽŶĨŽƌWĞĂŬ,ŽƵƌ ĂŶĚŝůůƵƐƚƌĂƚĞĚŝŶ&ŝŐƵƌĞϮʹĂǇƐŚŽƌĞƌŝǀĞͲDWhŝƐƚƌŝďƵƚŝŽŶďǇWĞƌĐĞŶƚĂŐĞĂŶĚďǇWDWĞĂŬ,ŽƵƌ͘ 9.A.2.d Packet Pg. 402 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϴ dĂďůĞϯ WhdƌĂĨĨŝĐŝƐƚƌŝďƵƚŝŽŶĨŽƌWDWĞĂŬ,ŽƵƌ ZŽĂĚǁĂǇ>ŝŶŬ ŽůůŝĞƌ ŽƵŶƚǇ >ŝŶŬEŽ͘ ZŽĂĚǁĂǇ>ŝŶŬ>ŽĐĂƚŝŽŶ ŝƐƚƌŝďƵƚŝŽŶ ŽĨWƌŽũĞĐƚ dƌĂĨĨŝĐ WDWĞĂŬ,ŽƵƌWƌŽũĞĐƚ dƌĂĨĨŝĐsŽůƵŵĞ ŶƚĞƌǆŝƚ ĂǇƐŚŽƌĞƌΎEͬWƌŽũĞĐƚĐĐĞƐƐƚŽdŚŽŵĂƐƐŽŶƌϱϬй^ʹϱϰEʹϯϮ ĂǇƐŚŽƌĞƌϳ͘ϬdŚŽŵĂƐƐŽŶƌƚŽh^ϰϭϰϬй^ʹϰϯEʹϮϲ dŚŽŵĂƐƐŽŶƌϭϬϴ͘ϬĂƐƚŽĨĂǇƐŚŽƌĞƌϭϬйtʹϭϭʹϲ dŚŽŵĂƐƐŽŶƌϭϬϴ͘ϬdŚŽŵĂƐƐŽŶƌĐĐĞƐƐƚŽh^ϰϭϱϬйtʹϱϰʹϯϮ h^ϰϭϵϭ͘ϬĂǀŝƐůǀĚƚŽĂǇƐŚŽƌĞƌϮϬйʹϮϮtʹϭϯ h^ϰϭϵϭ͘ϬĂǇƐŚŽƌĞƌƚŽŝƌƉŽƌƚZĚϮϬйtʹϮϮʹϭϯ h^ϰϭϵϮ͘ϬŝƌƉŽƌƚZĚƚŽZĂƚƚůĞƐŶĂŬĞ ,ĂŵŵŽĐŬϯϬйʹϯϮtʹϭϵ h^ϰϭϵϯ͘ϬZĂƚƚůĞƐŶĂŬĞ,ĂŵŵŽĐŬƚŽ dƌŝĂŶŐůĞůǀĚϮϬйtʹϮϮʹϭϯ EŽƚĞ;ƐͿ͗ ΎEŽƚĂŽůůŝĞƌŽƵŶƚǇŵŽŶŝƚŽƌĞĚƌŽĂĚǁĂǇ͘WĞĂŬĚŝƌĞĐƚŝŽŶĚĞƚĞƌŵŝŶĞĚďǇ:ĂŶƵĂƌǇϮϮ͕ϮϬϮϬƚƌĂĨĨŝĐĐŽƵŶƚƐ͘ dĂďůĞϯ DWhdƌĂĨĨŝĐŝƐƚƌŝďƵƚŝŽŶĨŽƌWDWĞĂŬ,ŽƵƌ ZŽĂĚǁĂǇ>ŝŶŬ ŽůůŝĞƌ ŽƵŶƚǇ>ŝŶŬ EŽ͘ ZŽĂĚǁĂǇ>ŝŶŬ>ŽĐĂƚŝŽŶ ŝƐƚƌŝďƵƚŝŽŶ ŽĨWƌŽũĞĐƚ dƌĂĨĨŝĐ WDWĞĂŬ,ŽƵƌWƌŽũĞĐƚ dƌĂĨĨŝĐsŽůƵŵĞ ŶƚĞƌǆŝƚ EĂǇƐŚŽƌĞƌΎEͬĂǇƐŚŽƌĞĐĐĞƐƐƚŽ dŚŽŵĂƐƐŽŶƌϭϳй^ΎΎ^ʹϭϵϲEʹϭϰϮ EŽƚĞ;ƐͿ͗ ΎEŽƚĂŽůůŝĞƌŽƵŶƚǇŵŽŶŝƚŽƌĞĚƌŽĂĚǁĂǇ͘WĞĂŬĚŝƌĞĐƚŝŽŶĚĞƚĞƌŵŝŶĞĚďǇ:ĂŶƵĂƌǇϮϮ͕ϮϬϮϬƚƌĂĨĨŝĐĐŽƵŶƚƐ͘ ΎΎ^с^ĂďůĞĂǇDWh 9.A.2.d Packet Pg. 403 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϵ &ŝŐƵƌĞϮʹWhWƌŽũĞĐƚŝƐƚƌŝďƵƚŝŽŶďǇWĞƌĐĞŶƚĂŐĞĂŶĚďǇWDWĞĂŬ,ŽƵƌ 9.A.2.d Packet Pg. 404 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϭϬ &ŝŐƵƌĞϮʹĂǇƐŚŽƌĞƌŝǀĞͲDWhŝƐƚƌŝďƵƚŝŽŶďǇWĞƌĐĞŶƚĂŐĞĂŶĚďǇWDWĞĂŬ,ŽƵƌ 9.A.2.d Packet Pg. 405 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϭϭ Background Traffic ǀĞƌĂŐĞďĂĐŬŐƌŽƵŶĚƚƌĂĨĨŝĐŐƌŽǁƚŚƌĂƚĞƐǁĞƌĞĞƐƚŝŵĂƚĞĚĨŽƌƚŚĞƐĞŐŵĞŶƚƐŽĨƚŚĞƌŽĂĚǁĂǇŶĞƚǁŽƌŬŝŶƚŚĞ ƐƚƵĚǇĂƌĞĂƵƐŝŶŐƚŚĞŽůůŝĞƌŽƵŶƚǇdƌĂŶƐƉŽƌƚĂƚŝŽŶWůĂŶŶŝŶŐ^ƚĂĨĨŐƵŝĚĂŶĐĞŽĨĂŵŝŶŝŵƵŵϮйŐƌŽǁƚŚƌĂƚĞ͕ ŽƌƚŚĞŚŝƐƚŽƌŝĐĂůŐƌŽǁƚŚƌĂƚĞĨƌŽŵĂŶŶƵĂůƚƌĂĨĨŝĐĐŽƵŶƚƐ;ĞƐƚŝŵĂƚĞĚĨƌŽŵϮϬϬϴƚŚƌŽƵŐŚϮϬϭϵͿ͕ǁŚŝĐŚĞǀĞƌ ŝƐŐƌĞĂƚĞƌ͘ŶŽƚŚĞƌǁĂǇƚŽĚĞƌŝǀĞƚŚĞďĂĐŬŐƌŽƵŶĚƚƌĂĨĨŝĐŝƐƚŽƵƐĞƚŚĞϮϬϭϵŶŶƵĂůhƉĚĂƚĞĂŶĚ/ŶǀĞŶƚŽƌǇ ZĞƉŽƌƚ;h/ZͿǀŽůƵŵĞƉůƵƐƚŚĞƚƌŝƉďĂŶŬǀŽůƵŵĞ͘ dĂďůĞϰ͕ĂĐŬŐƌŽƵŶĚdƌĂĨĨŝĐǁŝƚŚŽƵƚWƌŽũĞĐƚŝůůƵƐƚƌĂƚĞƐƚŚĞĂƉƉůŝĐĂƚŝŽŶŽĨƉƌŽũĞĐƚĞĚŐƌŽǁƚŚƌĂƚĞƐƚŽ ŐĞŶĞƌĂƚĞƚŚĞƉƌŽũĞĐƚĞĚďĂĐŬŐƌŽƵŶĚ;ǁŝƚŚŽƵƚƉƌŽũĞĐƚͿƉĞĂŬŚŽƵƌƉĞĂŬĚŝƌĞĐƚŝŽŶƚƌĂĨĨŝĐǀŽůƵŵĞĨŽƌƚŚĞ ĨƵƚƵƌĞŚŽƌŝǌŽŶǇĞĂƌϮϬϮϱ͘ dŚĞĂǇƐŚŽƌĞƌŝǀĞůŝŶŬƐŽƵƚŚŽĨdŚŽŵĂƐƐŽŶƌŝǀĞŝƐŶŽƚĂŽůůŝĞƌŽƵŶƚǇŵŽŶŝƚŽƌĞĚƌŽĂĚǁĂǇ͘/ŶŽƌĚĞƌƚŽ ĚĞƚĞƌŵŝŶĞďĂĐŬŐƌŽƵŶĚĐŽŶĚŝƚŝŽŶƐŽŶƚŚŝƐůŝŶŬ͕ƚƌĂĨĨŝĐĐŽƵŶƚƐǁĞƌĞƉĞƌĨŽƌŵĞĚŽŶtĞĚŶĞƐĚĂǇ͕:ĂŶƵĂƌǇϮϮ͕ ϮϬϮϬ͘dŚĞƌĂǁƚƌĂĨĨŝĐĚĂƚĂǁĂƐĂĚũƵƐƚĞĚƚŽƉĞĂŬƐĞĂƐŽŶĐŽŶĚŝƚŝŽŶƐƵƐŝŶŐƚŚĞ&KdϮϬϭϴWĞĂŬ^ĞĂƐŽŶ &ĂĐƚŽƌĂƚĞŐŽƌǇZĞƉŽƌƚĨŽƌŽůůŝĞƌŽƵŶƚǇĂŶĚƚŚĞϮϬϮϬƉĞĂŬŚŽƵƌƉĞĂŬĚŝƌĞĐƚŝŽŶƚƌĂĨĨŝĐǀŽůƵŵĞƐǁĞƌĞ ĐĂůĐƵůĂƚĞĚĨƌŽŵƚŚĞƌĞƐƵůƚŝŶŐĚĂƚĂ͘&ŽƌŵŽƌĞĚĞƚĂŝůƐ͕ƐĞĞƉƉĞŶĚŝǆ͗dƌĂĨĨŝĐŽƵŶƚǆŚŝďŝƚƐ͘ ĂǇƐŚŽƌĞƌŝǀĞĂƚƚŚŝƐůŽĐĂƚŝŽŶŝƐĂŶŽŽƵƚůĞƚƌŽĂĚǁĂǇĂŶĚĂƐĂƌĞƐƵůƚ͕ŵŝŶŝŵĂůĂŶŶƵĂůƚƌĂĨĨŝĐŐƌŽǁƚŚŝƐ ĞǆƉĞĐƚĞĚ͘&ŽƌƚŚŝƐĂŶĂůǇƐŝƐ͕ĐŽŶƐĞƌǀĂƚŝǀĞůǇ͕ĂϮйŐƌŽǁƚŚƌĂƚĞŝƐĂƉƉůŝĞĚƚŽĚĞƚĞƌŵŝŶĞϮϬϮϱďĂĐŬŐƌŽƵŶĚ ǀŽůƵŵĞƐĨŽƌƚŚŝƐůŝŶŬ͘dŚĞĞǆŝƐƚŝŶŐĂƉƉƌŽǀĞĚDWhƚƌĂĨĨŝĐǀŽůƵŵĞƐĂŶƚŝĐŝƉĂƚĞĚƚŽĂĐĐĞƐƐĂǇƐŚŽƌĞƌŝǀĞ ǀŝĂƚŚŝƐĐŽŶŶĞĐƚŝŽŶĂƌĞƚŚĞŶĂĚĚĞĚƚŽƚŚĞϮϬϮϱďĂĐŬŐƌŽƵŶĚǀŽůƵŵ ĞƐĂŶĚƚŚĞƌĞƐƵůƚŝŶŐƚƌĂĨĨŝĐǀŽůƵŵĞƚŽƚĂů ŝƐƵƐĞĚĨŽƌƚŚĞĐŽŶĐƵƌƌĞŶĐǇĂŶĂůǇƐŝƐ͘ 9.A.2.d Packet Pg. 406 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϭϮ dĂďůĞϰ ĂĐŬŐƌŽƵŶĚdƌĂĨĨŝĐǁŝƚŚŽƵƚWƌŽũĞĐƚ;ϮϬϭϵͲϮϬϮϱͿ ZŽĂĚǁĂǇ>ŝŶŬ h/Z >ŝŶŬ /η ZŽĂĚǁĂǇ>ŝŶŬ >ŽĐĂƚŝŽŶ ϮϬϭϵh/Z WŬ,ƌ͕WŬŝƌ ĂĐŬŐƌŽƵŶĚ dƌĂĨĨŝĐ sŽůƵŵĞ ;ƚƌŝƉƐͬŚƌͿ WƌŽũĞĐƚĞĚ dƌĂĨĨŝĐ ŶŶƵĂů 'ƌŽǁƚŚ ZĂƚĞ ;йͬǇƌͿ;ϭͿ 'ƌŽǁƚŚ &ĂĐƚŽƌ ϮϬϮϱWƌŽũĞĐƚĞĚ WŬ,ƌ͕WĞĂŬŝƌ ĂĐŬŐƌŽƵŶĚ dƌĂĨĨŝĐsŽůƵŵĞ ǁͬŽƵƚWƌŽũĞĐƚ ;ƚƌŝƉƐͬŚƌͿ 'ƌŽǁƚŚ&ĂĐƚŽƌ;ϮͿ dƌŝƉ ĂŶŬ ϮϬϮϱWƌŽũĞĐƚĞĚ WŬ,ƌ͕WĞĂŬŝƌ ĂĐŬŐƌŽƵŶĚ dƌĂĨĨŝĐsŽůƵŵĞ ǁͬŽƵƚWƌŽũĞĐƚ ;ƚƌŝƉƐͬŚƌͿ dƌŝƉĂŶŬ;ϯͿ ĂǇƐŚŽƌĞƌ͘;ϰͿEͬWƌŽũĞĐƚĐĐĞƐƐƚŽ dŚŽŵĂƐƐŽŶƌ͘ϭϴϬϮ͘Ϭйϭ͘ϭϬϰϭϭϵϵϭϵϲ;ϱͿϯϵϱ;ϲͿ ĂǇƐŚŽƌĞƌ͘ϳ͘ϬdŚŽŵĂƐƐŽŶƌ͘ ƚŽh^ϰϭϲϰϬ Ϯ͘Ϭй ϭ͘ϭϮϲϮ ϳϮϭ ϭϰϵϳϴϵ dŚŽŵĂƐƐŽŶƌ͘ϭϬϴ͘Ϭ ĂǇƐŚŽƌĞƌ͘ƚŽ WƌŽũĞĐƚDĂŝŶ ĐĐĞƐƐ ϱϱϬϮ͘Ϭйϭ͘ϭϮϲϮϲϮϬϭϬϬϲϱϬ dŚŽŵĂƐƐŽŶƌ͘ϭϬϴ͘ϬWƌŽũĞĐƚDĂŝŶ ĐĐĞƐƐƚŽh^ϰϭϱϱϬ Ϯ͘Ϭй ϭ͘ϭϮϲϮ ϲϮϬ ϭϬϬϲϱϬ dĂŵŝĂŵŝdƌ;h^ ϰϭͿϵϭ͘ϬĂǀŝƐůǀĚƚŽ ĂǇƐŚŽƌĞƌϭ͕ϱϴϬϮ͘Ϭйϭ͘ϭϮϲϮϭ͕ϳϴϬϭϯϵϭ͕ϳϭϵ dĂŵŝĂŵŝdƌ;h^ ϰϭͿϵϭ͘ϬĂǇƐŚŽƌĞƌƚŽ ŝƌƉŽƌƚZĚϭ͕ϱϴϬ Ϯ͘Ϭй ϭ͘ϭϮϲϮϭ͕ϳϴϬϭϯϵ ϭ͕ϳϭϵ dĂŵŝĂŵŝdƌ;h^ ϰϭͿϵϮ͘Ϭ ŝƌƉŽƌƚZĚƚŽ ZĂƚƚůĞƐŶĂŬĞ ,ĂŵŵŽĐŬ Ϯ͕ϮϯϬϮ͘Ϭйϭ͘ϭϮϲϮϮ͕ϱϭϮϯϮϳϮ͕ϱϱϳ dĂŵŝĂŵŝdƌ;h^ ϰϭͿϵϯ͘Ϭ ZĂƚƚůĞƐŶĂŬĞ ,ĂŵŵŽĐŬƚŽ dƌŝĂŶŐůĞůǀĚ ϭ͕ϴϲϬ Ϯ͘Ϭй ϭ͘ϭϮϲϮ Ϯ͕Ϭϵϱ ϲϭϲϮ͕ϰϳϲ EŽƚĞ;ƐͿ͗;ϭͿŶŶƵĂů'ƌŽǁƚŚZĂƚĞʹĞƐƚŝŵĂƚĞĚĨƌŽŵϮϬϬϴͲϮϬϭϵŽƌϮйŵŝŶŝŵƵŵ͘ ;ϮͿ'ƌŽǁƚŚ&ĂĐƚŽƌс;ϭнŶŶƵĂů'ƌŽǁƚŚZĂƚĞͿϲ͘ϮϬϮϱWƌŽũĞĐƚĞĚsŽůƵŵĞсϮϬϭϵh/ZsŽůƵŵĞǆ'ƌŽǁƚŚ&ĂĐƚŽƌ͘ ;ϯͿϮϬϮϱWƌŽũĞĐƚĞĚsŽůƵŵĞсϮϬϭϵh/ZsŽůƵŵĞнdƌŝƉĂŶŬ͘ dŚĞƉƌŽũĞĐƚĞĚϮϬϮϱWĞĂŬ,ŽƵƌʹWĞĂŬŝƌĞĐƚŝŽŶĂĐŬŐƌŽƵŶĚdƌĂĨĨŝĐŝƐƚŚĞŐƌĞĂƚĞƌŽĨƚŚĞ'ƌŽǁƚŚ&ĂĐƚŽƌŽƌdƌŝƉĂŶŬĐĂůĐƵůĂƚŝŽŶ͕ǁŚŝĐŚŝƐ ƵŶĚĞƌůŝŶĞĚĂŶĚďŽůĚĂƐĂƉƉůŝĐĂďůĞ͘ ;ϰͿEŽƚĂŽůůŝĞƌŽƵŶƚǇŵŽŶŝƚŽƌĞĚƌŽĂĚǁĂǇ͘ϮϬϮϬĂĐŬŐƌŽƵŶĚƚƌĂĨĨŝĐǀŽůƵŵĞĚĞƌŝǀĞĚĨƌŽŵƚƌĂĨĨŝĐĐŽƵŶƚƐƉĞƌĨŽƌŵĞĚϭͲϮϮͲϮϬϮϬĂŶĚ ĂĚũƵƐƚĞĚĨŽƌƉĞĂŬƐĞĂƐŽŶ͘'ƌŽǁƚŚ&ĂĐƚŽƌĨŽƌƚŚŝƐůŝŶŬŝƐ;ϭнŶŶƵĂů'ƌŽǁƚŚZĂƚĞͿϱ͘ϮϬϮϱWƌŽũĞĐƚĞĚsŽůƵŵĞсϮϬϮϬĂĚũƵƐƚĞĚƚƌĂĨĨŝĐĐŽƵŶƚ ǀŽůƵŵĞǆ'ƌŽǁƚŚ&ĂĐƚŽƌ͘ ;ϱͿĂůĐƵůĂƚĞĚĨƌŽŵĞǆŝƐƚŝŶŐĂƉƉƌŽǀĞĚDWhǌŽŶŝŶŐƚƌŝƉƐ͕ƌĞĨĞƌƚŽdĂďůĞϯ͘ ;ϲͿϮϬϮϱWƌŽũĞĐƚĞĚsŽůƵŵĞͲdƌŝƉĂŶŬсϮϬϮϱWƌŽũĞĐƚĞĚsŽůƵŵĞнdƌŝƉĂŶŬ͘ Existing and Future Roadway Network dŚĞĞǆŝƐƚŝŶŐƌŽĂĚǁĂǇĐŽŶĚŝƚŝŽŶƐĂƌĞĞǆƚƌĂĐƚĞĚĨƌŽŵƚŚĞϮϬϭϵŶŶƵĂůhƉĚĂƚĞĂŶĚ/ŶǀĞŶƚŽƌǇZĞƉŽƌƚ;h/ZͿ ĂŶĚƚŚĞƉƌŽũĞĐƚƌŽĂĚǁĂǇĐŽŶĚŝƚŝŽŶƐĂƌĞďĂƐĞĚŽŶƚŚĞĐƵƌƌĞŶƚŽůůŝĞƌŽƵŶƚǇϱͲzĞĂƌtŽƌŬWƌŽŐƌĂŵ͘ ZŽĂĚǁĂǇŝŵƉƌŽǀĞŵĞŶƚƐƚŚĂƚĂƌĞĐƵƌƌĞŶƚůǇƵŶĚĞƌĐŽŶƐƚƌƵĐƚŝŽŶŽƌĂƌĞƐĐŚĞĚƵůĞĚƚŽďĞĐŽŶƐƚƌƵĐƚĞĚǁŝƚŚŝŶ ƚŚĞĨŝǀĞǇĞĂƌdƌĂŶƐƉŽƌƚĂƚŝŽŶ/ŵƉƌŽǀĞŵĞŶƚWůĂŶ;d/WͿŽƌĂƉŝƚĂů/ŵƉƌŽǀĞŵĞŶƚWƌŽŐƌĂŵ;/WͿĂƌĞĐŽŶƐŝĚĞƌĞĚ ƚŽďĞĐŽŵŵŝƚƚĞĚŝŵƉƌŽǀĞŵĞŶƚƐ͘ƐŶŽƐƵĐŚŝŵƉƌŽǀĞŵĞŶƚƐǁĞƌĞŝĚĞŶƚŝĨŝĞĚŝŶƚŚĞŽůůŝĞƌŽƵŶƚǇϮϬϭϵ h/Z͕ƚŚĞĞǀĂůƵĂƚĞĚƌŽĂĚǁĂǇƐĂƌĞĂŶƚŝĐŝƉĂƚĞĚƚŽƌĞŵĂŝŶĂƐƐƵĐŚƚŚƌŽƵŐŚƉƌŽũĞĐƚďƵŝůĚͲŽƵƚ͘dŚĞĞǆŝƐƚŝŶŐ ĂŶĚĨƵƚƵƌĞƌŽĂĚǁĂǇĐŽŶĚŝƚŝŽŶƐĂƌĞŝůůƵƐƚƌĂƚĞĚŝŶdĂďůĞϱ͘ 9.A.2.d Packet Pg. 407 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϭϯ dĂďůĞϱ ǆŝƐƚŝŶŐĂŶĚ&ƵƚƵƌĞZŽĂĚǁĂǇŽŶĚŝƚŝŽŶƐ ZŽĂĚǁĂǇ>ŝŶŬh/Z >ŝŶŬ/η ZŽĂĚǁĂǇ>ŝŶŬ >ŽĐĂƚŝŽŶ ϮϬϭϵ ZŽĂĚǁĂǇ ŽŶĚŝƚŝŽŶƐ DŝŶ͘ ^ƚĂŶĚĂƌĚ >K^ ϮϬϭϵ WĞĂŬŝƌ͕ WĞĂŬ,ƌ ĂƉĂĐŝƚǇ sŽůƵŵĞ ϮϬϮϱ ZŽĂĚǁĂǇ ŽŶĚŝƚŝŽŶƐ ϮϬϮϱ WĞĂŬŝƌ͕ WĞĂŬ,ƌ ĂƉĂĐŝƚǇ sŽůƵŵĞ ĂǇƐŚŽƌĞƌΎEͬWƌŽũĞĐƚĐĐĞƐƐƚŽ dŚŽŵĂƐƐŽŶƌϮhϴϬϬ;^ͿϮhϴϬϬ;^Ϳ ĂǇƐŚŽƌĞƌϳ͘ϬdŚŽŵĂƐƐŽŶƌƚŽ h^ϰϭϰ ϭ͕ϴϬϬ ;^Ϳϰϭ͕ϴϬϬ ;^Ϳ dŚŽŵĂƐƐŽŶƌϭϬϴ͘Ϭ ĂǇƐŚŽƌĞƌƚŽ WƌŽũĞĐƚDĂŝŶ ĐĐĞƐƐ ϮhϴϬϬ;ͿϮhϴϬϬ;Ϳ dŚŽŵĂƐƐŽŶƌϭϬϴ͘ϬWƌŽũĞĐƚDĂŝŶ ĐĐĞƐƐƚŽh^ϰϭϮh ϴϬϬ;Ϳ Ϯh ϴϬϬ;Ϳ dĂŵŝĂŵŝdƌ ;h^ϰϭͿϵϭ͘ϬĂǀŝƐůǀĚƚŽ ĂǇƐŚŽƌĞƌϲϮ͕ϵϬϬ ;ͿϲϮ͕ϵϬϬ ;Ϳ dĂŵŝĂŵŝdƌ ;h^ϰϭͿϵϭ͘ϬĂǇƐŚŽƌĞƌƚŽ ŝƌƉŽƌƚZĚϲ Ϯ͕ϵϬϬ ;ͿϲϮ͕ϵϬϬ ;Ϳ dĂŵŝĂŵŝdƌ ;h^ϰϭͿϵϮ͘Ϭ ŝƌƉŽƌƚZĚƚŽ ZĂƚƚůĞƐŶĂŬĞ ,ĂŵŵŽĐŬ ϲϮ͕ϵϬϬ ;ͿϲϮ͕ϵϬϬ ;Ϳ dĂŵŝĂŵŝdƌ ;h^ϰϭͿϵϯ͘Ϭ ZĂƚƚůĞƐŶĂŬĞ ,ĂŵŵŽĐŬƚŽ dƌŝĂŶŐůĞůǀĚ ϲ ϯ͕ϬϬϬ ;Ϳϲϯ͕ϬϬϬ ;Ϳ EŽƚĞ;ƐͿ͗ ϮhсϮͲůĂŶĞƵŶĚŝǀŝĚĞĚƌŽĂĚǁĂǇ͖ϰ͕ϲ͕ϴсϰͲůĂŶĞ͕ϲͲůĂŶĞ͕ϴͲůĂŶĞĚŝǀŝĚĞĚƌŽĂĚǁĂǇ͕ƌĞƐƉĞĐƚŝǀĞůǇ͘ >K^с>ĞǀĞůŽĨ^ĞƌǀŝĐĞ͘ ΎEŽƚĂŽůůŝĞƌŽƵŶƚǇŵŽŶŝƚŽƌĞĚƌŽĂĚǁĂǇ͘KƉĞƌĂƚŝŽŶĂůĐŚĂƌĂĐƚĞƌŝƐƚŝĐƐĂƌĞĂƐƐƵŵĞĚƐŝŵŝůĂƌƚŽ>ŝŶŬηϭϰϰ͘Ϭ͕ ^ŚĂĚŽǁůĂǁŶƌŝǀĞ͘WĞĂŬŚŽƵƌƉĞĂŬĚŝƌĞĐƚŝŽŶĚĞƌŝǀĞĚĨƌŽŵϭͲϮϮͲϮϬϮϬƚƌĂĨĨŝĐĐŽƵŶƚƐ͘ Project Impacts to Area Roadway Network Link Analysis dŚĞŽůůŝĞƌŽƵŶƚǇdƌĂŶƐƉŽƌƚĂƚŝŽŶWůĂŶŶŝŶŐ^ĞƌǀŝĐĞƐĚĞǀĞůŽƉĞĚ>ĞǀĞůŽĨ^ĞƌǀŝĐĞ;>K^ͿǀŽůƵŵĞƐĨŽƌƚŚĞ ƌŽĂĚǁĂǇůŝŶŬƐŝŵƉĂĐƚĞĚďǇƚŚĞƉƌŽũĞĐƚ͕ǁŚŝĐŚǁĞƌĞĞǀĂůƵĂƚĞĚƚŽĚĞƚĞƌŵŝŶĞƚŚĞƉƌŽũĞĐƚŝŵƉĂĐƚƐƚŽƚŚĞ ĂƌĞĂ ƌŽĂĚǁĂǇ ŶĞƚǁŽƌŬ ĨŽƌ ĨƵƚƵƌĞ ĐŽŶĚŝƚŝŽŶƐ ;ƉůĂŶŶŝŶŐ ŚŽƌŝǌŽŶ ǇĞĂƌϮϬϮϱͿ͘dŚĞŽůůŝĞƌŽƵŶƚǇ dƌĂŶƐƉŽƌƚĂƚŝŽŶWůĂŶŶŝŶŐ^ĞƌǀŝĐĞƐŐƵŝĚĞůŝŶĞƐŚĂǀĞĚĞƚĞƌŵŝŶĞĚƚŚĂƚĂƉƌŽũĞĐƚǁŝůůďĞĐŽŶƐŝĚĞƌĞĚƚŽŚĂǀĞĂ ƐŝŐŶŝĨŝĐĂŶƚĂŶĚĂĚǀĞƌƐĞŝŵƉĂĐƚŝĨďŽƚŚƚŚĞƉĞƌĐĞŶƚĂŐĞǀŽůƵŵĞĐĂƉĂĐŝƚǇĞǆĐĞĞĚƐϮйŽĨƚŚĞĐĂƉĂĐŝƚǇĨŽƌƚŚĞ ůŝŶŬĚŝƌĞĐƚůǇĂĐĐĞƐƐĞĚďǇƚŚĞƉƌŽũĞĐƚĂŶĚĨŽƌƚŚĞůŝŶŬĂĚũĂĐĞŶƚƚŽƚŚĞůŝŶŬĚŝƌĞĐƚůǇĂĐĐĞƐƐĞĚďǇƚŚĞƉƌŽũĞĐƚ͖ ϯйĨŽƌŽƚŚĞƌƐƵďƐĞƋƵĞŶƚůŝŶŬƐĂŶĚŝĨƚŚĞƌŽĂĚǁĂǇŝƐƉƌŽũĞĐƚĞĚƚŽŽƉĞƌĂƚĞďĞůŽǁƚŚĞĂĚŽƉƚĞĚ>K^ƐƚĂŶĚĂƌĚ͘ ĂƐĞĚŽŶƚŚĞƐĞĐƌŝƚĞƌŝĂ͕ƚŚĞƉƌŽũĞĐƚ͛ƐŝŵƉĂĐƚŝƐƐŝŐŶŝĨŝĐĂŶƚŽŶ ĂǇƐŚŽƌĞƌŝǀĞĂŶĚŽŶdŚŽŵĂƐƐŽŶƌŝǀĞĨƌŽŵ ƚŚĞƉƌŽũĞĐƚ͛ƐŵĂŝŶĂĐĐĞƐƐƚŽh^ϰϭ͘dŚĞĞƐƚŝŵĂƚĞĚƚƌĂĨĨŝĐĚŽĞƐŶŽƚĐƌĞĂƚĞĂŶǇƐŝŐŶŝĨŝĐĂŶƚŝŵƉĂĐƚƐŽŶƚŚĞ ŽƚŚĞƌĂŶĂůǇǌĞĚƌŽĂĚǁĂǇƐĞŐŵĞŶƚƐŽĨƚŚĞƐƚƵĚǇŶĞƚǁŽƌŬ͘ EŽŶĞŽĨƚŚĞĂŶĂůǇǌĞĚůŝŶŬƐĂƌĞƉƌŽũĞĐƚĞĚƚŽŽƉĞƌĂƚĞďĞůŽǁƚŚĞĂĚŽƉƚĞĚ>K^ƐƚĂŶĚĂƌĚǁŝƚŚŽƌǁŝƚŚŽƵƚƚŚĞ ƉƌŽũĞĐƚĂƚϮϬϮϱĨƵƚƵƌĞĐŽŶĚŝƚŝŽŶƐ͘dĂďůĞϲ͕ZŽĂĚǁĂǇ>ŝŶŬ>ĞǀĞůŽĨ^ĞƌǀŝĐĞŝůůƵƐƚƌĂƚĞƐƚŚĞ>K^ŝŵƉĂĐƚƐŽĨ ƚŚĞƉƌŽũĞĐƚŽŶƚŚĞƌŽĂĚǁĂǇŶĞƚǁŽƌŬĐůŽƐĞƐƚƚŽƚŚĞƉƌŽũĞĐƚ͘ 9.A.2.d Packet Pg. 408 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϭϰ dĂďůĞϲ ZŽĂĚǁĂǇ>ŝŶŬ>ĞǀĞůŽĨ^ĞƌǀŝĐĞ;>K^ͿʹtŝƚŚWƌŽũĞĐƚŝŶƚŚĞzĞĂƌϮϬϮϱ ZŽĂĚǁĂǇ>ŝŶŬ h/Z >ŝŶŬ/ η ZŽĂĚǁĂǇ>ŝŶŬ >ŽĐĂƚŝŽŶ ϮϬϭϵWĞĂŬ ŝƌ͕WĞĂŬ,ƌ ĂƉĂĐŝƚǇ sŽůƵŵĞ ZŽĂĚǁĂǇ >ŝŶŬ͕WĞĂŬ ŝƌ͕WĞĂŬ,ƌ ;WƌŽũĞĐƚsŽů ĚĚĞĚͿΎ ϮϬϮϱWĞĂŬ ŝƌ͕WĞĂŬ ,ƌsŽůƵŵĞ ǁͬWƌŽũĞĐƚ ΎΎ йsŽůƵŵĞ ĂƉĂĐŝƚǇ /ŵƉĂĐƚďǇ WƌŽũĞĐƚ DŝŶ>K^ ĞǆĐĞĞĚĞĚ ǁŝƚŚŽƵƚ WƌŽũĞĐƚ͍ zĞƐͬEŽ DŝŶ>K^ ĞǆĐĞĞĚĞĚ ǁŝƚŚ WƌŽũĞĐƚ͍ zĞƐͬEŽ ĂǇƐŚŽƌĞƌ͘Eͬ WƌŽũĞĐƚĐĐĞƐƐ ƚŽdŚŽŵĂƐƐŽŶ ƌ͘ ϴϬϬ;^Ϳ^ʹϱϰϰϰϵϲ͘ϴйEŽEŽ ĂǇƐŚŽƌĞƌ͘ϳ͘ϬdŚŽŵĂƐƐŽŶƌ͘ ƚŽh^ϰϭϭ͕ϴϬϬ;^Ϳ^ʹϰϯ ϴϯϮϮ͘ϰй EŽ EŽ dŚŽŵĂƐƐŽŶƌ͘ϭϬϴ͘Ϭ ĂǇƐŚŽƌĞƌ͘ ƚŽWƌŽũĞĐƚ DĂŝŶĐĐĞƐƐ ϴϬϬ;ͿʹϲϲϱϲϬ͘ϴйEŽEŽ dŚŽŵĂƐƐŽŶƌ͘ϭϬϴ͘Ϭ WƌŽũĞĐƚDĂŝŶ ĐĐĞƐƐƚŽh^ ϰϭ ϴϬϬ;ͿʹϯϮ ϲϴϮϰ͘Ϭй EŽ EŽ dĂŵŝĂŵŝdƌ ;h^ϰϭͿϵϭ͘ϬĂǀŝƐůǀĚƚŽ ĂǇƐŚŽƌĞƌϮ͕ϵϬϬ;ͿʹϮϮϭ͕ϴϬϮϬ͘ϴйEŽEŽ dĂŵŝĂŵŝdƌ ;h^ϰϭͿϵϭ͘ϬĂǇƐŚŽƌĞƌƚŽ ŝƌƉŽƌƚZĚϮ͕ϵϬϬ;Ϳʹϭϯ ϭ͕ϳϵϯϬ͘ϰй EŽ EŽ dĂŵŝĂŵŝdƌ ;h^ϰϭͿϵϮ͘Ϭ ŝƌƉŽƌƚZĚƚŽ ZĂƚƚůĞƐŶĂŬĞ ,ĂŵŵŽĐŬ Ϯ͕ϵϬϬ;ͿʹϯϮϮ͕ϱϴϵϭ͘ϭйEŽEŽ dĂŵŝĂŵŝdƌ ;h^ϰϭͿϵϯ͘Ϭ ZĂƚƚůĞƐŶĂŬĞ ,ĂŵŵŽĐŬƚŽ dƌŝĂŶŐůĞůǀĚ ϯ͕ϬϬϬ;Ϳʹϭϯ Ϯ͕ϰϴϵϬ͘ϰй EŽ EŽ EŽƚĞ;ƐͿ͗ ΎZĞĨĞƌƚŽdĂďůĞϯĨƌŽŵƚŚŝƐƌĞƉŽƌƚ͘ ΎΎϮϬϮϱWƌŽũĞĐƚĞĚsŽůƵŵĞсϮϬϮϱďĂĐŬŐƌŽƵŶĚ;ƌĞĨĞƌƚŽdĂďůĞϰͿнWƌŽũĞĐƚsŽůƵŵĞĂĚĚĞĚ͘ ƐŝůůƵƐƚƌĂƚĞĚŝŶŽůůŝĞƌŽƵŶƚǇ>ŚĂƉƚĞƌϲ͘ϬϮ͘ϬϮʹD͘Ϯ͕ŽŶĐĞƚƌĂĨĨŝĐĨƌŽŵĂĚĞǀĞůŽƉŵĞŶƚŚĂƐďĞĞŶ ƐŚŽǁŶƚŽďĞůĞƐƐƚŚĂŶƐŝŐŶŝĨŝĐĂŶƚŽŶĂŶǇƐĞŐŵĞŶƚƵƐŝŶŐŽůůŝĞƌŽƵŶƚǇd/^ƐŝŐŶŝĨŝĐĂŶĐĞĐƌŝƚĞƌŝŽŶ͕ƚŚĞ ĚĞǀĞůŽƉŵĞŶƚ͛ƐŝŵƉĂĐƚƐĂƌĞŶŽƚƌĞƋƵŝƌĞĚƚŽďĞĂŶĂůǇǌĞĚĨƵƌƚŚĞƌŽŶĂŶǇĂĚĚŝƚŝŽŶĂůƐĞŐŵĞŶƚƐ͘ dŚĞdĂŵŝĂŵŝdƌĂŝůĂƐƚƌŽĂĚǁĂǇƐĞŐŵĞŶƚƐĨƌŽŵĂǀŝƐŽƵůĞǀĂƌĚƚŽZĂƚƚůĞƐŶĂŬĞ,ĂŵŵŽĐŬZŽĂĚŝƐŝŶĂ ĚĞƐŝŐŶĂƚĞĚ dƌĂŶƐƉŽƌƚĂƚŝŽŶ ŽŶĐƵƌƌĞŶĐǇ ǆĞŵƉƚŝŽŶ ƌĞĂ ;dͿ͘ /Ŷ ĐŽŵƉůŝĂŶĐĞ ǁŝƚŚ ƚŚĞ ĞǀĞůŽƉĞƌ ŽŵŵŝƚŵĞŶƚƐĚĞƚĂŝůĞĚŝŶƚŚĞDWhKƌĚŝŶĂŶĐĞηϭϮͲϭϮ͕ĂƐŵĂǇďĞĂŵĞŶĚĞĚ͕ƚŚĞĚĞǀĞůŽƉŵĞŶƚƐŚĂůůĂďŝĚĞ ďǇ^ĞĐƚŝŽŶϲ͘ϬϮ͘ϬϮŽĨƚŚĞ>ŝŶƌĞŐĂƌĚƐƚŽdƌĂŶƐƉŽƌƚĂƚŝŽŶĞŵĂŶĚ DĂŶĂŐĞŵĞŶƚ ;dDͿƐƚƌĂƚĞŐŝĞƐ ƌĞƋƵŝƌĞĚĨŽƌĂƉƌŽũĞĐƚƚŚĂƚĂĨĨĞĐƚƐĂd͘ WŽůŝĐǇϱ͘ϭŽĨƚŚĞŽůůŝĞƌŽƵŶƚǇdƌĂŶƐƉŽƌƚĂƚŝŽŶůĞŵĞŶƚŽĨƚŚĞ'ƌŽǁƚŚDĂŶĂŐĞŵĞŶƚWůĂŶ;'DWͿƐƚĂƚĞƐ ƚŚĂƚ͞ƚŚĞŽƵŶƚǇŽŵŵŝƐƐŝŽŶƐŚĂůůƌĞǀŝĞǁĂůůƌĞǌŽŶĞƉĞƚŝƚŝŽŶƐ͕^ZĚĞƐŝŐŶĂƚŝŽŶĂƉƉůŝĐĂƚŝŽŶƐ͕ĐŽŶĚŝƚŝŽŶĂů ƵƐĞƉĞƚŝƚŝŽŶƐ͕ĂŶĚƉƌŽƉŽƐĞĚĂŵĞŶĚŵĞŶƚƐƚŽƚŚĞ&ƵƚƵƌĞ>ĂŶĚhƐĞůĞŵĞŶƚ;&>hͿĂĨĨĞĐƚŝŶŐƚŚĞŽǀĞƌĂůů ĐŽƵŶƚǇǁŝĚĞĚĞŶƐŝƚǇŽƌŝŶƚĞŶƐŝƚǇŽĨƉĞƌŵŝƐƐŝďůĞĚĞǀĞůŽƉŵĞŶƚ͕ǁŝƚŚĐŽŶƐŝĚĞƌĂƚŝŽŶŽĨƚŚĞŝƌŝŵƉĂĐƚŽŶƚŚĞ ŽǀĞƌĂůůŽƵŶƚǇƚƌĂŶƐƉŽƌƚĂƚŝŽŶƐǇƐƚĞŵ͕ĂŶĚƐŚĂůůŶŽƚĂƉƉƌŽǀĞĂŶǇƉĞƚŝƚŝŽŶŽƌĂƉƉůŝĐĂƚŝŽŶƚŚĂƚǁŽƵůĚĚŝƌĞĐƚůǇ 9.A.2.d Packet Pg. 409 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϭϱ ĂĐĐĞƐƐĂĚĞĨŝĐŝĞŶƚƌŽĂĚǁĂǇƐĞŐŵĞŶƚĂƐŝĚĞŶƚŝĨŝĞĚŝŶƚŚĞĐƵƌƌĞŶƚh/ZŽƌŝĨŝƚŝŵƉĂĐƚƐĂŶĂĚũĂĐĞŶƚƌŽĂĚǁĂǇ ƐĞŐŵĞŶƚƚŚĂƚŝƐĚĞĨŝĐŝĞŶƚĂƐŝĚĞŶƚŝĨŝĞĚŝŶƚŚĞĐƵƌƌĞŶƚh/Z͕ŽƌǁŚŝĐŚƐŝŐŶŝĨŝĐĂŶƚůǇŝŵƉĂĐƚƐĂƌŽĂĚǁĂǇ ƐĞŐŵĞŶƚŽƌĂĚũĂĐĞŶƚƌŽĂĚǁĂǇƐĞŐŵĞŶƚƚŚĂƚŝƐĐƵƌƌĞŶƚůǇŽƉĞƌĂƚŝŶŐĂŶĚͬŽƌŝƐƉƌŽũĞĐƚĞĚƚŽŽƉĞƌĂƚĞďĞůŽǁ ĂŶĂĚŽƉƚĞĚ>ĞǀĞůŽĨ^ĞƌǀŝĐĞ^ƚĂŶĚĂƌĚǁŝƚŚŝŶƚŚĞĨŝǀĞǇĞĂƌh/ZƉůĂŶŶŝŶŐƉĞƌŝŽĚ͕ƵŶůĞƐƐƐƉĞĐŝĨŝĐŵŝƚŝŐĂƚŝŶŐ ƐƚŝƉƵůĂƚŝŽŶƐĂƌĞĂůƐŽĂƉƉƌŽǀĞĚ͘͟ dŚĞĂŶĂůǇǌĞĚƌŽĂĚǁĂǇŶĞƚǁŽƌŬŝƐƉƌŽũĞĐƚĞĚƚŽŽƉĞƌĂƚĞĂƚĂĐĐĞƉƚĂ ďůĞ>K^ĂƚĨƵƚƵƌĞϮϬϮϱƚƌĂĨĨŝĐĐŽŶĚŝƚŝŽŶƐ͘ dŚĞƌĞĨŽƌĞ͕ƚŚĞƐƵďũĞĐƚWhĂŵĞŶĚŵĞŶƚŝƐĚĞƚĞƌŵŝŶĞĚƚŽďĞĐŽŶƐŝƐƚĞŶƚǁŝƚŚWŽůŝĐǇϱ͘ϭŽĨƚŚĞ dƌĂŶƐƉŽƌƚĂƚŝŽŶůĞŵĞŶƚŽĨƚŚĞ'ƌŽǁƚŚDĂŶĂŐĞŵĞŶƚWůĂŶ͘ Site Access Turn Lane Analysis dŚĞ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůƉƌŽũĞĐƚƉƌŽƉŽƐĞƐĂĨƵůůŵŽǀĞŵĞŶƚĐŽŶŶĞĐƚŝŽŶƚŽĂǇƐŚŽƌĞƌŝǀĞǀŝĂĂŶĞǁŝŶƚĞƌŶĂů ƌŽĂĚǁĂǇ͘/ŶĂĚĚŝƚŝŽŶ͕ƚŚĞƉƌŽũĞĐƚǁŝůůƵƚŝůŝǌĞĞǆŝƐƚŝŶŐŝŶƚĞƌŶĂůƌŽĂĚǁĂǇƐǁŝƚŚŝŶƚŚĞďŽƵŶĚĂƌŝĞƐŽĨƚŚĞWh ƚŽĐŽŶŶĞĐƚƚŽdŚŽŵĂƐƐŽŶƌŝǀĞĂƚƚŚĞĞǆŝƐƚŝŶŐĨƵůůŵŽǀĞŵĞŶƚĂĐĐĞƐƐ͘ dƵƌŶůĂŶĞůĞŶŐƚŚƐƌĞƋƵŝƌĞĚĂƚĨƵƚƵƌĞďƵŝůĚͲŽƵƚĐŽŶĚŝƚŝŽŶƐĂƌĞĂŶĂůǇǌĞĚďĂƐĞĚŽŶƚŚĞŶƵŵďĞƌŽĨƚƵƌŶŝŶŐ ǀĞŚŝĐůĞƐǁŝƚŚŝŶƚŚĞDĂŶĚWDƉĞĂŬŚŽƵƌƚƌĂĨĨŝĐ͘dŚĞĞƐƚŝŵĂƚĞĚƉƌŽũĞĐƚƚƌŝƉƐĂƚĂĐĐĞƐƐůŽĐĂƚŝŽŶĂƌĞ ŝůůƵƐƚƌĂƚĞĚŝŶƉƉĞŶĚŝǆ͗WƌŽũĞĐƚdƵƌŶŝŶŐDŽǀĞŵĞŶƚƐǆŚŝďŝƚƐ͘ WƌŽũĞĐƚĂĐĐĞƐƐŝƐĞǀĂůƵĂƚĞĚĨŽƌƚƵƌŶůĂŶĞǁĂƌƌĂŶƚƐďĂƐĞĚŽŶƚŚĞŽůůŝĞƌŽƵŶƚǇZŝŐŚƚͲŽĨͲǁĂǇDĂŶƵĂů͗;ĂͿ ƚǁŽͲůĂŶĞƌŽĂĚǁĂǇƐʹϰϬǀƉŚĨŽƌƌŝŐŚƚͲƚƵƌŶůĂŶĞͬϮϬǀƉŚĨŽƌůĞĨƚͲƚƵƌŶůĂŶĞ͖;ďͿŵƵůƚŝͲůĂŶĞĚŝǀŝĚĞĚƌŽĂĚǁĂǇƐʹ ƌŝŐŚƚƚƵƌŶůĂŶĞƐƐŚĂůůĂůǁĂǇƐďĞƉƌŽǀŝĚĞĚ͖ĂŶĚ;ĐͿǁŚĞŶŶĞǁŵĞĚŝĂŶŽƉĞŶŝŶŐƐĂƌĞƉĞƌŵŝƚƚĞĚ͕ƚŚĞǇƐŚĂůů ĂůǁĂǇƐŝŶĐůƵĚĞůĞĨƚͲƚƵƌŶůĂŶĞƐ͘ ĂǇƐŚŽƌĞƌŝǀĞŝƐƵŶĚĞƌŽůůŝĞƌŽƵŶƚǇũƵƌŝƐĚŝĐƚŝŽŶ͘dŚŝƐƌŽĂĚǁĂǇŝƐĐƵƌƌĞŶƚůǇĂŶŽƌƚŚͲƐŽƵƚŚƵŶĚŝǀŝĚĞĚ ĐŽůůĞĐƚŽƌƚŽƚŚĞǁĞƐƚŽĨƚŚĞƐƵďũĞĐƚƉĂƌĐĞů͘dŚŝƐƌŽĂĚǁĂǇŚĂƐĂƉŽƐƚĞĚůĞŐĂůƐƉĞĞĚŽĨϯϬŵƉŚŝŶƚŚĞǀŝĐŝŶŝƚǇ ŽĨƉƌŽũĞĐƚ͘ĂƐĞĚŽŶ&Kd^ƚĂŶĚĂƌĚWůĂŶƐ/ŶĚĞǆϳϭϭͲϬϬϭ͕ĨŽƌĂĚĞƐŝŐŶƐƉĞĞĚŽĨϯϱŵƉŚ͕ƚŚĞŵŝŶŝŵƵŵ ƚƵƌŶůĂŶĞůĞŶŐƚŚŝƐϭϰϱĨĞĞƚ;ǁŚŝĐŚŝŶĐůƵĚĞƐĂϱϬĨŽŽƚƚĂƉĞƌͿƉůƵƐƌĞƋƵŝƌĞĚƋƵĞƵĞ͘ dŚĞWhƉƌŽũĞĐƚŝƐĞǆƉĞĐƚĞĚƚŽŐĞŶĞƌĂƚĞϭϲǀƉŚĂŶĚϱϰǀƉŚŝŶďŽƵŶĚůĞĨƚͲƚƵƌŶŝŶŐŵŽǀĞŵĞŶƚƐĚƵƌŝŶŐƚŚĞ DĂŶĚWDƉĞĂŬŚŽƵƌ͕ƌĞƐƉĞĐƚŝǀĞůǇ͕ǁŚŝĐŚŝƐĂďŽǀĞƚŚĞϮϬǀƉŚƚŚƌĞƐŚŽůĚ͘/ŶĂĚĚŝƚŝŽŶ͕ƚŚĞĞǆŝƐƚŝŶŐ ĂƉƉƌŽǀĞĚ^ĂďůĞĂǇDWhŝƐĞǆƉĞĐƚĞĚƚŽŐĞŶĞƌĂƚĞϴϵǀƉŚĂŶĚϮϭϭǀƉŚŝŶďŽƵŶĚůĞĨƚͲƚƵƌŶŝŶŐŵŽǀĞŵĞŶƚƐ ĚƵƌŝŶŐƚŚĞDĂŶĚWDƉĞĂŬŚŽƵƌ͕ƌĞƐƉĞĐƚŝǀĞůǇ͘dŚĞĐŽŵďŝŶĞĚƐŽƵƚŚďŽƵŶĚ͕ůĞĨƚͲƚƵƌŶŝŶŐŵŽǀĞŵĞŶƚƐĂƚ ƚŚŝƐůŽĐĂƚŝŽŶŝƐϭϬϱǀƉŚĂŶĚϮϲϱǀƉŚŝŶďŽƵŶĚůĞĨƚͲƚƵƌŶŝŶŐŵŽǀĞŵĞŶƚƐĚƵƌŝŶŐƚŚĞDĂŶĚWDƉĞĂŬŚŽƵƌ͕ ƌĞƐƉĞĐƚŝǀĞůǇ͘ ĂǇƐŚŽƌĞƌŝǀĞŝƐĂŶŽͲŽƵƚůĞƚƌŽĂĚǁĂǇǁŝƚŚŵŝŶŝŵĂůŽƉƉŽƐŝŶŐƚƌĂĨĨŝĐĂƚƚŚŝƐůŽĐĂƚŝŽŶ͘/ŶĂĚĚŝƚŝŽŶ͕ƚŚŝƐ ĂĐĐĞƐƐƉƌŽǀŝĚĞƐĂĚĚŝƚŝŽŶĂůƐƚĂĐŬŝŶŐǁŝƚŚŝŶƚŚĞĚƌŝǀĞǁĂǇƚŚƌŽĂƚ͘ƵĞƚŽƚŚĞŶŽŽƵƚůĞƚ͕ůŽǁƐƉĞĞĚŶĂƚƵƌĞŽĨ ƚŚŝƐĐŽŶŶĞĐƚŝŽŶĂŶĚƚŚĞĂǀĂŝůĂďůĞƐƚĂĐŬŝŶŐŽŶƚŚĞƉƌŽũĞĐƚƉƌŽƉĞƌƚǇ͕ĂůĞĨƚͲƚƵƌŶůĂŶĞŝŶƚŽƚŚĞƉƌŽũĞĐƚŝƐŶŽƚ ƌĞĐŽŵŵĞŶĚĞĚĂƚƚŚŝƐůŽĐĂƚŝŽŶ͘ /ŶĂĚĚŝƚŝŽŶ͕ŝĨĂǇƐŚŽƌĞƌŝǀĞŝƐĞǆƚĞŶĚĞĚŝŶƚŚĞĨƵƚƵƌĞ͕ƚŚĞĚĞǀĞůŽƉĞƌŝƐƌĞƐƉŽŶƐŝďůĞĨŽƌƚŚĞĐŽƐƚŽĨ ĐŽŶƐƚƌƵĐƚŝŽŶŽĨƚŚĞůĞĨƚͲƚƵƌŶůĂŶĞĂƐǁĞůůĂƐĐŽŵƉĞŶƐĂƚŝŶŐƌŝŐŚƚͲŽĨͲǁĂǇĂƐĂĚĞǀĞůŽƉĞƌĐŽŵŵŝƚŵĞŶƚ͘ dŚŽŵĂƐƐŽŶƌŝǀĞŝƐƵŶĚĞƌŽůůŝĞƌŽƵŶƚǇũƵƌŝƐĚŝĐƚŝŽŶ͘dŚŝƐƌŽĂĚǁĂǇŝƐĐƵƌƌĞŶƚůǇĂŶĞĂƐƚͲǁĞƐƚƵƌďĂŶ ĚŝǀŝĚĞĚŵĂũŽƌĐŽůůĞĐƚŽƌĂŶĚŚĂƐĂƉŽƐƚĞĚůĞŐĂůƐƉĞĞĚŽĨϯϱŵƉŚŝŶƚŚĞǀŝĐŝŶŝƚǇŽĨƉƌŽũĞĐƚ͘ 9.A.2.d Packet Pg. 410 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϭϲ dŚĞƉƌŽũĞĐƚŝƐĞǆƉĞĐƚĞĚƚŽŐĞŶĞƌĂƚĞϭϲǀƉŚĂŶĚϱϰǀƉŚŝŶďŽƵŶĚůĞĨƚͲƚƵƌŶŝŶŐŵŽǀĞŵĞŶƚƐĚƵƌŝŶŐƚŚĞDĂŶĚ WDƉĞĂŬŚŽƵƌ͕ƌĞƐƉĞĐƚŝǀĞůǇ͘ƚƚŚĞŵŝŶŝŵƵŵ͕ƚŚĞǁĞƐƚďŽƵŶĚůĞĨƚͲƚƵƌŶůĂŶĞƐŚŽƵůĚďĞϭϵϱĨĞĞƚůŽŶŐ;ϭϰϱ ĨĞĞƚĚĞĐĞůĞƌĂƚŝŽŶůĂŶĞǁŝƚŚƚĂƉĞƌĂŶĚϱϬĨĞĞƚŽĨƐƚŽƌĂŐĞͿ͘ dŚĞĞǆŝƐƚŝŶŐĞĂƐƚďŽƵŶĚůĞĨƚͲƚƵƌŶůĂŶĞƐĞƌǀŝĐŝŶŐƚŚŝƐĂĐĐĞƐƐŝƐĂƉƉƌŽǆŝŵĂƚĞůǇϮϲϬĨĞĞƚůŽŶŐ͘ƐƐƵĐŚ͕ƚŚĞ ĞǆŝƐƚŝŶŐůĞĨƚͲƚƵƌŶůĂŶĞŽŶdŚŽŵĂƐƐŽŶƌŝǀĞŝƐĂĚĞƋƵĂƚĞƚŽĂĐĐŽŵŵŽĚĂƚĞƉƌŽũĞĐƚĞĚ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞů ƚƌĂĨĨŝĐĂƚďƵŝůĚͲŽƵƚĐŽŶĚŝƚŝŽŶƐ͘ ĂƐĞĚŽŶƉƌŽũĞĐƚĞĚƚƌĂĨĨŝĐǀŽůƵŵĞ͕ĂƌŝŐŚƚͲƚƵƌŶůĂŶĞĂƚƚŚŝƐůŽĐĂƚŝŽŶŝƐŶŽƚǁĂƌƌĂŶƚĞĚ͘ Improvement Analysis dŚĞƉƌŽũĞĐƚ͛ƐŝŵƉĂĐƚƐĂƌĞƐŝŐŶŝĨŝĐĂŶƚŽŶĂǇƐŚŽƌĞƌŝǀĞĂŶĚdŚŽŵĂƐƐŽŶƌŝǀĞ͘EŽŶĞŽĨƚŚĞŽƚŚĞƌĂŶĂůǇǌĞĚ ƌŽĂĚǁĂǇƐĞŐŵĞŶƚƐĂƌĞƐŝŐŶŝĨŝĐĂŶƚůǇŝŵƉĂĐƚĞĚďǇƚŚĞƉƌŽũĞĐƚ͘EŽ ŶĞŽĨƚŚĞĂŶĂůǇǌĞĚƌŽĂĚǁĂǇƐĞŐŵĞŶƚƐĂƌĞ ƉƌŽũĞĐƚĞĚƚŽŽƉĞƌĂƚĞŝŶĞǆĐĞƐƐŽĨƚŚĞŝƌ>K^ĐĂƉĂĐŝƚǇƵŶĚĞƌĨƵƚƵƌĞϮϬϮϱĐŽŶĚŝƚŝŽŶƐ͕ǁŝƚŚŽƌǁŝƚŚŽƵƚƚŚĞ ƉƌŽũĞĐƚ͘ ĂƐĞĚƵƉŽŶƚŚĞƌĞƐƵůƚƐŽĨƚƵƌŶůĂŶĞĂŶĂůǇƐŝƐƉĞƌĨŽƌŵĞĚǁŝƚŚŝŶƚŚŝƐƌĞƉŽƌƚ͕ƚƵƌŶůĂŶĞŝŵƉƌŽǀĞŵĞŶƚƐĂƌĞŶŽƚ ƌĞĐŽŵŵĞŶĚĞĚĂƚƚŚĞƉƌŽũĞĐƚĂĐĐĞƐƐŽŶĂǇƐŚŽƌĞƌŝǀĞ͘ /ŶĂĚĚŝƚŝŽŶ͕ƚŚĞĞǆŝƐƚŝŶŐǁĞƐƚďŽƵŶĚůĞĨƚͲƚƵƌŶůĂŶĞĂƚƚŚĞƉƌŽũĞĐƚĂĐĐĞƐƐŽŶƚŽdŚŽŵĂƐƐŽŶƌŝǀĞŝƐĂĚĞƋƵĂƚĞ ƚŽĂĐĐŽŵŵŽĚĂƚĞƚƌĂĨĨŝĐĂƚďƵŝůĚͲŽƵƚĐŽŶĚŝƚŝŽŶƐ͘ dŚĞŵĂǆŝŵƵŵƚŽƚĂůĚĂŝůǇƚƌŝƉŐĞŶĞƌĂƚŝŽŶĨŽƌƚŚĞ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞů ;ƉĂƌĐĞů ŝĚĞŶƚŝĨŝĐĂƚŝŽŶ ŶƵŵďĞƌƐ ϲϭϴϯϴϮϰϬϬϬϬ͕ ϲϭϴϯϮϬϭϬϬϳ͕ ϲϭϴϯϴϮϬϬϬϬϴ͕ ϲϭϴϯϴϭϲϬϬϬϵ͕ ϲϭϴϯϴϭϮϬϬϬϳĂŶĚ ϲϭϴϯϴϬϴϬϬϬϴͿ ƐŚĂůů ŶŽƚ ĞǆĐĞĞĚϭϳϮƚǁŽͲǁĂǇWDƉĞĂŬŚŽƵƌŶĞƚŶĞǁƚƌŝƉƐďĂƐĞĚŽŶƚŚĞƵƐĞĐŽĚĞƐŝŶƚŚĞ/dŵĂŶƵĂůŽŶƚƌŝƉ ŐĞŶĞƌĂƚŝŽŶƌĂƚĞƐŝŶĞĨĨĞĐƚĂƚƚŚĞƚŝŵĞŽĨĂƉƉůŝĐĂƚŝŽŶĨŽƌ^Wͬ^WŽƌƐƵďĚŝǀŝƐŝŽŶƉůĂƚĂƉƉƌŽǀĂů͘ Mitigation of Impact dŚĞĚĞǀĞůŽƉĞƌƉƌŽƉŽƐĞƐƚŽƉĂǇƚŚĞĂƉƉƌŽƉƌŝĂƚĞŽůůŝĞƌŽƵŶƚǇZŽĂĚ/ŵƉĂĐƚ&ĞĞĂƐďƵŝůĚŝŶŐƉĞƌŵŝƚƐĂƌĞ ŝƐƐƵĞĚĨŽƌƚŚĞƉƌŽũĞĐƚ͘ 9.A.2.d Packet Pg. 411 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϭϳ Appendix A: Project Master Site Plan 9.A.2.d Packet Pg. 412 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϭϴ 9.A.2.d Packet Pg. 413 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϭϵ Appendix B: Initial Meeting Checklist (Methodology Meeting) 9.A.2.d Packet Pg. 414 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϮϬ 9.A.2.d Packet Pg. 415 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϮϭ 9.A.2.d Packet Pg. 416 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϮϮ 9.A.2.d Packet Pg. 417 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϮϯ 9.A.2.d Packet Pg. 418 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϮϰ 9.A.2.d Packet Pg. 419 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϮϱ Appendix C: Trip Generation Calculations ITE 10th Edition 9.A.2.d Packet Pg. 420 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϮϲ 9.A.2.d Packet Pg. 421 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϮϳ 9.A.2.d Packet Pg. 422 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϮϴ 9.A.2.d Packet Pg. 423 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϮϵ ^ĂďůĞĂǇDWhƵŝůĚŽƵƚŽŶĚŝƚŝŽŶƐ 9.A.2.d Packet Pg. 424 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϯϬ 9.A.2.d Packet Pg. 425 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϯϭ 9.A.2.d Packet Pg. 426 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϯϮ 9.A.2.d Packet Pg. 427 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϯϯ 9.A.2.d Packet Pg. 428 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϯϰ 9.A.2.d Packet Pg. 429 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϯϱ 9.A.2.d Packet Pg. 430 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϯϲ 9.A.2.d Packet Pg. 431 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϯϳ 9.A.2.d Packet Pg. 432 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϯϴ 9.A.2.d Packet Pg. 433 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϯϵ 9.A.2.d Packet Pg. 434 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϰϬ 9.A.2.d Packet Pg. 435 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϰϭ Appendix D: Traffic Count Exhibits 9.A.2.d Packet Pg. 436 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϰϮ 9.A.2.d Packet Pg. 437 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϰϯ 9.A.2.d Packet Pg. 438 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϰϰ Appendix E: Project Turning Movements Exhibits 9.A.2.d Packet Pg. 439 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϰϱ 9.A.2.d Packet Pg. 440 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /ƐůĞƐŽĨŽůůŝĞƌWƌĞƐĞƌǀĞʹ&ůĞŝƐĐŚŵĂŶŶWĂƌĐĞůʹWhʹd/^ʹDĂƌĐŚϮϬϮϬ dƌĞďŝůĐŽĐŬŽŶƐƵůƚŝŶŐ^ŽůƵƚŝŽŶƐ͕WWĂŐĞͮϰϲ 9.A.2.d Packet Pg. 441 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Es/ZKEDEd>d 9.A.2.d Packet Pg. 442 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Project No. 04WCI1042 ISLES OF COLLIER PRESERVE MIXED-USE PLANNED UNIT DEVELOPMENT FLEISCHMANN PARCEL AMENDMENT ENVIRONMENTAL DATA December 2019 Revised May 2020 Prepared For: Minto Communities, LLC 3DUN2DNV%RXOHYDUG6XLWH 7DPSD)ORULGD Prepared By: Passarella & Associates, Inc. 0HWURSROLV$YHQXH6XLWH )RUW0\HUV)ORULGD 9.A.2.d Packet Pg. 443 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann i TABLE OF CONTENTS Page Introduction ....................................................................................................................................1 Environmental Data Author ...........................................................................................................1 Vegetation Mapping.......................................................................................................................1 Vegetation Descriptions .................................................................................................................2 Listed Species Survey ....................................................................................................................2 Native Vegetation Requirement .....................................................................................................2 Project Impacts...............................................................................................................................3 Soils................................................................................................................................................3 Environmental Site Assessment .....................................................................................................4 Preserve Management Plan ............................................................................................................4 References ......................................................................................................................................4 9.A.2.d Packet Pg. 444 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann ii LIST OF EXHIBITS Page Exhibit 1. Project Location Map ......................................................................................... E1-1 Exhibit 2. Environmental Data Submittal Preparer’s Resume ........................................... E2-1 Exhibit 3. Aerial with FLUCFCS and Wetlands Map ........................................................ E3-1 Exhibit 4. FLUCFCS Descriptions ..................................................................................... E4-1 Exhibit 5. Native Vegetation Map ...................................................................................... E5-1 Exhibit 6. Listed Species Survey ........................................................................................ E6-1 Exhibit 7. Isles of Collier Preserve Bald Eagle Nesting History ........................................ E7-1 Exhibit 8. Florida Bonneted Bat Survey ............................................................................. E8-1 Exhibit 9. UMAM Functional Analysis.............................................................................. E9-1 Exhibit 10. Wetland Impact Map........................................................................................ E10-1 Exhibit 11. Soils Map ......................................................................................................... E11-1 Exhibit 12. Water Level Nail Elevation Summary ............................................................. E12-1 Exhibit 13. Preserve Area Management Plan ..................................................................... E13-1 9.A.2.d Packet Pg. 445 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 1 INTRODUCTION The following environmental data is provided by Passarella & Associates, Inc. (PAI) in support of the Isles of Collier Preserve land use petition for an amendment to the existing Mixed-Use Planned Unit Development (MPUD). The amendment proposes to add the Fleischmann Parcel (Project) to the MPUD. The following information is being provided in accordance with the Collier County environmental data submittal requirements outlined in Section 3.08.00.A of the Collier County Land Development Code (LDC). The Project is located southeast of the intersection of Holly Avenue and Bayshore Drive and west of the Avalon Outfall Canal in Sections 23 and 26, Township 50 South, Range 25 East, Collier County (Exhibit 1). The Project is comprised of five Collier County Parcel Nos.: 61838201007, 61838200008, 61838160009, 61838120007, and 61838080008. The following report includes details regarding the author of this report, vegetation descriptions for the various habitats on-site, results of the listed species surveys conducted by PAI, and the Project’s native vegetation preservation information. ENVIRONMENTAL DATA AUTHOR This environmental data report was prepared by Andrew Woodruff, a Senior Ecologist with Passarella & Associates, Inc. with over 26 years of experience as a professional environmental consultant. Mr. Woodruff holds a Bachelor of Science degree from Emory University and a Master of Science degree from the University of Florida. He satisfies the environmental credential and experience requirements for preparing the environmental data report, per Section 3.08.00.A.2 of the Collier County LDC. His resume is attached as Exhibit 2. VEGETATION MAPPING A FLUCFCS and wetlands map of the property is provided as Exhibit 3. The Project’s existing land uses include undeveloped native upland and wetland habitats with varying degrees of exotic infestation. The vegetation associations and land uses were delineated using December 2018 rectified color aerials (Scale: 1" = 200') and groundtruthing conducted in July 2019. The delineations were classified based on the nomenclature of the Florida Land Use, Cover and Forms Classification System (FLUCFCS) Levels III and IV (Florida Department of Transportation 1999). Level IV FLUCFCS was utilized to denote disturbance and “E” codes were used to identify levels of exotic species invasion (i.e., melaleuca (0HODOHXFD TXLQTXHQHUYLD), downy rose-myrtle (5KRGRP\UWXV WRPHQWRVD), and Brazilian pepper (6FKLQXV WHUHELQWKLIROLXV)). AutoCAD Map 3D 2017 software was used to determine the acreage of each mapped polygon, produce summaries, and generate the final FLUCFCS map. 9.A.2.d Packet Pg. 446 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 2 VEGETATION DESCRIPTIONS A description of land use and vegetation communities associated with each FLUCFCS type are provided in Exhibit 4. The dominant habitat types on the property are disturbed pine flatwoods (FLUCFCS Codes 4119 E4 and 6259 E4). The Project site contains 53.7± acres of South Florida Water Management District (SFWMD) jurisdictional wetlands (Exhibit 3). Wetlands were verified by SFWMD staff in October 2019. The SFWMD wetland limits have been survey- located. A native vegetation map of the Project is included as Exhibit 5. Native vegetation communities contain varying levels of exotic vegetation including, but not limited to, Brazilian pepper, melaleuca, and downy rose-myrtle. Native vegetation communities are dominated by exotic vegetation in the understory and ground cover but retain sufficient native canopy cover to meet native status by County definition. Dominant native vegetation communities include Pine Flatwoods, Disturbed (76-100% Exotics) (FLUCFCS Code 4119 E4) and Pine, Hydric, Disturbed (76-100% Exotics) (FLUCFCS Code 6259 E4). Non-native vegetation includes a small area of drainage canal and less than one acre of area dominated by a canopy of melaleuca located in Pine, Hydric, Disturbed (76-100% Exotics) (FLUCFCS Code 6259 E4). LISTED SPECIES SURVEY Listed species observed nesting or denning on the Project have been limited to gopher tortoise (*RSKHUXVSRO\SKHPXV) (Exhibit 6). Gopher tortoises and their habitat are located on the north side of the Project. No Rare listed plants were observed on-site. Less Rare plant species observed on-site included regulated stiff-leaved wild pine (7LOODQGVLD IDVFLFXODWD), twisted airplant (7LOODQGVLDIOH[XRVD), and butterfly orchid ((QF\FOLDWDPSHQVLV). The property contains habitat with the potential to contain other regulated plants as defined by the Collier County LDC and Florida Administrative Code Chapter 5B-40. Other regulated plants with the potential to occur in the proposed preserve area include Less Rare species giant wild pine (7LOODQGVLDXWULFXODWD) and inflated wild pine (7LOODQGVLDEDOELVLDQD). There are several known bald eagle nesting sites located within the Isles of Collier Preserve MPUD. The Project is not located within 660 feet of any of these known bald eagle nesting sites (Exhibit 7). The acoustic survey for Florida bonneted bat ((XPRSVIORULGDQXV) was negative (Exhibit 8). NATIVE VEGETATION REQUIREMENT The native vegetation map depicts 101.57± acres of habitat having 25 percent or more canopy coverage (or highest existing vegetative strata) of native plant species (Exhibit 5). The preserve provides greater than 29 acres of native vegetation, exceeding the 25 percent native vegetation retention requirement (25% x 101.57 = 25.39 acres). 9.A.2.d Packet Pg. 447 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 3 Preserves were selected to include the largest contiguous area possible. Wetland preserves are contiguous across off-site lands that include mostly wetland vegetation, including mangrove, that make them highly unlikely to be permitted for future impact. The Project is compliant with the preserve selection criteria pursuant to Conservation and Coastal Management Element (CCME) Policy 6.1.1.(4); and LDC 3.05.07.A.4 by preserving: xThe majority of the Project’s wetland habitats. These areas include the higher-quality wetland habitats located in the southern half of the property which are known to be utilized by listed species, including documented occurrences of protected plants. xAreas of mangrove and buttonwood swamp located on the south side of the site that provide potential foraging habitat for listed wading birds. xThe south end of the Project’s preserve will be interconnected to existing conservation lands that are being deeded to Rookery Bay National Estuarine Research Reserve and will help preserve a corridor for wildlife movement. xNative upland pine habitats that serve as buffers to wetlands. xCypress/pine/cabbage palm, pine flatwoods, and other native habitats. A summary table of Uniform Mitigation Assessment Methodology (UMAM) scores is included in the UMAM Functional Analysis attached as Exhibit 9. The scores have been prepared to comply with Florida Administrative Code Chapter 62-345 which establishes a standardized procedure for assessing functions provided by wetlands. The SFWMD will be responsible for verifying the information as part of the Environmental Resource Permit review. In general, native wetland habitats located on the south side of the Project are less hydrologically disturbed; have less exotic species disturbance; have better natural buffers; and are assessed a slightly higher functionality. PROJECT IMPACTS The Project directs wetland impacts away from the large interconnected higher quality wetland system located on the south side of the site (CCME Policy 6.2.5). The majority of wetland impacts are associated with low quality wetlands previously impacted by adjacent development on the Project’s north and east sides (Exhibit 10). A 25-foot upland/structural buffer is being provided for preserved wetlands, except in locations where wetlands are proposed for direct impact resulting from site plan constraints. Preserved wetlands which are partially impacted by site improvements will provide structural buffers (berm, hedge, fence, etc.) in accordance with Environmental Resource Permit criteria. To compensate for direct and secondary wetland impacts, the applicant intends to provide full functional replacement value in accordance with an approved Environmental Resource Permit that will provide for a conservation easement, exotic removal, and maintenance of both upland and wetland habitat areas. 9.A.2.d Packet Pg. 448 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4 Gopher tortoises located in development areas are proposed to be relocated off-site in accordance with Florida Fish and Wildlife Conservation Commission permit conditions. The Project proposes to protect the majority of the wetland habitats which are known to be utilized by listed species, including documented occurrences of protected plants including butterfly orchid, stiff- leaved wild pine, and twisted air plant. The preserves abut a large contiguous area on the south side of the Project that supports existing wildlife habitat and conservation lands. SOILS A soils map prepared by the Natural Resources Conservation Service is enclosed as Exhibit 11. ENVIRONMENTAL SITE ASSESSMENT The Project is undeveloped land. A Phase I Environmental Site Assessment is not required. PRESERVE MANAGEMENT PLAN The Project shall be designed in accordance with SFWMD rules that apply to the Environmental Resource Permit program under Part IV of Chapter 373 of the Florida Statutes. The detention and control elevations shall be set to protect surrounding wetlands and be consistent with surrounding land and project control elevations and water tables. Biological indicators of wetland water levels were field located (Exhibit 9A) and subsequently surveyed to determine their elevations (Exhibit 12). The preserve area contains native vegetation in excess of retention requirements. Native vegetation required for preservation requirements will be maintained in accordance with the Preserve Area Management Plan attached as Exhibit 13. The preserve areas contain existing at-grade trails that will be utilized for passive recreational purposes consistent with the intent and purpose of the conservation easement. Mowing, trimming overhanging vegetation, and debris cleanup may be conducted as needed to maintain existing at- grade trails so they remain accessible for passive recreational use. There are no new trails or proposed improvements to existing trails that would result in loss of native vegetation. Mowing at-grade trails will be limited to a maximum width of ten feet. Trimmings will be taken to an on- site upland area of development and disposed of in an appropriate manner through either burning or mulching. REFERENCES Florida Department of Transportation. 1999. Florida Land Use, Cover and Forms Classification System. Procedure No. 550-010-001-a. Second Edition. 9.A.2.d Packet Pg. 449 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann EXHIBIT 1 PROJECT LOCATION MAP 9.A.2.d Packet Pg. 450 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 5(9,(:('%< '5$:1%< 5(9,6(' '$7( '$7( '$7( :+,7$.(55':+,7$.(55'//$$..((::2222''%%//99''99((552211$$::$$//..&&,,55 0$1$7((5'0$1$7((5'7755((99,,6622%%$$<<%%//99''&2817<%$515'&2817<%$515'&23(/1&23(/1 &5(:65'&5(:65' 1'$9(11'$9(1 00$$55 66++''555588005522::77 ++$$99 ((11 33 22 ////<<$$99((3$/0'53$/0'5&&55$$<<77221155''/(%8))65'/(%8))65'%(1),(/'5'%(1),(/'5')/25,'$1$9()/25,'$1$9(66$$11''33,,33((556677&(175$/$9(&(175$/$9(0088 66 ((22&&,,55..,,11**66::$$<</,9,1*67215'/,9,1*67215'1'$9(6:1'$9(6:11$$33//((66++((55,,77 $$**((''555'6765'676&&//88 %%((6677$$77((66''55&&((555522 00$$55''55::,,//''))//22::((55 ::$$<<*8/)6+25(%/9'6*8/)6+25(%/9'6**$$////((2211''5577 ++$$99((66 *5((1:$<5'*5((1:$<5'//((//<<55((66225577%%//99''&&((//((6677((''557+6717+671**//((11(($$**//((%%//99''$,5325738//,1*5'6$,5325738//,1*5'611 22 55 77 ++55 '' 77 ++22 00 $$66 662211 ''55 %%$$55(())222277::,,////,,$$006655''**55$$11''//((//<<''5566$$,,11 77 $$11 ''55 ((::66%%//99''$$99,,$$00 $$55 &&,,55::++,,77((//$$..((%%//99'' ..,,11**66//$$..((%%//99''66 $$%%$$//33 $$//00 55 ''**2255''2211''5566++((////,,66//$$11''55''&2//,(5%/9'65&2//,(5%/9'65)),,''''//((5566&&55((((..33 ..::<<6$17$%$5%$5$%/9'6$17$%$5%$5$%/9'55 $$77 77 //((66 11$$..((++$$00 00 22 &&..55 '' 55 $$'',,22 55'' '$9,6%/9''$9,6%/9'&2//,(5%/9'&5&2//,(5%/9'&5(/ ;3EXIT 101§¨¦ Gulf of Mexico 6$1 0$5&2'5 2,/:(//5 '(9(5*/$'(6%/9'¿À ¿À ¿À ¿À ¿À (/ §¨¦ &2//,(5&2//,(5 /((/(( ^^^ ^ ^ ^ ^ ^ ^ ^^ ^ ^^ ^ ^ MIAMI TAMPA NAPLES ORLANDO KEY WEST SARASOTA PENSACOLA FORT MYERS VERO BEACH LAKE PLACID PANAMA CITY GAINESVILLE TALLAHASSEE JACKSONVILLE DAYTONA BEACH FORT LAUDERDALE¶ 352-(&7/2&$7,21 6(&7:3651*( (;+,%,7352-(&7/2&$7,210$3 5)'% $: )/(,6&+0$113$5&(/GULF OF MEXICO ,6/(62)&2//,(535(6(59(038' 9.A.2.d Packet Pg. 451 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann EXHIBIT 2 ENVIRONMENTAL DATA SUBMITTAL PREPARER’S RESUME 9.A.2.d Packet Pg. 452 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Andrew Woodruff Vice President & Senior Ecologist August 1997 - Present Offices in Florida and South Carolina 0HWURSROLV$YHQXH6XLWH)W0\HUV)/|:DQGR3ODFH'ULYH6XLWH0W3OHDVDQW6& ZZZSDVVDUHOODQHW Vice President and Senior Ecologist for Passarella & Associates, Inc., an ecological consulting firm providing environmental and ecological services. Services include state, federal, and local permitting; agency negotiations; environmental impact assessments; ecological assessments; listed species surveys, permitting and relocation; state and federal wetland jurisdictionals; wetland mitigation design, permitting and construction observations; wetland mitigation banking management, design, permitting and construction observations; and environmental project management. REPRESENTATIVE PROJECT EXPERIENCE AGRICULTURE SR 846 Land Trust, Collier County State permitting for agriculture and mining, county conditioned use permitting for mining and blasting, Florida Fish and Wildlife Conservation Commission permitting for burrowing owl, wetland mitigation assessment, and listed species survey for the 2,576± acre project. Big Cypress Stewardship District, Collier County Federally listed species surveys, including Florida panther, red-cockaded woodpecker, and Florida bonneted bat, for the 22,210± acre project. Minto West, Palm Beach County Listed species and camera trap surveys for the 3,800± acre project. Treeco Palm Nursery, Lee County Vegetation mapping, wetland jurisdictional determination, wetland mitigation assessment, listed species survey, state and federal permitting, and mitigation monitoring plans for the 141.88± acre project. COMMERCIAL & RESIDENTIAL DEVELOPMENT Stonewater, Lee County City of Cape Coral, Florida Fish and Wildlife Conservation Commission, and U.S. Fish and Wildlife Service bald eagle management plans, state and federal bald eagle disturbance permitting, environmental project management, ecological assessments, and county rezoning review for the 201± acre project. Estates at Entrada, Lee County State and federal permitting, listed species survey, wetland flagging, compliance monitoring, red-cockaded woodpecker surveys, Florida scrub jay surveys, wetland jurisdictional determinations, Florida Fish and Wildlife Conservation Commission coordination, U.S. Fish and Wildlife Service Section 7 Consultation, county development order applications and county rezone application. The Loop, Charlotte County Development of Regional Impact environmental impact studies, state and federal permitting, Florida Fish and Wildlife Conservation Commission gopher tortoise permitting, and U.S. Fish and Wildlife Service Section 7 Consultation for the 202.51± acre project. Isles of Collier Preserve, Collier County Wetland hydrologic assessment, vegetation mapping, listed species surveys, gopher tortoise relocation, wetland mitigation assessment, wetland jurisdictional determinations, state and federal permitting, and U.S. Fish and Wildlife Service Section 7 Consultation for Florida panther for the 2,331± acre project. Collier’s Reserve, Collier County Gopher tortoise surveys, relocation, and reporting. Mockingbird Crossing, Collier County Listed species surveys habitat management plans, restoration management plans, mitigation and monitoring plans, U.S. Fish and Wildlife Service Section 7 Consultation for bald eagle, wetland mitigation assessment, state permitting, exemption verification, and Transfer of Development Rights restoration and management plan for the 110.95± acre project. SR 80 CPD, Lee County Federal jurisdictional determination and federal permitting for the 25± (24.69) acre project. Sanibel Beach Place, Lee County Reflagging wetland lines, updated vegetation mapping, Lee County supplemental planting plan; state and federal coordination for this 34.62± acre project. Siesta V, Lee County Permitting and rezoning, listed species survey, Florida Department of Environmental Protection, U.S. Army Corps of Engineers, Lee County, and South Florida Water Management District coordination, cumulative effects analysis, homeowner’s environmental educational plan, and indigenous preserve management plan. 9.A.2.d Packet Pg. 453 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Andrew Woodruff Vice President & Senior Ecologist 2 |Page MARINE Aqua Pelican Isle Yacht Club, Collier County Benthic survey, biological evaluation, Collier County Environmental Impact Statement, intertidal planting and monitoring plan for marina, state and federal permitting, and U.S. Fish and Wildlife Service Section 7 Consultation for bald eagle and manatee for the 10.45± acre project. New River Yacht Club, Broward County Seagrass and benthic resource survey and state and federal permitting for the 1.36± acre project. Sanibel Causeway Span A, Lee County U.S. Fish and Wildlife Service Section 7 Consultation, bascule piers blast plan, blast event timeline and responsibility, turbidity monitoring plan, seagrass survey, mangrove survey for U.S. Coast Guard bridge permit, and listed species surveys. Hideaway Beach Renourishment and Erosion Control, Collier County Mangrove assessment, annual seagrass surveys, and Florida Department of Environmental Protection pre- and post- construction seagrass monitoring reports. Boca Grande Bridge Replacement, Charlotte County Wetland mitigation assessment, seagrass and wetland surveys, U.S. Coast Guard meetings, public informational meetings, and Wildlife and Habitat Evaluation Technical Memorandum as part of the alternative analysis study associated with the replacement of this bridge spanning two 80 foot wide navigation channels. Hurricane Pass, Pinellas County Seagrass survey for beach fill borrow area. MINING East Naples Mine, Collier County Environmental project management, vegetation mapping, wetland mitigation assessment, and state and federal permitting for the 2,250± acre project. Charlotte County Mine, Charlotte County Environmental project management, wetland jurisdictional determinations, listed species survey, wetland mitigation assessment, and state and federal permitting for the 700± acre project. FFD MEPD, Lee County Vegetation and wetland mapping, protected species surveys, mitigation assessment, cumulative effects analysis, county rezoning review, biological assessment, Florida Department of Environmental Protection wetland jurisdictional determination, state and federal permitting for the mining of this 5,209± acre project. OIL EXPLORATION Nobles Grade 3D Seismic Survey, Collier County State and federal permitting, National Park Service Plan of Operations and Environmental Assessment preparation and review, and U.S. Fish and Wildlife Service Section 7 Consultation for the proposed 3D seismic survey for the 70,540± acre survey area within the Big Cypress National Preserve. ROAD PROJECTS Tiger Grant State and federal permitting for bike and pedestrian path improvements, wetland jurisdictional determinations, exemption verifications, modifications of existing permits for Lee County Complete Streets Initiative, Financial Projects No. 435448-2, FHWA FY 2013 TIGER Grant No. 19 Alico Road Alignment Study Environmental site assessment including habitat, wetland, and other surface waters mapping, specific listed species surveys, wetland jurisdictional determinations, and U.S. Fish and Wildlife Service coordination for the right-of-way and easement study area for the future widening of Alico Road. Crystal-Plantation Roundabout Vegetation mapping, listed species surveys, mitigation plan for wetland impacts, and agency meetings for location assessment of the proposed roundabout. Bonita Beach Road Widening Environmental project management, wetland jurisdictional determinations, and state and federal permitting for road widening US 41 to Interstate 75. Imperial River Bridge Replacement, Lee County State and federal permitting for the bridge replacement over navigable waters. WETLAND MITIGATION BANKS Corkscrew Regional Mitigation Bank, Lee County Project management and mitigation oversight as Florida Department of Environmental Protection Qualified Mitigation Supervisor and state permit modifications for the 632.5± acre project. Jack’s Branch Wetland Mitigation Bank, Hendry County State and federal permitting, wetland mitigation assessment, and wetland mitigation design for the 475± acre project. 9.A.2.d Packet Pg. 454 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Andrew Woodruff Vice President & Senior Ecologist 3 |Page OTHER Haman Ranch, Hendry County State and federal permitting, wetland monitoring, wetland jurisdictional determinations, Florida panther habitat assessment, and U.S. Fish and Wildlife Service Section 7 Consultation Lely Area Stormwater Improvement Project, Collier County State and federal permitting, wetland mitigation design, wetland monitoring, U.S. Fish and Wildlife Service Section 7 Consultation, gopher tortoise relocation, wildlife surveys for the realignment of a 1.5± mile reconfiguration. East County Water Control District San Carlos Flow-Way, Lee County Ecological assessment, vegetation mapping, wetland jurisdictional determinations, protected species surveys, and state and federal permitting. PREVIOUS EXPERIENCE Ecologist Kevin L. Erwin Consulting Ecologists, Inc. (December 1992 – August 1997) Representative Projects Little Pine Island Wetland Mitigation Bank, Lee County FDEP Qualified Mitigation Supervisor for this wetland mitigation bank. Florida Gulf Coast University, Lee County Habitat mapping, listed species survey, wetland jurisdictional determinations, wildlife and listed plant inventory and Florida panther prey base study. Viera East ADA/DRI Listed species surveys including burrowing owl survey and habitat management plan; nesting season wildlife survey of 5,800 acres; gopher tortoise surveys, population estimates, and relocations; and Florida scrub jay survey and habitat management plan. CONTINUING EDUCATION Gopher Tortoise Certification Training Program, Wildlands Conservation, Inc., Tampa, Florida (2019) Wetland Soil Taxonomy (2018) Fundamental Hydric Soils (2017) Florida Wildlife Society Conference, Orlando, Florida (2017) National Mitigation & Ecosystem Banking Conference, Orlando, Florida (2015) NMBA Conservation Banking Webinar, Session II, Fort Myers, Florida (2014) Prescribed Fire Techniques for Wildlife, Orange Park, Florida (2014) Conservation Easement Webinar, SFWMD, Fort Myers, Florida (2014) Managing Visitors and Volunteers in Natural Areas, Natural Areas Training Academy, Melrose, Florida (2013) Summer Grass ID Workshop, Myakka River State Park, Sarasota, Florida (2013) Conservation Site Assessment & Planning, Natural Areas Training Academy, Melrose, Florida (2013) ULI/CBIA Post Legislative Update, Estero, Florida (2012) Exotic Species Workshop, FGCU, Fort Myers, Florida (2011) SFWMD Lower West Coast Partnering Water Use Permit Regulations for Consumptive Use Permits, Fort Myers, Florida (2011) Environmental LCD Amendments Workshop, Naples, Florida (2010) SW Florida Transportation Update, Fort Myers, Florida (2010) Working Across Boundaries to Protect Ecosystems, Natural Areas Training Academy, Apopka, Florida (2010) Managing for Diversity Across Florida’s Unique Landscapes, Natural Areas Training Academy, Orlando, Florida (2009) Smalltooth Sawfish Workshop, Fort Myers, Florida (2009) COE Regulatory Roadshow, Estero, Florida (2009) The Florida Chamber’s 23rd Annual Environmental Permitting Summer School, Marco Island, Florida (2009) Environmental Permitting 101-SFWMD, Fort Myers, Florida Florida Uniform Mitigation Assessment Method (UMAM) Short Course, University of Florida, Gainesville, Florida (2005) Creation and Restoration of Wetlands Course, The Ohio State University, held in Naples, Florida (2003) Master Wildlifer Program (2003) Gopher Tortoise Conservation Initiative, Gopher Tortoise Management and Mitigation Professional Training Program, Gainesville, Florida (2001) FAEP SW Florida Plant ID Seminar (1999) Dr. David Hall, Plant Identification Workshop (1999) Shorebird Seminar with Ted Below, Rookery Bay, Naples, Florida (1998) Florida Association of Benthologists Annual Keys Workshop, Keys Marine Laboratory, Long Key, Florida (1996) Interagency Basic Prescribed Fire Training, Hillsborough Community College (1993) 9.A.2.d Packet Pg. 455 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Andrew Woodruff Vice President & Senior Ecologist 4 |Page EDUCATION Master of Science, Environmental Engineering 1993 Major: Aquatic Science University of Florida, Gainesville, Florida Bachelor of Science, Biology 1989 Emory University, Atlanta, Georgia CERTIFICATIONS Certified Professional Wetland Scientist, Society of Wetland Scientists Certified Wetland Delineator, U.S. Army Corps of Engineers Certified Prescribed Burn Manager, Florida Division of Forestry Natural Areas Management, Natural Areas Training Academy Qualified Mitigation Supervisor, Florida Department of Environmental Protection PROFESSIONAL ASSOCIATIONS Florida Association of Environmental Professionals Local Board of Directors (1991 – 1996) Society of Wetland Scientists Coastal Conservation Association U.S. Power Squadron San Carlos Bay Chairman Environmental Committee (1999) Calusa Nature Center and Planetarium Board of Trustees (2007) 9.A.2.d Packet Pg. 456 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann EXHIBIT 3 AERIAL WITH FLUCFCS AND WETLANDS MAP 9.A.2.d Packet Pg. 457 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann                                      6&$/( 0HWURSROLV$YHQXH 6XLWH )W0\HUV)/ 3KRQH )D[ '5$:,1*1R 6+((71R :&,7) $: '$7( '$7( '$7('5$:1%< 5(9,(:('%< 5(9,6(' )/(,6&+0$113$5&(/ $(5,$/:,7+)/8&)&6$1' :(7/$1'60$3                     (;+,%,7 9.A.2.d Packet Pg. 458 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann EXHIBIT 4 FLUCFCS DESCRIPTIONS 9.A.2.d Packet Pg. 459 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann E4-1 FLEISCHMANN PARCEL FLUCFCS DESCRIPTIONS December 2019 Pine Flatwoods, Disturbed (50-100% Exotics) (FLUCFCS Codes 4119 E3-E4) The canopy vegetation is slash pine (3LQXVHOOLRWWLL) with widely scattered melaleuca (0HODOHXFD TXLQTXHQHUYLD) and earleaf acacia ($FDFLDDXULFXOLIRUPLV). The sub-canopy includes cabbage palm (6DEDO SDOPHWWR), myrsine (0\UVLQH FXEDQD), dahoon holly (,OH[ FDVVLQH), wax myrtle (0RUHOODFHULIHUD), Brazilian pepper (6FKLQXVWHUHELQWKLIROLD), downy rose-myrtle (5KRGRP\UWXV WRPHQWRVD), staggerbush (/\RQLD IUXWLFRVD), and gallberry (,OH[ JODEUD). The sub-canopy in scattered higher elevation areas contains sand live oak (4XHUFXV JHPLQDWD) and myrtle oak (4XHUFXV P\UWLIROLD). The ground cover includes downy rose-myrtle, Brazilian pepper, saw palmetto (6HUHQRDUHSHQV), bracken fern (3WHULGLXPDTXLOLQXP), swamp fern (7HOPDWREOHFKQXP VHUUXODWXP), greenbriar (6PLOD[sp.), grapevine (9LWLVURWXQGLIROLD), poison ivy (7R[LFRGHQGURQ UDGLFDQV), love vine (&DVV\WKD ILOLIRUPLV), gopher apple (/LFDQLD PLFKDX[LL), running oak (4XHUFXVSXPLOD), and yellow-eyed grass (;\ULV sp.). Coverage of exotics exceeds 75 percent in areas mapped as E4. Drainage Canal (FLUCFCS Code 514) These excavated other surface water areas are open water shaded by a canopy of melaleuca, downy rose-myrtle, and Brazilian pepper. Mangrove Swamps, Disturbed (0-24% Exotics) (FLUCFCS Code 6129 E1) The canopy and sub-canopy vegetation include white mangroves (/DJXQFXODULD UDFHPRVD), black mangroves ($YLFHQQLD JHUPLQDQV), buttonwood (&RQRFDUSXV HUHFWXV), melaleuca, and Australian pine (&DVXDULQD HTXLVHWLIROLD). The ground cover includes needle rush (-XQFXV URHPHULDQXV), saltgrass ('LVWLFKOLV VSLFDWD), morning glory (,SRPHD sp.), umbrella sedge ()XLUHQDVFLUSRLGHD), and saltwort (%DWLVPDULWLPD). Mangrove Swamps, Disturbed (50-75% Exotics) (FLUCFCS Code 6129 E3) The canopy and sub-canopy vegetation include buttonwood, melaleuca, cabbage palm, Brazilian pepper, white mangroves, and black mangroves. The ground cover includes saltgrass and white indigo berry (5DQGHDDFXOHDWD). Cypress/Pine/Cabbage Palm, Disturbed (Exotics 50-100%) (FLUCFCS Codes 6249 E3-E4) The canopy consists of slash pine, melaleuca, cypress (7D[RGLXPGLVWLFKXP), and cabbage palm. The sub-canopy contains downy rose-myrtle, cabbage palm, cocoplum (&KU\VREDODQXVLFDFR), wax myrtle, swamp bay (3HUVHD SDOXVWULV), melaleuca, Brazilian pepper, and myrsine. The ground cover includes gulfdune paspalum (3DVSDOXP PRQRVWDFK\XP), swamp fern, sawgrass (&ODGLXPMDPDLFHQVH), grapevine, swamp lily (&ULQXPDPHULFDQXP), Old world climbing fern (/\JRGLXP PLFURSK\OOXP), poison ivy, and cabbage palm. Coverage of exotics exceeds 75 percent in areas mapped as E4. 9.A.2.d Packet Pg. 460 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann E4-2 Pine, Hydric, Disturbed (50-100% Exotics) (FLUCFCS Codes 6259 E3-E4) The canopy consists of slash pine and melaleuca with some scattered cabbage palm and cypress. The sub-canopy contains slash pine, wax myrtle, myrsine, dahoon holly, swamp bay, saltbush (%DFFKDULV KDOLPLIROLD), melaleuca, downy rose-myrtle, cypress, cocoplum, and Brazilian pepper. The ground cover includes gulfdune paspalum, swamp fern, sawgrass, snowberry (&KLRFRFFD DOED), poison ivy, bracken fern, Old world climbing fern, yellow-eyed grass, grapevine, greenbriar, bantam buttons (6\QJRQDQWKXVIODYLGXOXV), and rush fuirena. Coverage of exotics exceeds 75 percent in areas mapped as E4. Wetland Shrub, Disturbed (50-75% Exotics) (FLUCFCS Code 6319 E3) The canopy and sub-canopy vegetation include buttonwood, melaleuca, cabbage palm, and Australian pine (&DVXDULQDHTXLVHWLIROLD). The ground cover is dominated by saltgrass with scattered spikerush ((OHRFKDULV sp.), saltwort, sand cordgrass (6SDUWLQDDOWHUQLIORUD), needle rush, leather fern ($FURVWLFKXPDXUHXP), and glasswort (6DOLFRUQLDYLUJLQLFD). 9.A.2.d Packet Pg. 461 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann EXHIBIT 5 NATIVE VEGETATION MAP 9.A.2.d Packet Pg. 462 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann                                       6&$/( 0HWURSROLV$YHQXH 6XLWH )W0\HUV)/ 3KRQH )D[ '5$:,1*1R 6+((71R :&,5) $: '$7( '$7( '$7('5$:1%< 5(9,(:('%< 5(9,6(' )/(,6&+0$113$5&(/ 1$7,9(9(*(7$7,210$3                        5)(;+,%,7 9.A.2.d Packet Pg. 463 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann EXHIBIT 6 LISTED SPECIES SURVEY 9.A.2.d Packet Pg. 464 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann E6-1 FLEISCHMANN PARCEL LISTED SPECIES SURVEY REPORT December 2019 Revised May 2020 INTRODUCTION This report documents the results of the listed species surveys conducted by Passarella & Associates, Inc. (PAI) for the Fleischmann Parcel (Project). The purpose of the survey was to review the Project area for plant and wildlife species listed by the Florida Fish and Wildlife Conservation Commission (FWCC) and the U.S. Fish and Wildlife Service (USFWS) as endangered, threatened, or species of special concern; and for plant species listed by the Florida Department of Agriculture and Consumer Services and the USFWS as endangered, threatened, or commercially exploited. The review included a literature search of listed species within the Project’s geographical area and on-site field surveys conducted on July 31 and August 7, 2019. The surveys were also conducted to be consistent with Sections 3.04.03 and 3.08.00 of the Collier County Land Development Code (LDC). The Project site totals 102.49± acres and is located in Sections 23 and 26, Township 50 South, Range 25 East, Collier County, specifically identified as Parcel Nos. 61838080008, 61838120007, 61838160009, 61838200008, and 61838201007 (Figure 1). The Project is bordered by residential development to the north and east, and by undeveloped land to the west and south. Vegetation mapping for the property was completedby PAIin July 2019utilizing the Florida Land Use, Cover and Forms Classification System (FLUCFCS) Level IV. AutoCAD Map 3D 2017 software was used to determine the acreage of each mapping area, produce summaries, and generate the final FLUCFCS map for the Project site (Figure 2). A brief description of the vegetation communities identified within each FLUCFCS code follows. Pine Flatwoods, Disturbed (50-100% Exotics) (FLUCFCS Codes 4119 E3-E4) The canopy vegetation is slash pine (3LQXVHOOLRWWLL) with widely scattered melaleuca (0HODOHXFD TXLQTXHQHUYLD) and earleaf acacia ($FDFLDDXULFXOLIRUPLV). The sub-canopy includes cabbage palm (6DEDO SDOPHWWR), myrsine (0\UVLQH FXEDQD), dahoon holly (,OH[ FDVVLQH), wax myrtle (0RUHOODFHULIHUD), Brazilian pepper (6FKLQXVWHUHELQWKLIROLD), downy rose-myrtle (5KRGRP\UWXV WRPHQWRVD), staggerbush (/\RQLD IUXWLFRVD), and gallberry (,OH[ JODEUD). The sub-canopy in scattered higher elevation areas contains sand live oak (4XHUFXV JHPLQDWD) and myrtle oak (4XHUFXV P\UWLIROLD). The ground cover includes downy rose-myrtle, Brazilian pepper, saw palmetto (6HUHQRDUHSHQV), bracken fern (3WHULGLXPDTXLOLQXP), swamp fern (7HOPDWREOHFKQXP VHUUXODWXP), greenbriar (6PLOD[sp.), grapevine (9LWLVURWXQGLIROLD), poison ivy (7R[LFRGHQGURQ UDGLFDQV), love vine (&DVV\WKDILOLIRUPLV), gopher apple (/LFDQLDPLFKDX[LL), running oak (4XHUFXV SXPLOD), and yellow-eyed grass (;\ULV sp.). Coverage of exotics exceeds 75 percent in areas mapped as E4. 9.A.2.d Packet Pg. 465 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann E6-2 Drainage Canal (FLUCFCS Code 514) These excavated other surface water areas are open water shaded by a canopy of melaleuca, downy rose-myrtle, and Brazilian pepper. Mangrove Swamps, Disturbed (0-24% Exotics) (FLUCFCS Code 6129 E1) The canopy and sub-canopy vegetation include white mangroves (/DJXQFXODULDUDFHPRVD), black mangroves ($YLFHQQLDJHUPLQDQV), buttonwood (&RQRFDUSXVHUHFWXV), melaleuca, and Australian pine (&DVXDULQDHTXLVHWLIROLD). The ground cover includes needle rush (-XQFXVURHPHULDQXV), saltgrass ('LVWLFKOLVVSLFDWD), morning glory (,SRPHD sp.), umbrella sedge ()XLUHQDVFLUSRLGHD), and saltwort (%DWLVPDULWLPD). Mangrove Swamps, Disturbed (50-75% Exotics) (FLUCFCS Code 6129 E3) The canopy and sub-canopy vegetation include buttonwood, melaleuca, cabbage palm, Brazilian pepper, white mangroves, and black mangroves. The ground cover includes saltgrass and white indigo berry (5DQGHDDFXOHDWD). Cypress/Pine/Cabbage Palm, Disturbed (Exotics 50-100%) (FLUCFCS Codes 6249 E3-E4) The canopy consists of slash pine, melaleuca, cypress (7D[RGLXPGLVWLFKXP), and cabbage palm. The sub-canopy contains downy rose-myrtle, cabbage palm, cocoplum (&KU\VREDODQXVLFDFR), wax myrtle, swamp bay (3HUVHDSDOXVWULV), melaleuca, Brazilian pepper, and myrsine. The ground cover includes gulfdune paspalum (3DVSDOXPPRQRVWDFK\XP), swamp fern, sawgrass (&ODGLXP MDPDLFHQVH), grapevine, swamp lily (&ULQXPDPHULFDQXP), Old world climbing fern (/\JRGLXP PLFURSK\OOXP), poison ivy, and cabbage palm. Coverage of exotics exceeds 75 percent in areas mapped as E4. Pine, Hydric, Disturbed (50-100% Exotics) (FLUCFCS Codes 6259 E3-E4) The canopy consists of slash pine and melaleuca with some scattered cabbage palm and cypress. The sub-canopy contains slash pine, wax myrtle, myrsine, dahoon holly, swamp bay, saltbush (%DFFKDULVKDOLPLIROLD), melaleuca, downy rose-myrtle, cypress, cocoplum, and Brazilian pepper. The ground cover includes gulfdune paspalum, swamp fern, sawgrass, snowberry (&KLRFRFFD DOED), poison ivy, bracken fern, Old world climbing fern, yellow-eyed grass, grapevine, greenbriar, bantam buttons (6\QJRQDQWKXVIODYLGXOXV), and rush fuirena. Coverage of exotics exceeds 75 percent in areas mapped as E4. Wetland Shrub, Disturbed (50-75% Exotics) (FLUCFCS Code 6319 E3) The canopy and sub-canopy vegetation include buttonwood, melaleuca, cabbage palm, and Australian pine (&DVXDULQDHTXLVHWLIROLD). The ground cover is dominated by saltgrass with scattered spikerush ((OHRFKDULV sp.), saltwort, sand cordgrass (6SDUWLQDDOWHUQLIORUD), needle rush, leather fern ($FURVWLFKXPDXUHXP), and glasswort (6DOLFRUQLDYLUJLQLFD). 9.A.2.d Packet Pg. 466 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann E6-3 METHODOLOGY AND DISCUSSION The listed plant and wildlife species surveys included a literature review for local, state, and federal listed species documented on the Project site or within the vicinity of the Project and field surveys of the Project site conducted on July 31 and August 7, 2019. Literature Review The literature review involved an examination of available information on listed species in the Project’s geographical region. The literature sources reviewed include the FWCC Florida’s Endangered and Threatened Species (2018); Florida Atlas of Breeding Sites for Herons and Their Allies (Runde HWDO. 1991); USFWS Habitat Management Guidelines for the Bald Eagle in the Southeast Region (1987); the Florida Panther Habitat Preservation Plan (Logan HWDO. 1993); the Landscape Conservation Strategy Map (KautzHWDO. 2006); and the USFWS and/or the FWCC databases for telemetry locations of Florida panther (3XPDFRQFRORUFRU\L), bald eagle (+DOLDHHWXV OHXFRFHSKDOXV), Florida black bear (8UVXVDPHULFDQXV IORULGDQXV), Florida scrub jay ($SKHORFRPD FRHUXOHVFHQV), and wading bird rookeries such as wood stork (0\FWHULDDPHULFDQD) in Collier County. The results of the literature search found no documented occurrences of listed wildlife species on the Project site. Records of bald eagle nests and Florida panther have been documented within one mile of the Project (Figure 3). The FWCC database contains no documented Florida black bear radio-telemetry locations on-site or within a one-mile radius of the Project area (Figure 3). The Florida black bear was delisted by the FWCC in August 2012. The Project area is located within the USFWS designated consultation area for the Florida bonneted bat ((XPRSVIORULGDQXV). The Project does contain potential roost sites that include canopy slash pine trees, oak trees (4XHUFXV sp.), and cabbage palms. Follow-up inspections for Florida bonneted bat are reported separately. No Florida bonneted bats or their sign (i.e., guano) were documented during the surveys. The Florida bonneted bat is a state and federally listed endangered species. The Project is not located within the 30± kilometer (18.6± mile) core foraging area of a wood stork rookery (Figure 4). The wood stork is a state and federally listed threatened species. No other wading bird rookeries have been documented within two miles of the site. No bald eagle nests have been documented on the Project site. However, four eagle nests with a distance greater than 0.5 mile outside of the Project area have been documented adjacent to the site. The nest distance is beyond the USFWS and the FWCC recommended 660-foot buffer protection zone for active and alternate bald eagle nests. The bald eagle is not a listed species but is protected under the Bald and Golden Eagle Protection Act. Limited foraging and nesting habitat for the Big Cypress fox squirrel (6FLXUXVQLJHUDYLFHQQLD)is found within the Project area. No Big Cypress fox squirrels or their nests were observed during 9.A.2.d Packet Pg. 467 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann E6-4 the listed species survey. The Big Cypress fox squirrel is listed as state-designated threatened by the FWCC. The Project is located outside of the USFWS designated panther consultation area, approximately 5 miles west of the USFWS Florida Panther Primary Zone (Kautz HWDO 2006) (Figure 5). No panther telemetry points have been documented on the Project site. Panthers telemetry points have been documented approximately 0.25 mile east and northwest of the Project site (Figure 3). The Florida panther is a state and federally listed endangered species. The nearest reported historic record of red-cockaded woodpeckers is approximately 3.5 miles northeast of the Project site (Figure 6). The Project lies approximately 0.5 mile outside of the USFWS Red-Cockaded Woodpecker Consultation Area. No red-cockaded woodpeckers or their sign were documented during the survey. The red-cockaded woodpecker is a state and federally listed species. Field Survey Field surveys for listed species were conducted on the Project site on July 31 and August 7, 2019. Survey methodology consisted of qualified ecologists walking overlapping parallel belt transects across the property (Figure 7). The transects were generally walked approximately 50 to 100 feet apart, depending on habitat type and visibility. The weather during the July 31, 2019 survey included clear skies with some scattered clouds in the afternoon and a light wind. Temperatures ranged from the mid-80s to mid-90s. The weather during the August 7, 2019 survey included mostly cloudy skies, calm wind, with temperatures in the mid-80s to low 90s. RESULTS Listed species surveys were conducted on July 31 and August 7, 2019 for the Project site. The surveys included a review of available literature regarding documented occurrences of listed species and field surveys of the Project site. The literature review found no documented occurrences for listed species within the Project limits. A total of 68 potentially occupied gopher tortoise (*RSKHUXVSRO\SKHPXV) burrows were identified during the listed species survey (Figure 8). No other listed wildlife species were identified on the Project. No Rare listed plants were observed on-site. Less Rare plant species observed on-site included regulated stiff-leaved wild pine (7LOODQGVLDIDVFLFXODWD), twisted airplant (7LOODQGVLDIOH[XRVD), and butterfly orchid ((QF\FOLD WDPSHQVLV) (Figure 8). The property contains habitat with the potential to contain other regulated plants as defined by the Collier County LDC and Florida Administrative Code Chapter 5B-40. Other regulated plants with the potential to occur in the proposed preserve area include Less Rare species giant wild pine (7LOODQGVLDXWULFXODWD) and inflated wild pine (7LOODQGVLDEDOELVLDQD). REFERENCES Florida Department of Transportation. 1999. Florida Land Use, Cover and Forms Classification System. Procedure No. 550-010-001-a. Third Edition. 9.A.2.d Packet Pg. 468 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann E6-5 Florida Fish and Wildlife Conservation Commission. 2018. Florida’s Endangered and Threatened Species List (Updated December 2018). Kautz, R., R. Kawula, T. Hoctor, J. Comiskey, D. Jansen, D. Jennings, J. Kasbohm, F. Mazzotti, R. McBride, L. Richardson, K. Root. 2006. How much is enough? Landscape-scale conservation for the Florida panther. Biological Conservation, Volume 130, Issue 1, Pages 118-133. Logan, Todd, Andrew C. Eller, Jr., Ross Morrell, Donna Ruffner, and Jim Sewell. 1993. Florida Panther Habitat Preservation Plan South Florida Population. U.S. Fish and Wildlife Service; Gainesville, Florida. Runde, D.E., J.A. Gore, J.A. Hovis, M.S. Robson, and P.D. Southall. 1991. Florida Atlas of Breeding Sites for Herons and Their Allies, Update 1986-1989. Nongame Wildlife Program Technical Report No. 10. Florida Game and Fresh Water Fish Commission, Tallahassee, Florida. U.S. Fish and Wildlife Service. 1987. Habitat Management Guidelines for the Bald Eagle in the Southeast Region. 9.A.2.d Packet Pg. 469 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 5(9,(:('%< '5$:1%< 5(9,6(' '$7( '$7( '$7( :+,7$.(55':+,7$.(55'//$$..((::2222''%%//99''99((552211$$::$$//..&&,,55 0$1$7((5'0$1$7((5'7755((99,,6622%%$$<<%%//99''&2817<%$515'&2817<%$515'&23(/1&23(/1 &5(:65'&5(:65' 1'$9(11'$9(1 00$$55 66++''555588005522::77 ++$$99 ((11 33 22 ////<<$$99((3$/0'53$/0'5&&55$$<<77221155''/(%8))65'/(%8))65'%(1),(/'5'%(1),(/'5')/25,'$1$9()/25,'$1$9(66$$11''33,,33((556677&(175$/$9(&(175$/$9(0088 66 ((22&&,,55..,,11**66::$$<</,9,1*67215'/,9,1*67215'1'$9(6:1'$9(6:11$$33//((66++((55,,77 $$**((''555'6765'676&&//88 %%((6677$$77((66''55&&((555522 00$$55''55::,,//''))//22::((55 ::$$<<*8/)6+25(%/9'6*8/)6+25(%/9'6**$$////((2211''5577 ++$$99((66 *5((1:$<5'*5((1:$<5'//((//<<55((66225577%%//99''&&((//((6677((''557+6717+671**//((11(($$**//((%%//99''$,5325738//,1*5'6$,5325738//,1*5'611 22 55 77 ++55 '' 77 ++22 00 $$66 662211 ''55 %%$$55(())222277::,,////,,$$006655''**55$$11''//((//<<''5566$$,,11 77 $$11 ''55 ((::66%%//99''$$99,,$$00 $$55 &&,,55::++,,77((//$$..((%%//99'' ..,,11**66//$$..((%%//99''66 $$%%$$//33 $$//00 55 ''**2255''2211''5566++((////,,66//$$11''55''&2//,(5%/9'65&2//,(5%/9'65)),,''''//((5566&&55((((..33 ..::<<6$17$%$5%$5$%/9'6$17$%$5%$5$%/9'55 $$77 77 //((66 11$$..((++$$00 00 22 &&..55 '' 55 $$'',,22 55'' '$9,6%/9''$9,6%/9'&2//,(5%/9'&5&2//,(5%/9'&5(/ ;3EXIT 101§¨¦ Gulf of Mexico 6$1 0$5&2'5 2,/:(//5 '(9(5*/$'(6%/9'¿À ¿À ¿À ¿À ¿À (/ §¨¦ &2//,(5&2//,(5 /((/(( ^^^ ^ ^ ^ ^ ^ ^ ^^ ^ ^^ ^ ^ MIAMI TAMPA NAPLES ORLANDO KEY WEST SARASOTA PENSACOLA FORT MYERS VERO BEACH LAKE PLACID PANAMA CITY GAINESVILLE TALLAHASSEE JACKSONVILLE DAYTONA BEACH FORT LAUDERDALE¶ 352-(&7/2&$7,21 6(&7:3651*( ),*85(352-(&7/2&$7,210$3 5) $: )/(,6&+0$113$5&(/GULF OF MEXICO 9.A.2.d Packet Pg. 470 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann                                      6&$/( 0HWURSROLV$YHQXH 6XLWH )W0\HUV)/ 3KRQH )D[ '5$:,1*1R 6+((71R :&,5) $: '$7( '$7( '$7('5$:1%< 5(9,(:('%< 5(9,6(' )/(,6&+0$113$5&(/ $(5,$/:,7+)/8&)&6$1' :(7/$1'60$3                     ),*85( 9.A.2.d Packet Pg. 471 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann '5$:1%<5(9,(:('%<5(9,6(''$7('$7('$7(/(*(1'A!(#*!H!Fl012Miles¶),*85('2&80(17('2&&855(1&(62)/,67('63(&,(65)$:)/(,6&+0$113$5&(/!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*!F!H!H!H!H!H!H!H!H!H!H!H!H!H!H!H!H!H!H!H!H!HllAAAAAAAAAAAAAAA)(5167%(&.%/9'%$1<$1%/9'/,9,1*67215'7+20$6621'53$/0'5%$<6+25('5&2817<%$515'*22'/(77()5$1.5'6$17$%$5%$5$%/9'/$.(:2 2 '%/9'(67(<$9(*8/)6+25(% / 9 '$,5325738//,1*5'5$77/(61$.(+$002&.5$',25''$9,6%/9'¿À(/§¨¦&2//,(5&2//,(5352-(&7/2&$7,21GULFOFMEXICO9.A.2.d Packet Pg. 472 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann '5$:1%<5(9,(:('%<5(9,6(''$7('$7('$7(kjGulf of Mexico/,9,1*67215'&5 $<72 1 5'5$',25'9$1'(5%,/7'5 2,/: ( / / * 5 $ ' ( 5 '&$03.($,65''$9,6%/9'3,1(5,'*(5'2 /'86*22'/(77()5$1.5'%21,7$%($&+5'9$1'(5%,/7%($&+5'$,5325738//,1*5'*2/'(1*$7(%/9'6$10$5&2'52,/:(//5'(9(5*/$'(6%/9'¿À¿À¿À(/§¨¦&2//,(5&2//,(5/((/((048Miles¶/(*(1'kj),*85()/25,'$:22'6725.1(67,1*&2/21,(65)$:)/(,6&+0$113$5&(/352-(&7/2&$7,21$1'0,/(&25()25$*,1*$5($69.A.2.d Packet Pg. 473 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann (/ &2//,(5&2//,(5 /((/(( §¨¦ 5(9,(:('%< '5$:1%< 5(9,6(' '$7( '$7( '$7(         ),*85(3$17+(5=21(6:,7+3$17+(5)2&86$5($ 5) $: )/(,6&+0$113$5&(/ 048 Miles ¶ /(*(1'     352-(&7/2&$7,21 GULF OF MEXICO 9.A.2.d Packet Pg. 474 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann !H !H !H !H !H !H !H !H !H !H !H !H !H !H !H !H !H !H !H !H!H !H !H !H !H !H !H !H !H !H !H !H (/ &2//,(5&2//,(5 §¨¦ 5(9,6(''$7( 5(9,(:('%< '5$:1%<'$7( '$7(             /(*(1'  !H   ),*85(5&:&2168/7$7,21$5($:,7+/2&$7,216 ++ $: )/(,6&+0$113$5&(/352-(&7/2&$7,21 ¶ 012 Miles 9.A.2.d Packet Pg. 475 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann                                      TILFAS TILFLEENCTAM TILFAS TILFAS TILFLE ENCTAM TILFLE TILFAS TILFAS TILFLE TILFAS TILFAS ENCTAM 6&$/( 0HWURSROLV$YHQXH 6XLWH )W0\HUV)/ 3KRQH )D[ '5$:,1*1R 6+((71R :&,5) $: '$7( '$7( '$7('5$:1%< 5(9,(:('%< 5(9,6(' )/(,6&+0$113$5&(/ $(5,$/:,7+)/8&)&6/,67('63(&,(6 $1'75$16(&7/2&$7,216                          ),*85( TIL FAS ENC TAM TIL FLE 9.A.2.d Packet Pg. 476 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 477 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann EXHIBIT 7 ISLES OF COLLIER PRESERVE BALD EAGLE NESTING HISTORY 9.A.2.d Packet Pg. 478 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann NEW NESTEAGLE NESTCO-009BABANDONEDEAGLE NESTCO-0091EAGLE NESTCO-024AABANDONED1EAGLE NESTCO-024BEAGLE NESTCO-028 LOST2015-16 ACTIVE2016-17 UNDETERMINED2017-18 UNDETERMINED2018-19 UNDETERMINED2019-20 ACTIVE2004-05 ACTIVE2005-06 ACTIVE2006-07 INACTIVE2007-08 INACTIVE2008-09 UNDETERMINED2009-10 UNDETERMINED2010-11 UNDETERMINED2011-12 UNDETERMINED2012-13 UNDETERMINED2013-14 UNDETERMINED2014-15 UNDETERMINED2015-16 UNDETERMINED2016-17 UNDETERMINED2017-18 UNDETERMINED2018-19 UNDETERMINED2019-20 UNDETERMINED2004-05 UNDETERMINED2005-06 UNDETERMINED2006-07 ACTIVE2007-08 ACTIVE2008-09 INACTIVE2009-10 UNDETERMINED2010-11 ACTIVE2012-13 UNDETERMINED2013-14 UNDETERMINED2014-15 UNDETERMINED2015-16 UNDETERMINED2016-17 UNDETERMINED2017-18 UNDETERMINED2018-19 UNDETERMINED2019-20 UNDETERMINED2007-08 ACTIVE2008-09 ACTIVE2009-10 ACTIVE2010-11 ACTIVE2011-12 ACTIVE2012-13 ACTIVE2013-14 ACTIVE2014-15 INACTIVE2015-16 ACTIVE2016-17 ACTIVE2017-18 ACTIVE2018-19 INACTIVE2019-20 INACTIVEEAGLE NESTCO-009A'%++01$:5(9,6,216'$7('$7('$7('5$:,1*1R6+((71R:&,'$7(1760HWURSROLV$YHQXH6XLWH)W0\HUV)/3KRQH)D['5$:1%<'(6,*1('%<5(9,(:('%<,6/(62)&2//,(535(6(59($(5,$/:,7+($*/(1(67/2&$7,216$1'5(&(171(67,1*+,6725<(;+,%,7$GGHGWKWK\HDULQIRUPDWLRQ$GGHGWKWK\HDULQIRUPDWLRQQHZDHULDO$GGHG)OHLVFKPDQ3DUFHOQHZDHULDO$GGHGWK\HDULQIRUPDWLRQQHZDHULDO9.A.2.d Packet Pg. 479 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann EXHIBIT 8 FLORIDA BONNETED BAT SURVEY 9.A.2.d Packet Pg. 480 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Project No. 04WCI1042 FLEISCHMANN PARCEL FLORIDA BONNETED BAT ACCOUSTIC SURVEY REPORT December 2019 Prepared For: Minto Communities, LLC 3DUN2DNV%RXOHYDUG6XLWH 7DPSD)ORULGD Prepared By: Passarella & Associates, Inc. 0HWURSROLV$YHQXH6XLWH )RUW0\HUV)ORULGD 9.A.2.d Packet Pg. 481 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann i TABLE OF CONTENTS Page 1.0 Introduction ........................................................................................................................... 1 2.0 Site Conditions ...................................................................................................................... 1 3.0 Florida Bonneted Bat Biology .............................................................................................. 1 3.1 Description .................................................................................................................... 1 3.2 Range ............................................................................................................................. 1 3.3 Habitat ........................................................................................................................... 2 3.4 Life History and Ecology .............................................................................................. 2 4.0 Survey Methodology ............................................................................................................. 3 4.1 Survey Stations .............................................................................................................. 3 4.2 Survey Equipment ......................................................................................................... 3 4.3 Sonogram Analysis ........................................................................................................ 4 5.0 Survey Results ...................................................................................................................... 4 5.1 Survey Stations .............................................................................................................. 4 5.2 Weather Conditions ....................................................................................................... 5 5.3 Sonogram Analysis ........................................................................................................ 5 6.0 Summary ............................................................................................................................... 6 7.0 References ............................................................................................................................. 6 9.A.2.d Packet Pg. 482 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann ii LIST OF TABLES Page Table 1. GPS Coordinates of Florida Bonneted Bat Acoustic Station Locations ...............4 Table 2. Sunrise and Sunset Times for Surveys..................................................................5 Table 3. Number of Recordings per Station .......................................................................5 9.A.2.d Packet Pg. 483 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann iii LIST OF APPENDICES Page Appendix A. Project Location Map .......................................................................................... A-1 Appendix B. Aerial with FLUCFCS and Wetlands Map ..........................................................B-1 Appendix C. Aerial with Acoustic Station Locations ...............................................................C-1 Appendix D. Photographs of Acoustic Survey Stations ........................................................... D-1 Appendix E. Weather Conditions During Survey Nights ......................................................... E-1 Appendix F. Sonograms of Representative Calls Obtained During the Florida Bonneted Bat Survey ......................................................................... F-1 9.A.2.d Packet Pg. 484 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 1 1.0 INTRODUCTION This report documents the Florida bonneted bat ((XPRSV IORULGDQXV) survey conducted by Passarella & Associates, Inc. for the Fleischmann Parcel (Project).The Project site totals 102.49± acres and is located in Sections 23 and 26, Township 50 South, Range 25 East, Collier County, specifically identified as Parcel Nos. 61838080008, 61838120007, 61838160009, 61838200008, and 61838201007 (Appendix A). The Project is bordered by residential development to the north and east, and by undeveloped land to the west and south. The survey was conducted to determine if Florida bonneted bats are utilizing the Project site. The Florida bonneted bat is listed as endangered by the U.S. Fish and Wildlife Service (USFWS) and the Florida Fish and Wildlife Conservation Commission. There are no known records of Florida bonneted bats occurring on-site. 2.0 SITE CONDITIONS A total of nine vegetative associations and land uses (i.e., Florida Land Use, Cover and Form Classification System (FLUCFCS) codes) were identified on the property. The vegetative communities are dominated by pine habitat (Appendix B). 3.0 FLORIDA BONNETED BAT BIOLOGY 3.1 Description With an average wingspan of 490 to 530 millimeters (19.3 to 20.9 inches) and an average length of 130 to 165 millimeters (5.1 to 6.5 inches), the Florida bonneted bat is the largest species of bat found in Florida. They are members of the Molossidae family, commonly referred to as free-tailed bats. As the name suggests, Molossids, including Florida bonneted bats, have tails that extend well beyond their short tail membrane. Also similar to other free-tailed bats, the Florida bonneted bat has small eyes; large upper lips; and long, narrow wings (Marks and Marks 2006). Their fur is short and glossy with sharply bicolored hairs with a white base (Timm and Genoways 2004). Their fur ranges from dark gray to brownish gray or cinnamon brown on its dorsal side, with lighter, grayish fur underneath. The Florida bonneted bat is characterized by its large size and its large, broad ears that slant forward over the eyes and join together along the midline of the head. Their big ears protrude over their head like a bonnet, giving them their name (Marks and Marks 2006). 3.2 Range The current range of the Florida bonneted bat is known to include both the east and the west coast of Southern Florida (excluding the Keys), and includes Charlotte, Collier, Lee, Miami-Dade, Okeechobee, and Polk Counties. In addition, bonneted bat calls were recorded in two locations in the Kissimmee River area, which may effectively move the range of this species northward by approximately 50 miles (Marks and Marks 2008a and 9.A.2.d Packet Pg. 485 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 2 USFWS 2014). They have historically been found in only a few areas, including theMiami area in 1936; Coral Gables, Coconut Grove, and Miami in the 1950s; Punta Gorda in 1979; Fakahatchee Strand in 2000; and North Fort Myers in 2003 (Marks and Marks 2006). Recent locations where bonneted bats have been recorded include 12 locations documented during acoustic surveys conducted between 2006 and 2008: Coral Gables (Granada Golf Course) and Homestead in Miami-Dade County; North Fort Myers in Lee County; Babcock Ranch in Charlotte and Lee Counties; Babcock/Webb in Charlotte and Lee Counties; Kicco Wildlife Management Area in Polk County; Kissimmee River Public Use Area in Okeechobee County; Naples in Collier County; Everglades City in Collier County; Fakahatchee Preserve in Collier County; Big Cypress National Preserve in Collier County; and Picayune Strand State Forest in Collier County (Marks and Marks 2008b and USFWS 2014). Additional surveys conducted in 2010 through 2012 identified additional bonneted bat locations within the Miami area and areas of Everglades National Park and Big Cypress National Preserve (USFWS 2014). 3.3 Habitat Habitat for the Florida bonneted bat consists mainly of foraging areas and roosting sites, including some artificial structures in both urban and forested areas (USFWS 2014). They are known to roost in rock crevices, tree cavities, buildings, and bat boxes (Marks and Marks 2008b). South Florida bonneted bats roost primarily in trees and in manmade artificial structures, with roost availability indicated as an important limiting factor (USFWS 2014). Foraging habitat includes areas over open fresh water such as ponds, streams, and wetlands; and they will drink when flying over open water (USFWS 2014). They will also forage over treetops and other open areas such as golf courses (Marks and Marks 2006). During the dry season, the bonneted bat becomes more dependent upon the remaining open water habitats such as ponds, streams, and wetland areas for foraging activities (USFWS 2014). 3.4 Life History and Ecology Molossids are found primarily in the tropical and subtropical regions of the world, but some species also occur in warmer portions of temperate regions. At one time the Florida bonneted bat was known as Wagner’s mastiff bat ((XPRSVJODXFLQXV) and was considered a single species with an extensive range (Marks and Marks 2006). In 1971, the Florida population was recognized as a separate subspecies, (XPRSV JODXFLQXV IORULGDQXV (Koopman 1971). Evidence published in 2004 demonstrated that in fact the Florida population is a distinct species and it was subsequently reclassified as (XPRSVIORULGDQXV (Timm and Genoways 2004). Relatively little information is known about the ecology of the Florida bonneted bat. They are colonial and appear to roost in groups of approximately 8 to 12 individuals. Findings from two colonies suggest that Florida bonneted bats may roost in a harem consisting of one male and a group of females. Females give birth to a single pup, but are believed to have two birthing seasons per year. It has been speculated that one birthing period may occur in June and July, and a second in late summer. It is unknown whether or not females 9.A.2.d Packet Pg. 486 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 3 produce an offspring during both birthing periods. Pregnant females have been found between June and September. Mating behavior, gestation period, and information about weaning of the young is also unknown (Marks and Marks 2006). All molossids are insectivorous, and the guano from one Florida bonneted bat roost included the remains of insects from several orders including beetles, flies, and true bugs. The Florida bonneted bat emerges from its roost approximately 40 minutes after sunset, which is later in the evening than most other Florida bat species. They are high, fast flyers and have been observed flying at 30 feet or higher, foraging above treetops and over open areas as noted above (Marks and Marks 2006). The Florida bonneted bat uses echolocation to navigate, as well as to locate and capture prey. Echolocation is used by bats to determine how far away an object is, its size, shape, texture, whether it is approaching or receding, and how fast it is moving. There are five main types of bat calls: commute calls, social calls, search calls, approach calls, and feeding buzzes. Search calls are given when a bat is looking for prey and are the type of call typically used for species identification. The Florida bonneted bat is the only bat in Florida that issues search calls in the 10 to 16 kilohertz (kHz) range (with an occasional extended call range from 16 to 25 kHz), making them easy to distinguish from the other Florida bat species (personal communication with George and Cynthia Marks). 4.0 SURVEY METHODOLOGY 4.1 Survey Stations Florida bonneted bat roosting habitat includes buildings and other artificial structures, as well as natural tree cavities. Foraging habitat includes water bodies, herbaceous wetlands, streams, tree lines, wooded fence lines, forest canopy openings, and other open lands. The Project site was inventoried for potential Florida bonneted bat roosting and foraging habitats. Acoustic survey stations were then selected by qualified ecologists with knowledge of bat ecology. Each survey station was photographed and located using a handheld Global Positioning System (GPS). 4.2 Survey Equipment Surveys were conducted using the Song Meter (SM4BAT FS) recorder by Wildlife Acoustics. The SM4BAT FS is a full-spectrum bioacoustics recorder that detects the echolocation calls of bats with a microphone and records the calls as a full spectrum sonogram. For non-linear projects, the USFWS recommends a cumulative total of 16 detector nights per 20 acres of suitable habitats proposed to be impacted. For surveys, the following weather conditions are required: 1) temperatures at or above 65 degrees Fahrenheit during the first five hours of the survey period; 2) precipitation, including rain and/or fog, must not exceed 30 minutes or continued intermittently during the first five hours of the survey period; and 3) sustained winds no greater than nine miles per hour for 30 minutes or more during the first five hours of the survey period. 9.A.2.d Packet Pg. 487 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 4 In order to capture high quality call sequences, the following guidelines were used for the placement and orientation of the SM4BAT FS: 1) elevated no less than 5 meters (16.4 feet) above ground level; 2) placed at least 1.5 meters (5 feet) away from any obstruction; 3) placed in areas without or with minimal vegetation within 10 meters (33 feet) in front of the detector microphone; and 4) detector microphone placed at a 45 degree angle from the horizon facing the target area. 4.3 Sonogram Analysis Sonograms recorded during the surveys were sorted and identified by bat species using the Kaleidoscope 2016 software and reviewed by a qualified ecologist for Florida bonneted bat calls. Kaleidoscope filters out all bat calls and labels them by species depending on the frequency of the call. The Kaleidoscope software categorizes sounds other than bat calls as “noise”. If the software was unsure of how to label a bat call, the file was labeled as “No ID” (unknown). After filtering the data using Kaleidoscope, all files were examined by ecologists to review call signatures consistent within the Florida bonneted bat frequency. Florida bonneted bat call frequencies are easily identifiable and well below those of other Florida bat species (Marks and Marks 2006). Florida bonneted bat calls fall in the range of 10 to 17 kHz. 5.0 SURVEY RESULTS 5.1 Survey Stations Ecologists deployed six SM4BAT FS units throughout the Project site for eight days at a time, over a period of two weeks. Per USFWS Draft Bonneted Bat Survey Protocol (2014), the units were deployed approximately 100 to 200 meters apart and attached to suitable trees that were clear from obstruction and placed at least 5 meters (16.4 feet) off the ground. The locations of the acoustic stations are depicted in Appendix C and photographs of the acoustic stations are shown in Appendix D.The GPS coordinates of the Florida bonneted bat acoustic survey stations are provided in Table 1. Table 1. GPS Coordinates of Florida Bonneted Bat Acoustic Station Locations Survey Station Coordinates AS-1 N 26.090169, W -81.766460 AS-2 N 26.091512, W -81.767660 AS-3 N 26.092923, W -81.768012 AS-4 N 26.088642, W -81.767175 AS-5 N 26.092109, W -81.769162 AS-6 N 26.093715, W -81.766530 AS-7 N 26.095116, W -81.766878 AS-8 N 26.094845, W -81.768779 AS-9 N 26.093676, W -81.768819 AS-10 N 26.096187, W -81.769245 9.A.2.d Packet Pg. 488 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 5 Table 1. (Continued) Survey Station Coordinates AS-11 N 26.096364, W -81.767756 AS-12 N 26.096895, W -81.766242 The SM4BAT FS units were deployed from August 19 through September 4, 2019. The units were programmed to begin recording 30 minutes prior to sunset until 30 minutes after sunrise and were left to record on-site. Sunrise and sunset times for the survey period are summarized in Table 2. Table 2. Sunrise and Sunset Times for Surveys Survey Periods Sunrise Sunset 08/19/19 – 08/27/19 7:03 am 7:56 pm 08/27/19 – 09/04/19 7:06 am 7:49 pm 5.2 Weather Conditions The hourly weather conditions during the survey nights were obtained from the nearest National Oceanic and Atmospheric Administration (NOAA) Station (WBAN 12897), located at the Naples Municipal Airport approximately 4 miles north of the Project site. According to NOAA reports, the weather condition criteria during the first five hours during the August 24-25 survey night were not met. The survey effort was repeated for that night to compensate for the weather conditions not meeting the criteria. A summary of the weather conditions for each survey night is provided in Appendix E. 5.3 Sonogram Analysis The Kaleidoscope 2016 software was used to analyze all sonograms collected during the survey nights. Sonograms containing representative calls of bats obtained during the survey periods are included as Appendix F. Over the survey period, 40,861 recordings were gathered. Of those calls, the Kaleidoscope software identified 21,557 bat calls; 19,304 of the recordings were identified as unknown or noise. All 40,861 recordings were manually reviewed and no bonneted bat calls were identified. A summary of the number of recordings per station is found in Table 3. Table. 3. Number of Recordings by Station Acoustic Station Dates Surveyed Number of Recordings AS-1 08/19/19 – 08/27/19 2,920 AS-2 08/19/19 – 08/27/19 5,981 AS-3 08/19/19 – 08/27/19 1,860 AS-4 08/19/19 – 08/27/19 1,669 AS-5 08/19/19 – 08/27/19 2,171 9.A.2.d Packet Pg. 489 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 6 Table. 3. (Continued) Acoustic Station Dates Surveyed Number of Recordings AS-6 08/19/19 – 08/27/19 2,259 AS-7 08/27/19 – 09/04/19 5,146 AS-8 08/27/19 – 09/04/19 2,998 AS-9 08/27/19 – 09/04/19 3,386 AS-10 08/27/19 – 09/04/19 4000 AS-11 08/27/19 – 09/04/19 3,950 AS-12 08/27/19 – 09/04/19 5,521 6.0 SUMMARY A bonneted bat acoustic survey was conducted from August 19 through September 4, 2019 on the 102.49± acre Fleischmann Parcel (Project) using SM4BAT FS units programmed to record 30 minutes prior to sunset until 30 minutes after sunrise. Kaleidoscope 2016 software was used to help filter and analyze the sonograms collected during the survey. The SM4BAT FS units recorded a total 40,861 files during the survey. Of those recordings, 21,557 were identified as bat calls and 19,304 were identified as either unknown or noise. Recordings were manually analyzed for the presence of Florida bonneted bat. No Florida bonneted bats or their sign were detected during the survey. 7.0 REFERENCES Koopman, K.F. 1971. The systematic and historical status of the Florida (XPRSV (Chiroptera: Molossidae). The American Novitates. 2478: 1-6. Marks, C.S. and G.E. Marks. 2006. Bats of Florida. University Press of Florida, Gainesville, Florida. Marks, G.E. and C.S. Marks. 2008a. Status of the Florida bonneted bat ((XPRSVIORULGDQXV) Supplemental report. Submitted by the Florida Bat Conservancy under grant agreement number 401815G 192. Florida Bat Conservancy. Bay Pines, Florida. Marks, G.E. and C.S. Marks. 2008b. Status of the Florida bonneted bat ((XPRSVIORULGDQXV)Final report. Submitted by the Florida Bat Conservancy under grant agreement number 401815G 192. Florida Bat Conservancy. Bay Pines, Florida. Timm, R.M., and H.H. Genoways. 2004. The Florida bonneted bat, (XPRSV IORULGDQXV (Chiroptera: Molossidae): distribution, morphometrics, systematics, and ecology. Journal of Mammalogy. 85: 852-865. U.S. Fish and Wildlife Service. 2014. Biological Opinion for Golf Club of the Everglades. Service CPA Code 2014-CPA-0037. South Florida Ecological Services Office, Vero Beach, Florida. 9.A.2.d Packet Pg. 490 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann APPENDIX A PROJECT LOCATION MAP 9.A.2.d Packet Pg. 491 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 5(9,(:('%< '5$:1%< 5(9,6(' '$7( '$7( '$7( :+,7$.(55':+,7$.(55'//$$..((::2222''%%//99''99((552211$$::$$//..&&,,55 0$1$7((5'0$1$7((5'7755((99,,6622%%$$<<%%//99''&2817<%$515'&2817<%$515'&23(/1&23(/1 &5(:65'&5(:65' 1'$9(11'$9(1 00$$55 66++''555588005522::77 ++$$99 ((11 33 22 ////<<$$99((3$/0'53$/0'5&&55$$<<77221155''/(%8))65'/(%8))65'%(1),(/'5'%(1),(/'5')/25,'$1$9()/25,'$1$9(66$$11''33,,33((556677&(175$/$9(&(175$/$9(0088 66 ((22&&,,55..,,11**66::$$<</,9,1*67215'/,9,1*67215'1'$9(6:1'$9(6:11$$33//((66++((55,,77 $$**((''555'6765'676&&//88 %%((6677$$77((66''55&&((555522 00$$55''55::,,//''))//22::((55 ::$$<<*8/)6+25(%/9'6*8/)6+25(%/9'6**$$////((2211''5577 ++$$99((66 *5((1:$<5'*5((1:$<5'//((//<<55((66225577%%//99''&&((//((6677((''557+6717+671**//((11(($$**//((%%//99''$,5325738//,1*5'6$,5325738//,1*5'611 22 55 77 ++55 '' 77 ++22 00 $$66 662211 ''55 %%$$55(())222277::,,////,,$$006655''**55$$11''//((//<<''5566$$,,11 77 $$11 ''55 ((::66%%//99''$$99,,$$00 $$55 &&,,55::++,,77((//$$..((%%//99'' ..,,11**66//$$..((%%//99''66 $$%%$$//33 $$//00 55 ''**2255''2211''5566++((////,,66//$$11''55''&2//,(5%/9'65&2//,(5%/9'65)),,''''//((5566&&55((((..33 ..::<<6$17$%$5%$5$%/9'6$17$%$5%$5$%/9'55 $$77 77 //((66 11$$..((++$$00 00 22 &&..55 '' 55 $$'',,22 55'' '$9,6%/9''$9,6%/9'&2//,(5%/9'&5&2//,(5%/9'&5(/ ;3EXIT 101§¨¦ Gulf of Mexico 6$1 0$5&2'5 2,/:(//5 '(9(5*/$'(6%/9'¿À ¿À ¿À ¿À ¿À (/ §¨¦ &2//,(5&2//,(5 /((/(( ^^^ ^ ^ ^ ^ ^ ^ ^^ ^ ^^ ^ ^ MIAMI TAMPA NAPLES ORLANDO KEY WEST SARASOTA PENSACOLA FORT MYERS VERO BEACH LAKE PLACID PANAMA CITY GAINESVILLE TALLAHASSEE JACKSONVILLE DAYTONA BEACH FORT LAUDERDALE¶ 352-(&7/2&$7,21 6(&7:3651*( $33(1',;$352-(&7/2&$7,210$3 5) $: )/(,6&+0$113$5&(/GULF OF MEXICO 9.A.2.d Packet Pg. 492 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann APPENDIX B AERIAL WITH FLUCFCS AND WETLANDS MAP 9.A.2.d Packet Pg. 493 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann                                      6&$/( 0HWURSROLV$YHQXH 6XLWH )W0\HUV)/ 3KRQH )D[ '5$:,1*1R 6+((71R :&,7) $: '$7( '$7( '$7('5$:1%< 5(9,(:('%< 5(9,6(' )/(,6&+0$113$5&(/ $(5,$/:,7+)/8&)&6$1' :(7/$1'60$3                     $33(1',;% 9.A.2.d Packet Pg. 494 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann APPENDIX C AERIAL WITH ACOUSTIC STATION LOCATIONS 9.A.2.d Packet Pg. 495 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann '5$:,1*1R 6+((71R '5$:1%< 5(9,(:('%< 5(9,6(' '$7( '$7( '$7($6$6 $6$6 $6$6 $6$6 $6$6 $6$6 $6$6 $6$6 $6$6 $6$6 $6$6 $6$6       0 300 600 Feet ¶/(*(1'   )/(,6&+0$113$5&(/ $(5,$/:,7+$&2867,& 67$7,21/2&$7,216 7):&, 352-(&7/2&$7,21 $33(1',;& 0HWURSROLV$YHQXH 6XLWH )RUW0\HUV)ORULGD 3KRQH )D[ $: 9.A.2.d Packet Pg. 496 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann APPENDIX D PHOTOGRAPHS OF ACOUSTIC SURVEY STATIONS 9.A.2.d Packet Pg. 497 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann AS-1 AS-2 Microphone Microphone 9.A.2.d Packet Pg. 498 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann AS-3 AS-4 Microphone Microphone 9.A.2.d Packet Pg. 499 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann AS-5 AS-6 Microphone Microphone 9.A.2.d Packet Pg. 500 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann AS-7 AS-8 Microphone Microphone 9.A.2.d Packet Pg. 501 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann AS-9 AS-10 Microphone Microphone 9.A.2.d Packet Pg. 502 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann AS-11 AS-12 Microphone Microphone 9.A.2.d Packet Pg. 503 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann APPENDIX E WEATHER CONDITIONS DURING SURVEY NIGHTS 9.A.2.d Packet Pg. 504 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann E-1 FLEISCHMANN PARCEL WEATHER CONDITIONS DURING SURVEY NIGHTS Survey Night Date Hour Cloud Cover Wind (mph) Temperature (°F) Precipitation (inches) 1 08/19/2019 to 08/20/2019 18:53 Clear 8 86 None 19:53 Partly cloudy 7 83 None 20:53 Clear 8 82 None 21:53 Partly cloudy 3 80 None 22:53 Clear 5 80 None 23:53 Clear 5 79 None 0:53 Clear 7 78 None 1:53 Clear 5 78 None 2:53 Clear 5 78 None 3:53 Clear 3 77 None 4:53 Clear 5 77 None 5:53 Clear 8 77 None 6:53 Clear 10 79 None 7:53 Clear 9 83 None 2 08/20/2019 to 08/21/2019 18:53 Partly cloudy 6 77 None 19:53 Partly cloudy 7 79 None 20:53 Partly cloudy 3 80 None 21:53 Clear 0 79 None 22:53 Clear 0 78 None 23:53 Clear 5 78 None 0:53 Clear 7 78 None 1:53 Clear 6 78 None 2:53 Clear 3 78 None 3:53 Clear 6 78 None 4:53 Clear 5 78 None 5:53 Clear 3 78 None 6:53 Clear 7 79 None 7:53 Clear 9 83 None 3 08/21/2019 to 08/22/2019 18:53 Rain 6 78 0.19 19:14 Light rain 7 78 0.01 19:53 Light rain 3 78 0.01 20:53 Partly cloudy 0 79 None 21:53 Partly cloudy 5 79 None 22:53 Clear 0 79 None 23:53 Clear 0 79 None 0:53 Clear 0 79 None 9.A.2.d Packet Pg. 505 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann E-2 (Continued) Survey Night Date Hour Cloud Cover Wind (mph) Temperature (°F) Precipitation (inches) 3 (Continued) 08/21/2019 to 08/22/2019 1:53 Clear 0 79 None 2:53 Clear 3 78 None 3:53 Clear 3 79 None 4:53 Clear 0 78 None 5:53 Clear 5 78 None 6:53 Clear 0 80 None 7:53 Clear 3 84 None 4 08/22/2019 to 08/23/2019 18:53 Clear 6 83 None 19:53 Clear 5 83 None 20:53 Clear 6 82 None 21:53 Clear 0 81 None 22:53 Clear 3 81 None 23:53 Clear 0 81 None 0:53 Clear 0 80 None 1:53 Clear 3 80 None 2:53 Clear 5 80 None 3:53 Clear 5 79 None 4:53 Clear 6 79 None 5:53 Clear 5 79 None 6:53 Clear 7 80 None 7:53 Clear 6 83 None 5 08/23/2019 to 08/24/2019 18:53 Clear 0 85 None 19:53 Clear 0 84 None 20:53 Clear 5 83 None 21:53 Clear 6 83 None 22:53 Clear 7 82 None 23:53 Clear 3 81 None 0:53 Clear 5 81 None 1:53 Clear 3 80 None 2:53 Clear 0 80 None 3:53 Mostly clear 3 79 None 4:53 Clear 0 79 None 5:53 Clear 0 79 None 6:53 Clear 5 80 None 7:53 Mostly clear 5 83 None 9.A.2.d Packet Pg. 506 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann E-3 (Continued) Survey Night Date Hour Cloud Cover Wind (mph) Temperature (°F) Precipitation (inches) 6 08/24/2019 to 08/25/2019 18:53 Mostly cloudy 9 87 None 19:39 Light rain 15 85 0.09 19:53 Thunderstorm 8 82 1.15 19:55 Thunderstorm 13 82 0.04 20:13 Thunderstorm 6 81 0.22 20:21 Rain 5 81 0.22 20:28 Rain 0 81 0.22 20:42 Rain 0 82 0.22 20:53 Light rain 7 81 0.12 21:53 Partly cloudy 0 81 None 22:53 Clear 0 81 None 23:53 Clear 0 81 None 0:53 Clear 0 81 None 1:53 Clear 0 81 None 2:53 Mosly clear 0 81 None 3:53 Clear 0 81 None 4:53 Mostly clear 0 81 None 5:53 Mostly clear 0 82 None 6:53 Clear 6 85 None 7:53 Clear 3 87 None 7 08/25/2019 to 08/26/2019 18:53 Clear 3 86 None 19:53 Clear 6 84 None 20:53 Clear 3 85 None 21:53 Clear 3 85 None 22:53 Mostly clear 3 85 None 23:53 Mostly cloudy 7 85 None 0:53 Partly cloudy 0 86 None 1:53 Mostly clear 7 86 None 2:53 Mostly clear 0 82 None 3:53 Mostly clear 5 81 None 4:53 Mostly clear 0 81 None 5:53 Clear 3 81 None 6:53 Mostly clear 5 82 None 7:53 Clear 0 87 None 9.A.2.d Packet Pg. 507 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann E-4 (Continued) Survey Night Date Hour Cloud Cover Wind (mph) Temperature (°F) Precipitation (inches) 8 08/26/2019 to 08/27/2019 18:53 Mostly clear 8 87 None 19:53 Clear 8 87 None 20:53 Clear 6 86 None 21:53 Mostly clear 6 86 None 22:53 Light rain 8 81 0.01 23:53 Light rain 3 82 0.01 0:53 Clear 0 82 None 1:53 Clear 0 82 None 2:53 Mostly clear 0 82 None 3:53 Clear 0 81 None 4:53 Clear 3 81 None 5:53 Partly cloudy 0 81 None 6:53 Mostly clear 0 82 None 7:53 Mostly clear 0 85 None 8:53 Partly cloudy 3 88 None 9 08/27/2019 to 08/28/2019 18:53 Clear 10 87 None 19:53 Mostly clear 6 87 None 20:53 Mostly clear 9 87 None 21:53 Partly cloudy 6 87 None 22:53 Partly cloudy 9 87 None 23:53 Partly cloudy 6 87 None 0:53 Partly cloudy 6 87 None 1:53 Clear 6 87 None 2:53 Mostly clear 5 86 None 3:53 Partly cloudy 6 86 None 4:53 Mostly clear 3 83 None 5:53 Clear 5 83 None 6:53 Mostly clear 3 84 None 7:53 Clear 3 87 None 10 08/28/2019 to 08/29/2019 18:53 Clear 15 86 None 19:53 Clear 9 87 None 20:53 Clear 6 87 None 21:53 Clear 7 87 None 22:53 Mostly clear 7 86 None 23:53 Clear 3 86 None 0:53 Mostly clear 3 84 None 9.A.2.d Packet Pg. 508 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann E-5 (Continued) Survey Night Date Hour Cloud Cover Wind (mph) Temperature (°F) Precipitation (inches) 10 (Continued) 08/28/2019 to 08/29/2019 1:53 Clear 0 84 None 2:53 Clear 3 83 None 3:53 Clear 5 82 None 4:53 Clear 5 81 None 5:53 Clear 3 81 None 6:53 Clear 0 82 None 7:53 Clear 6 85 None 11 08/29/2019 to 08/30/2019 18:53 Mostly clear 13 85 None 19:53 Mostly clear 9 85 None 20:53 Partly cloudy 6 84 None 21:53 Partly cloudy 7 84 None 22:53 Clear 7 83 None 23:53 Clear 9 82 None 0:53 Mostly clear 7 80 None 1:53 Mostly clear 5 80 None 2:53 Clear 7 80 None 3:53 Clear 5 80 None 4:53 Clear 8 80 None 5:53 Clear 7 80 None 6:53 Clear 8 81 None 7:53 Clear 10 84 None 12 08/30/2019 to 08/31/2019 18:53 Mostly clear 6 82 None 19:53 Mostly clear 0 81 None 20:53 Clear 3 81 None 21:53 Clear 0 81 None 22:53 Clear 7 80 None 23:53 Clear 8 80 None 0:53 Clear 8 79 None 1:53 Clear 9 79 None 2:53 Clear 9 79 None 3:53 Clear 8 80 None 4:53 Clear 8 79 None 5:53 Clear 7 79 None 6:53 Clear 8 79 None 7:53 Clear 7 83 None 8:53 Clear 9 83 None 9.A.2.d Packet Pg. 509 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann E-6 (Continued) Survey Night Date Hour Cloud Cover Wind (mph) Temperature (°F) Precipitation (inches) 13 08/31/2019 to 09/01/2019 18:53 Clear 8 85 None 19:53 Clear 10 84 None 20:53 Clear 10 84 None 21:53 Clear 7 82 None 22:53 Clear 8 82 None 23:53 Clear 7 81 None 0:53 Clear 8 80 None 1:53 Clear 6 80 None 2:53 Clear 5 80 None 3:53 Clear 6 79 None 4:53 Clear 6 79 None 5:53 Clear 7 79 None 6:53 Clear 6 80 None 7:53 Clear 6 83 None 14 09/01/2019 To 09/02/2019 18:53 Rain 0 79 0.23 19:53 Clear 0 80 None 20:53 Clear 0 81 None 21:53 Mostly clear 3 82 None 22:53 Clear 3 81 None 23:53 Clear 3 81 None 0:53 Clear 5 81 None 1:53 Clear 6 80 None 2:53 Clear 6 80 None 3:53 Clear 5 81 None 4:53 Clear 6 81 None 5:53 Clear 5 81 None 6:53 Clear 6 82 None 7:53 Clear 10 84 None 15 09/02/2019 to 09/03/2019 18:53 Clear 9 83 None 19:53 Clear 8 83 None 20:53 Clear 7 83 None 21:53 Clear 8 83 None 22:53 Clear 9 83 None 23:53 Clear 7 82 None 0:53 Clear 7 83 None 1:53 Clear 6 82 None 9.A.2.d Packet Pg. 510 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann E-7 (Continued) Survey Night Date Hour Cloud Cover Wind (mph) Temperature (°F) Precipitation (inches) 15 (Continued) 09/02/2019 to 09/03/2019 2:53 Clear 9 82 None 3:53 Clear 8 81 None 4:53 Clear 8 81 None 5:53 Clear 9 82 None 6:53 Mostly clear 8 82 None 7:53 Mostly clear 10 84 None 16 09/03/2019 to 09/04/2019 18:53 Clear 15 87 None 19:53 Clear 8 87 None 20:53 Clear 8 86 None 21:53 Clear 5 84 None 22:53 Clear 6 83 None 23:53 Clear 7 84 None 0:53 Clear 5 83 None 1:53 Clear 9 83 None 2:53 Clear 8 85 None 3:53 Partly cloudy 10 85 None 4:53 Light rain 9 83 0.01 5:53 Clear 11 84 None 6:53 Mostly clear 9 85 None 7:53 Partly cloudy 14 87 None 9.A.2.d Packet Pg. 511 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann APPENDIX F REPRESENTATIVE BAT SONOGRAMS 9.A.2.d Packet Pg. 512 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 1As identified by Kaleidescope 16 software. %DWFDOOVZLWKLQWKHUDQJHRI%UD]LOLDQIUHHWDLOHGEDWTadarida brasiliensis1RUWKHUQ\HOORZEDWLasiurus intermedius6HPLQROHEDWLasiurus seminolus%DWFDOOVZLWKLQWKHUDQJHRI1RUWKHUQ\HOORZEDWLasiurus intermediusDQG%UD]LOLDQIUHHWDLOHGEDWTadarida brasiliensisFrequency (kHz)Time(s)Frequency (kHz)Date: 8/24/2019Time:20:38:49 Station: AS-1Date: 8/19/2019Time: 20:52:24Station: AS-1Time(s)9.A.2.d Packet Pg. 513 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 1As identified by Kaleidescope 16 software. %DWFDOOVZLWKLQWKHUDQJHRI1RUWKHUQ\HOORZEDWLasiurus intermediusDQG%UD]LOLDQIUHHWDLOHGEDWTadarida brasiliensis%DWFDOOVZLWKLQWKHUDQJHRI1RUWKHUQ\HOORZEDWLasiurus intermediusDQG%UD]LOLDQIUHHWDLOHGEDWTadarida brasiliensisFrequency (kHz)Date: 8/19/2019Time: 20:42:04 Station: AS-2Time(s)Frequency (kHz)Time(s)Date: 8/27/2019Time: 06:33:21 Station: AS-29.A.2.d Packet Pg. 514 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 1As identified by Kaleidescope 16 software. %DWFDOOVZLWKLQWKHUDQJHRI1RUWKHUQ\HOORZEDWLasiurus intermedius%UD]LOLDQIUHHWDLOHGEDWTadarida brasiliensisELJEURZQEDWEptesicus fuscus%DWFDOOVZLWKLQWKHUDQJHRI1RUWKHUQ\HOORZEDWLasiurus intermedius%UD]LOLDQIUHHWDLOHGEDWTadarida brasiliensisELJEURZQEDWEptesicus fuscusFrequency (kHz)Time(s)Date: 8/19/2019Time: 20:48:21 Station: AS-3Time(s)Frequency (kHz)Date: 8/27/2019Time: 20:25:35 Station: AS-3Time(s)9.A.2.d Packet Pg. 515 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 1As identified by Kaleidescope 16 software. %DWFDOOVZLWKLQWKHUDQJHRI1RUWKHUQ\HOORZEDWLasiurus intermedius%UD]LOLDQIUHHWDLOHGEDWTadarida brasiliensisELJEURZQEDWEptesicus fuscusTime(s)%DWFDOOVZLWKLQWKHUDQJHRIELJEURZQEDWEptesicus fuscusFrequency (kHz)Date: 8/20/2019Time: 03:03:18 Station: AS-4Time(s)Date: 8/25/2019Time: 20:32:09 Station: AS-4Frequency (kHz)9.A.2.d Packet Pg. 516 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 1As identified by Kaleidescope 16 software. %DWFDOOVZLWKLQWKHUDQJHRIELJEURZQEDWEptesicus fuscus%DWFDOOVZLWKLQWKHUDQJHRIELJEURZQEDWEptesicus fuscusFrequency (kHz)Time(s)Date: 8/19/2019Time: 22:37:52 Station: AS-5Frequency (kHz)Date: 8/27/2019Time: 02:51:31 Station: AS-5Time(s)9.A.2.d Packet Pg. 517 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 1As identified by Kaleidescope 16 software. %DWFDOOVZLWKLQWKHUDQJHRI1RUWKHUQ\HOORZEDWLasiurus intermedius%UD]LOLDQIUHHWDLOHGEDWTadarida brasiliensisELJEURZQEDWEptesicus fuscus%DWFDOOVZLWKLQWKHUDQJHRI1RUWKHUQ\HOORZEDWLasiurus intermedius%UD]LOLDQIUHHWDLOHGEDWTadarida brasiliensisELJEURZQEDWEptesicus fuscusFrequency (kHz)Time(s)Time(s)Date:8/19/2019Time: 21:22:42 Station: AS-6Date: 8/27/2019Time: 01:19:42 Station: AS-6Time(s)Time(s)Frequency (kHz)9.A.2.d Packet Pg. 518 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 1As identified by Kaleidescope 16 software. %DWFDOOVZLWKLQWKHUDQJHRIHYHQLQJEDWNycticeius humeralisDQG6HPLQROHEDWLasiurus seminolus%DWFDOOVZLWKLQWKHUDQJHRIHYHQLQJEDWNycticeius humeralis1RUWKHUQ\HOORZEDWLasiurus intermediusELJEURZQEDWEptesicusfuscusDate: 8/27/2019Time: 20:07:02 Station: AS-7Date: 9/02/2019Time: 00:00:46 Station: AS-7Frequency (kHz)Frequency (kHz)Time(s)Time(s)9.A.2.d Packet Pg. 519 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann EXHIBIT 9 UMAM FUNCTIONAL ANALYSIS 9.A.2.d Packet Pg. 520 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 521 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Table 1. UMAM Primary Wetland ImpactsWetland Polygon No.FLUCFCS CodeLocationWater EnvironmentCommunity StructureScore/ DeltaPrimary Impact AcreagePrimary Impact Functional Loss1-1 6249 E33.00 4.00 4.000.37 3.95 1.451-2 6249 E43.00 2.00 2.000.23 0.57 0.131-3 6259 E44.00 4.00 3.000.37 21.39 7.841-4 6319E36.00 5.00 4.000.50 0.05 0.032-3 6249E43.00 3.00 2.000.27 0.01 0.0025.979.45Table 2. UMAM Secondary Wetland ImpactsWetland Polygon No.FLUCFCS CodeLocationWater EnvironmentCommunity StructureLocationWater EnvironmentCommunity StructurePre-ScorePost- Score DeltaSecondary Impact AcreageSecondary Impact Functional Loss1-3 6259 E44.00 4.00 3.00 2.00 4.00 3.000.37 0.30 0.07 0.50 0.031-4 6319E36.00 5.00 4.00 4.00 5.00 4.000.50 0.43 0.07 0.17 0.012-3 6249E43.00 3.00 2.00 1.00 3.00 2.000.27 0.20 0.07 0.20 0.012-5 6259E43.00 4.00 2.00 1.00 4.00 2.000.30 0.23 0.07 0.09 0.010.960.06Table 3. UMAM Relative Functional GainWetland Polygon No.FLUCFCS CodeLocationWater EnvironmentCommunity StructureLocationWater EnvironmentCommunity StructurePre-ScorePost- ScoreDelta Time Lag RiskRelative Functional GainAcreageFunctional Gain1-3 6259 E44.00 4.00 3.00 4.00 5.00 8.000.37 0.57 0.20 1.03 1.00 0.19 0.86 0.171-4 6319E36.00 5.00 4.00 6.00 6.00 8.000.50 0.67 0.17 1.03 1.00 0.16 2.78 0.452-1 6129E16.00 6.00 7.00 6.00 7.008.000.630.70 0.07 1.031.000.061.540.102-2 6129E35.00 6.00 4.00 5.00 7.008.000.50 0.67 0.171.031.000.161.090.182-3 6249E43.00 3.00 2.00 3.00 4.008.000.27 0.50 0.23 1.031.000.233.870.882-4 6259E3 5.00 4.00 4.00 5.00 5.008.000.43 0.60 0.17 1.031.000.168.081.312-5 6259E43.00 4.00 2.00 3.00 5.008.000.30 0.53 0.23 1.031.000.237.441.692-6 6319E34.00 4.00 3.00 4.00 5.008.000.37 0.57 0.20 1.031.000.190.730.142-7 6259E43.00 2.00 2.00 3.00 3.008.000.23 0.47 0.23 1.031.000.230.400.0926.794.99Loss - Gain = Deficit4.52TotalsWITHOUT MITIGATION WITH MITIGATIONPRE-DEVELOPMENT POST-DEVELOPMENTFLEISCHMANN PARCEL May 28, 2020UMAM ANALYSIS - SUMMARYTotalsTotalsE9B-19.A.2.d Packet Pg. 522 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann EXHIBIT 10 WETLAND IMPACT MAP 9.A.2.d Packet Pg. 523 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 524 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann EXHIBIT 11 SOILS MAP 9.A.2.d Packet Pg. 525 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 0HWURSROLV$YHQXH 6XLWH )RUW0\HUV)ORULGD 3KRQH )D[ '5$:,1*1R 6+((71R '5$:1%< 5(9,(:('%< 5(9,6(' '$7( '$7( '$7(%$<6+25('5%$<6+25('5++22 ////<<$$99 ((          )/(,6&+0$113$5&(/ 62,/60$3 5) $: :&, 0300600 Feet /(*(1'  ¶¶ (;+,%,7Soil Unit Description ϳ /DDK<>&/E^E ϭϱ WKD>>K&/E^E ϭϳ ^/E'Z&/E^E Ϯϱ K͕Z/s/Z͕>/D^dKE^h^dZdhD͕EKW>E&/E^E^͕WZ^^/KE> ϯϰ hZE>EͲ/DDK<>ͲK>^DZ͕>/D^dKE^h^dZdhD͕KDW>y ϱϯ ^dZKEW</^,^K/>^͕&ZYhEd>z&>KK 9.A.2.d Packet Pg. 526 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann EXHIBIT 12 WATER LEVEL NAIL ELEVATION SUMMARY 9.A.2.d Packet Pg. 527 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann E12-1 FLEISCHMAN PARCEL WATER LEVEL NAIL ELEVATION SUMMARY December 2019 Water Level Nail Summary Table Nail No.Biological Indicator Marked Nail Elevation (Feet NGVD) Ground Elevation (Feet NGVD) 1-1 Bottom of moss line on cypress 2.50 1.70 1-2 Bottom of moss line on cypress 2.46 1.60 1-3 Bottom of moss line on cypress 2.41 1.60 2-1 Top of adventitious rooting on buttonwood 1.20 1.00 2-2 Top of adventitious rooting on buttonwood 1.28 1.00 2-3 Top of adventitious rooting on buttonwood 1.17 0.90 9.A.2.d Packet Pg. 528 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann EXHIBIT 13 PRESERVE AREA MANAGEMENT PLAN 9.A.2.d Packet Pg. 529 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 530 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann '5$:1%<'(6,*1('%<5(9,(:('%<'$7('$7('$7('5$:,1*1R6+((71R0HWURSROLV$YHQXH6XLWH)W0\HUV)/3KRQH)D[ 3$66$5(//$$,1&:&,,6/(62)&2//,(535(6(59(35(6(59($5($0$1$*(0(173/$13$572)++'%$:$:(;+,%,7%5(9,6,216'$7($GGHG3DUFHOV7DQG6LQIRUPDWLRQ5HYLVHG7H[W8SGDWHWRLQFOXGH)OHLVFKPDQQ3DUFHO9.A.2.d Packet Pg. 531 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann hd/>/dz^ddDEd 9.A.2.d Packet Pg. 532 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 533 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann KhEZz^hZsz 9.A.2.d Packet Pg. 534 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 535 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 536 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 537 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Z^^/E',<>/^d 9.A.2.d Packet Pg. 538 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann K>>/ZKhEdz'KsZEDEd 'ZKtd,DE'DEdWZdDEd ǁǁǁ͘ĐŽůůŝĞƌŐŽǀ͘ŶĞƚ ϮϴϬϬEKZd,,KZ^^,KZ/s EW>^͕&>KZ/ϯϰϭϬϰ ;ϮϯϵͿϮϱϮͲϮϰϬϬ&y ;ϮϯϵͿϮϱϮͲϱϳϮϰ ADDRESSING CHECKLIST 3OHDVHFRPSOHWHWKHIROORZLQJDQGHPDLOWR*0'B$GGUHVVLQJ#FROOLHUJRYQHWRUID[WRWKH2SHUDWLRQV'LYLVLRQ DWRUVXEPLWLQSHUVRQWRWKH$GGUHVVLQJ6HFWLRQDWWKHDERYHDGGUHVV)RUPPXVWEHVLJQHGE\ $GGUHVVLQJSHUVRQQHOSULRUWRSUHDSSOLFDWLRQPHHWLQJSOHDVHDOORZGD\VIRUSURFHVVLQJ 1RW DOO LWHPV ZLOO DSSO\ WR HYHU\ SURMHFW ,WHPV LQEROGW\SHDUHUHTXLUHG)2/,2 180%(56 0867 %( 3529,'(')RUPVROGHUWKDQPRQWKVZLOOUHTXLUHDGGLWLRQDOUHYLHZDQGDSSURYDOE\WKH$GGUHVVLQJ6HFWLRQ 3(7,7,217<3((Indicate type below, complete a separate Addressing Checklist for each Petition type) %/%ODVWLQJ3HUPLW %'%RDW'RFN([WHQVLRQ &DUQLYDO&LUFXV3HUPLW &8&RQGLWLRQDO8VH (;3([FDYDWLRQ3HUPLW )3)LQDO3ODW //$/RW/LQH$GMXVWPHQW 31&3URMHFW1DPH&KDQJH 33/3ODQV 3ODW5HYLHZ 3633UHOLPLQDU\6XEGLYLVLRQ3ODW 38'5H]RQH 5=6WDQGDUG5H]RQH 6'36LWH'HYHORSPHQW3ODQ 6'3$6'3$PHQGPHQW 6'3,,QVXEVWDQWLDO&KDQJHWR6'3 6,36LWH,PSURYHPHQW3ODQ 6,3,,QVXEVWDQWLDO&KDQJHWR6,3 6156WUHHW1DPH&KDQJH 61&6WUHHW1DPH&KDQJH±8QSODWWHG 7'57UDQVIHURI'HYHORSPHQW5LJKWV 9$9DULDQFH 9539HJHWDWLRQ5HPRYDO3HUPLW 956)39HJHWDWLRQ5HPRYDO 6LWH)LOO3HUPLW 27+(5 /(*$/'(6&5,37,21RIVXEMHFWSURSHUW\RUSURSHUWLHV(copy of lengthy description may be attached) )2/,23URSHUW\,'180%(5VRIDERYH(attach to, or associate with, legal description if more than one) 675((7$''5(66RU$''5(66(6(as applicable, if already assigned) 352326('675((71$0(6(if applicable) 6,7('(9(/230(173/$1180%(5(for existing projects/sites only) /2&$7,210$3PXVWEHDWWDFKHGVKRZLQJH[DFWORFDWLRQRISURMHFWVLWHLQUHODWLRQWRQHDUHVWSXEOLFURDGULJKW RIZD\ 352326('352-(&71$0((if applicable) 6'3RU$5RU3/ 6859(<FRS\QHHGHGRQO\IRUXQSODWWHGSURSHUWLHV &855(17352-(&71$0((if applicable) Rev. 6/9/2017 Page 1 of 2 ■PUDA (PUD Amendment) See attached boundary survey. 61838201007, 61838200008, 61838160009, 61838120007, 61838080008 N/A Fleischmann Parcel N/A Ord. No. 05-59 Ord 12-12 Name not approved at this time S23&26 T50 R25 Sabal Bay 9.A.2.d Packet Pg. 539 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann K>>/ZKhEdz'KsZEDEd 'ZKtd,DE'DEdWZdDEd ǁǁǁ͘ĐŽůůŝĞƌŐŽǀ͘ŶĞƚ ϮϴϬϬEKZd,,KZ^^,KZ/s EW>^͕&>KZ/ϯϰϭϬϰ ;ϮϯϵͿϮϱϮͲϮϰϬϬ&y ;ϮϯϵͿϮϱϮͲϱϳϮϰ 3OHDVH5HWXUQ$SSURYHG&KHFNOLVW%\(PDLO3HUVRQDOO\SLFNHGXS $SSOLFDQW1DPH 6LJQDWXUHRQ$GGUHVVLQJ&KHFNOLVWGRHVQRWFRQVWLWXWH3URMHFWDQGRU6WUHHW1DPH DSSURYDODQGLVVXEMHFWWRIXUWKHUUHYLHZE\WKH2SHUDWLRQV'LYLVLRQ )2567$))86(21/< )ROLR1XPEHU )ROLR1XPEHU )ROLR1XPEHU )ROLR1XPEHU )ROLR1XPEHU )ROLR1XPEHU $SSURYHGE\'DWH 8SGDWHGE\'DWH ,)2/'(57+$10217+6)2500867%( 83'$7('251(:)25068%0,77(' )D[ (PDLO)D[3KRQH 3URMHFWRUGHYHORSPHQWQDPHVSURSRVHGIRURUDOUHDG\DSSHDULQJLQFRQGRPLQLXPGRFXPHQWVLIDSSOLFDWLRQ LQGLFDWHZKHWKHUSURSRVHGRUH[LVWLQJ Rev. 6/9/2017 Page 2 of 2 ■ Barraco and Associates, Inc. c/o Jennifer Sapen (239) 461-3170 JenniferS@Barraco.net & DawnR@Barraco.net 61838201007 10/4/19 See attached 9.A.2.d Packet Pg. 540 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 541 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann S89°32'19"W648.48'(C)S89°32'10"W673.65'(C)N00°19'45"E1344.09'(C)N00°20'11"EN00°43'16"W1344.00'(C)1348.91'(C)N89°30'51"E1321.26'(C)S00°44'12"E1349.42'(C)S00°19'19"W2688.11'(C)AREA = 102.49 Ac. +/-Lot 91Lot 71Lot 73Lot 90Lot 89Lot 74Lot 88Lot 87Lot 75Lot 76Lot 86Lot 85Lot 77Lot 84Lot 83Lot 80SW 1/4 of SE 1/4 of NE 1/4Lot2Lot1Lot3Lot53Lot54Lot55Lot5624252623Section24Section23Section25Section26SectionLineSectionLineSectionLine1/4SectionLine1/4-1/4SectionLine1/4-1/4SectionLineTownship 50 South,Range 25 EastSection 23Township50South,Range25EastSection26NE 1/4SE 1/4(P.B. 1, PG. 27A, C.C.R.)"Naples Groves and TruckCo's Little Farms No. 2"Lot 82Lot 81Lot 78Lot 79SW 1/4 of NE 1/4"Holly Terrace"(P.B. 4, PG. 64, C.C.R.)HollyAvenue(P)25'(P)25'(P)50'(P)50'(P)30'(P)25'(P)25'(P)25'(P)25'(P)RIGHTOFWAYLINE(P)RIGHTOFWAYLINE(P)RIGHTOFWAYLINE(P)(O.R. 4856, PG. 233, C.C.R.)61838201007ALEXIAN ENTERPRISES LLC(O.R. 4856, PG. 233, C.C.R.)61838200008ALEXIAN ENTERPRISES LLC(O.R. 4856, PG. 233, C.C.R.)61838160009ALEXIAN ENTERPRISES LLC(O.R. 4856, PG. 233, C.C.R.)61838120007ALEXIAN ENTERPRISES LLC(O.R. 4856, PG. 233, C.C.R.)61838080008ALEXIAN ENTERPRISES LLC(O.R. 5199, PG. 3180, C.C.R.)61838040006LARRY & MARJI POMPOSINI(O.R. 4870, PG. 318, C.C.R.)00395560307MINTO SABAL BAY, LLC(O.R. 4870, PG. 318, C.C.R.)00395560307MINTO SABAL BAY, LLC(O.R. 4870, PG. 318, C.C.R.)61838240000MINTO SABAL BAY, LLCWAYANTIGUATract"F"Tract"L"9089099109119129139149159 1 6917 930931968969Tract"L"Tract"L"Road(P)CountyDriveBayshoreSEESHEET3SEESHEET2"Isles of Collier Preserve Phase 12"(P.B. 64, PG. 64, C.C.R.)0 100 200 400SCALE IN FEETLEGEND:('7B.M. BENCHMARK(C) CALCULATEDCCR# CERTIFIED CORNERRECORDC.M.R. COLLIER COUNTYRECORDSC/L CENTER LINECONC. CONCRETECB= CHORD BEARING=CD= CHORD DISTANCE=CH= CHORD BEARING &DISTANCE=C.M. CONCRETEMONUMENTCOR.CORNERC.U.E. COUNTY UTILITYEASEMENTΔ= DELTA OR CENTRALANGLE=(D) DEEDD.B. DEED BOOKEL. ELEVATION(F) FIELDFD. FOUNDF.D.O.T. FLORIDADEPARTMENT OFTRANSPORTATIONF.P. & L. FLORIDA POWER &LIGHT CO.FRAC. FRACTIONI.E. IRRIGATIONEASEMENTI.P. IRON PIPEI.R. IRON RODL= LENGTHLB LICENSED BUSINESSL.B.E. LANDSCAPE BUFFEREASEMENTL.M.E. LAKE MAINTENANCEEASEMENT(M) MEASUREDO.R. OFFICIAL RECORDBOOK(P) PLATP.B. PLAT BOOKP.C. POINT OF CURVATUREPG. PAGEP.K. PARKER-KALONP.R.M. PERMANENTREFERENCEMONUMENTPROP. PROPERTYP.V.C. PLASTIC PIPER= RADIUS=R.C.P. REINFORCEDCONCRETE PIPEREF. REFERENCER/W RIGHT OF WAYTYP. TYPICALSEC. SECTIONW/ WITHWIT. WITNESS69:9$5662%,5:&$ 799,0)*9*SET "MAG" NAIL WITH DISC STAMPED LB6940SET 1/2" IRON ROD WITH CAP STAMPED LB6940SET 4"x4" CONC. MONUMENT STAMPED LB6940FOUND NAIL AS NOTEDFOUND CONC. MONUMENT AS NOTEDFOUND IRON PIPE OR IRON ROD AS NOTEDDRAINAGE INLETDRAINAGE MANHOLEMITERED END SECTIONYARD DRAINLIGHT POLEFLOOD LIGHTCONCRETE POWER POLEWOOD POWER POLEGUY ANCHORTELEPHONE BOXELECTRIC BOXCABLE TV BOXWATER VALVEWATER BOXFIRE HYDRANTBACK FLOW ASSEMBLYAIR RELEASE VALVEIRRIGATION VALVEIRRIGATION SERVICEWELLSANITARY MANHOLESANITARY SERVICESIGNMAIL BOXBLOW OFFFIBER OPTIC CABLE MARKERGAS LINE MARKERGAS VALVEFLORIDA PLANE(EAST ZONE)COORDINATE SYSTEMNAD 1983(NSRS2007)NDESCRIPTION (PER TITLE COMMITMENT)Lots 81 through 90, inclusive, Naples Groves and Truck Company's Little Farms No.2, according tothe plat thereof as recorded in Plat Book 1, Page 27A, Public Records of Collier County, Florida.1. DATE OF LAST FIELD WORK: AUGUST 15, 2019.2. THIS SURVEY DOES NOT MAKE ANY REPRESENTATION AS TO ZONING ORDEVELOPMENT RESTRICTIONS ON SUBJECT PARCEL.3. THIS SURVEY WAS PERFORMED FOR THE PURPOSE SHOWN HEREON AND DOESNOT MAKE ANY REPRESENTATION AS TO THE DELINEATION OF ANY JURISDICTIONALLINES EXCEPT AS SHOWN OR NOTED HEREON.4. NO ENVIRONMENTAL ASSESSMENT OR AUDIT WAS PERFORMED ON SUBJECTPARCEL BY THIS FIRM.5. ALL DISTANCES SHOWN ARE IN FEET AND DECIMALS THEREOF. UNLESS OTHERWISENOTED DISTANCES ARE ALSO (U.S. SURVEY FEET) GROUND AND CAN BE MULTIPLIEDBY 1.000011796 TO OBTAIN GRID DISTANCES.6. BEARINGS AND COORDINATES HEREON ARE STATE PLANE FLORIDA EAST ZONE(NAD1983 (NSRS 2007)) AND ARE BASED THE EAST LINE OF THE SOUTHEASTQUARTER (SE 1/4) OF SECTION 26 TO BEAR S00°19'19"W.7. IMPROVEMENTS OTHER THAN THOSE SHOWN IF ANY WERE NOT LOCATED.8. THERE ARE NO VISIBLE ENCROACHMENTS OTHER THAN THOSE SHOWN.9. OWNERSHIP OF ANY FENCE SHOWN HEREON IS UNKNOWN.10. ACCORDING TO F.I.R.M. No. 12021C0584H, MAP REVISED: MAY 16, 2012, THEPROPERTY IS LOCATED IN FLOOD ZONE AE (EL 6).11. THIS SURVEY WAS PREPARED IN ACCORDANCE WITH A AMERICAN LAND TITLECOMMITMENT PREPARED BY: OLD REPUBLIC NATIONAL TITLE INSURANCE COMPANY,COMMITMENT No. 737911, COMMITMENT DATE: JUNE 17, 2019 AT 11:00 PM.12. THE SURVEYED PARCEL CONTAINS 102.49 ACRES, MORE OR LESS.13. ELEVATIONS SHOWN ARE IN FEET ABOVE NORTH AMERICAN VERTICAL DATUM 1988AND ARE BASED ON A LEVEL LOOP BY THIS FIRM FROM NATIONAL GEODETICSURVEY BENCH MARK "Q 249" (PID=AD1229)(ELEVATION =4.73').NOTES:DATE SIGNED:THIS SURVEY IS FOR THE BENEFIT OF:OLD REPUBLIC NATIONAL TITLE INSURANCE COMPANYMINTO COMMUNITIES, LLCBAYSHORE PARCEL, LLCSHUTTS & BOWEN LLPTHOMPSON LEWIS LAW FIRM, PLLCI HEREBY CERTIFY THAT THIS SURVEY WAS DONE UNDER MY DIRECTION ANDSUPERVISION AND MEETS THE STANDARDS OF PRACTICE AS PER CHAPTER5J-17.050 THRU 052 F.A.C. PURSUANT TO CHAPTER 472.027, FLORIDA STATUTES.NOT VALID WITHOUT THE SIGNATURE AND THE ORIGINAL RAISED SEAL OF AFLORIDA LICENSED SURVEYOR AND MAPPER.SCOTT A. WHEELER (FOR THE FIRM - LB-6940)PROFESSIONAL SURVEYOR AND MAPPERFLORIDA CERTIFICATE NO.5949SHEET NUMBERPLAN REVISIONSSTRAP NUMBERSPROJECT / FILE NO.SCALEFIELD BOOKCHECKED BYDRAWN BYSURVEY DATEDRAWING DATA1 OF 3BOUNDARYSURVEY2378023-50-2508-15-2019P. OLSENSAW1"=200'6183808000861838160009618381200076183820000861838201007),/(1$0(/2&$7,213/27'$7(6':*-??':*?6859(<,1*?)5,$0/$<2873/27%< &+5,6(//,60F*5(*25%/9'68,7(32672)),&('5$:(5)2570<(56)/25,'$3+21()$;&,9,/(1*,1((5,1*/$1'6859(<,1*/$1'3/$11,1*)/25,'$&(57,),&$7(62)$87+25,=$7,21(1*,1((5,1*6859(<,1*/%35(3$5(')25352-(&7'(6&5,37,21A SUBDIVISION LYING INSECTIONS 14, 23 AND 26,TOWNSHIP 50 SOUTH,RANGE 25 EAST,COLLIER COUNTY, FLORIDAPLAT BOOK 1, PAGE 27,COLLIER COUNTY RECORDSNaples Grovesand Truck Co’sLittle Farms No. 2LOTS 81 THROUGH 90 OF THERECORD PLAT0,172&20081,7,(686$3$5.2$.6%28/(9$5'68,7(7$03$)/:::0,172&20)$;3+21(352-(&76859(<251279$/,':,7+2877+(6,*1$785($1'7+(25,*,1$/5$,6('6($/2)$)/25,'$/,&(16('6859(<25$1'0$33(5/,&(16(18(5 67$7(2)352)(6 6 ,2 1$/6859(<25'0$33(56&277$:+((/(5 )/25,'$0%1$THE PROPERTY IS AFFECTED AS NOTED BY THE FOLLOWING ITEMS FROMSCHEDULE B2 OF THE TITLE COMMITMENT AS FOLLOWS:6. All matters contained on the Plat of Naples Groves and Truck Company's Little FarmsNo. 2, as recorded in Plat Book l, Page 27 A, Public Records of Collier County,Florida. (AFFECTS PROPERTY, SHOWN)7. Easement in favor of United Telephone Company of Florida recorded in OfficialRecords Book 1010, Page 268, Public Records of Collier County, Florida. (DOESNOT AFFECT PROPERTY, NOT SHOWN)9. Resolution No. 88-230 recorded in Official Records Book 1384, Page 570, PublicRecords of Collier County, Florida. (AFFECTS ALL OF LOT 90 OF PLAT, NOTSHOWN)SURVEY RELATED ITEMS FROM SCHEDULE B-2:9.A.2.d Packet Pg. 542 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann ;SLot 91Lot 71Lot 73Lot 90Lot 89Lot 74Lot 88Lot 87Lot 75Lot 76Lot 86Lot 85Lot 77Lot 84Lot2Lot1Lot54Lot55Lot5624252623Section23Section24SectionLineSectionLine1/4-1/4SectionLineTownship 50 South,Range 25 EastSection 23SE 1/4(P.B. 1, PG. 27A, C.C.R.)"Naples Groves and Truck Co's Little Farms No. 2"Lot 78"Holly Terrace"(P.B. 4, PG. 64, C.C.R.)HollyAvenue(P)50'(P)30'(P)25'(P)25'(P)RIGHTOFWAYLINE(P)RIGHTOFWAYLINE(P)(O.R. 4856, PG. 233, C.C.R.)61838201007ALEXIAN ENTERPRISES LLC(O.R. 4856, PG. 233, C.C.R.)61838200008ALEXIAN ENTERPRISES LLC(O.R. 4856, PG. 233, C.C.R.)61838160009ALEXIAN ENTERPRISES LLC(O.R. 4856, PG. 233, C.C.R.)61838120007ALEXIAN ENTERPRISES LLC(O.R. 4870, PG. 318, C.C.R.)61838240000MINTO SABAL BAY, LLCTract"F"(FUTUREDEVELOPMENT)(P)CountyDriveBayshoreTract"L"(LAKE,L.M.E.&D.E.)(P)"Isles of Collier Preserve Phase 12"(P.B. 64, PG. 64, C.C.R.)(O.R. 4856, PG. 233, C.C.R.)61838080008ALEXIAN ENTERPRISES LLCRoad(P)(UNIMPROVED)(INTERIOR FENCES & INTERIOR IMPROVEMENTS OTHER THAN THOSE SHOWN WERE NOT LOCATED)SectionLineSection23Section14Section23Section22Section26Section23Township50South,Range25EastSection26NE 1/4NW 1/4SW 1/4NE 1/4S00°44'12"E1349.42'(C)N89°30'51"E1321.26'(C)N00°43'16"WN00°20'11"E1348.91'(C)NOTE:THE CONCRETE WALK,LIGHT POLES AND GUY ANCHORSFALL WITHIN THESURVEYED PROPERTY.S00°19'19"W2688.11'(C)1344.00'(C)S89°32'28"W2693.26'(C)S00°44'12"E2698.83'(C)N00°42'19"W5404.37'(C)N89°29'14"E5358.05'(C)S00°43'16"E2697.56'(C)(1/4SEC.COR.TOSEC.COR.)(1/4SEC.COR.TO1/4SEC.COR.)1349.42'(C)(1/4SEC.COR.TO1/4SEC.COR.)1345.89'(C)1345.89'(C)2666.27'(C)2708.08'(C)2696.29'(C)(SEC.COR.TO1/4SEC.COR.)1346.63'(C)1346.63'(C)S00°20'11"W2688.24'(C)(1/4-1/4SEC.COR.TO1/4-1/4SEC.COR.)N89°31'15"E1321.35'(C)N89°31'39"E1321.45'(C)N89°32'04"E1321.54'(C)N89°32'26"E1321.71'(C)N89°32'23"E1321.80'(C)(LOT86/87)CORNER AT BISECTORNOT ON SECTION LINE1321.63'(C)0.12'(C)(COR.TOSEC.LINE)336.01'(C)336.01'(C)337.35'(C)337.35'(C)337.35'(C)337.35'(C)337.20'(C)337.20'(C)337.20'(C)337.20'(C)335.91'(C)336.03'(C)335.70'(P)1341.00'(P)1341.00'(P)1341.00'(P)1341.00'(P)1341.00'(P)1341.00'(P)1341.00'(P)335.70'(P)335.70'(P)335.70'(P)335.70'(P)334.50'(P)334.50'(P)334.50'(P)334.50'(P)335.70'(P)335.70'(P)335.70'(P)FD. "MAG" NAIL W/DISK"LB 6940 PRM"FD. 1/2" I.R.(NO CAP)FD. 1/2" I.R.(NO CAP)FD. R.R. SPIKENORTH 1/4 SEC. 23)(CCR#20768)FD. 3/4" I.P. (W/ 1/2" I.R. IN CENTER)0.08' N. & 0.13' E. OF C/L x SEC. LINEFD. 4"x4" C.M.(W/ 3/4" PIPE BROKEN)SOUTH 1/4 COR. SEC. 23FD. 3"x3" C.M.(DISK STAMPED 22-23)WEST 1/4 COR. SEC. 23FD. 4"x 4" C.M. (W/ 5/8" I.R.)E 1/4 COR. COR. SEC. 23(CCR#22088)FD. 4"x 4" C.M. (DESTROYED)SET 1/2" I.R. "LB 6940"SOUTHEAST COR. SEC. 23(CCR#22075)SET 1/2" I.R. "LB6940"N=640682.13(Y)E=403469.99(X)N=642030.95(Y)E=403453.01(X)N=642042.15(Y)E=404774.25(X)N=646075.29(Y)E=402031.84(X)N=643343.51(Y)E=399398.98(X)N=643391.47(Y)E=404756.89(X)N=640692.83(Y)E=404791.60(X)N=640671.26(Y)E=402098.38(X)Overhead Utility Line5.8'(toGuy)Sidewalk10'(toGuy)5'5'PavementLEGEND:'B.M. BENCHMARK(C) CALCULATEDCCR# CERTIFIED CORNER RECORDC.M.R. COLLIER COUNTY RECORDSC/L CENTER LINECONC. CONCRETECB= CHORD BEARING=CD= CHORD DISTANCE=CH= CHORD BEARING & DISTANCE=C.M. CONCRETE MONUMENTCOR.CORNERC.U.E. COUNTY UTILITY EASEMENTΔ= DELTA OR CENTRAL ANGLE=(D) DEEDD.B. DEED BOOKEL. ELEVATION(F) FIELDFD. FOUNDF.D.O.T. FLORIDA DEPARTMENT OFTRANSPORTATIONF.P. & L. FLORIDA POWER & LIGHT CO.FRAC. FRACTIONI.E. IRRIGATION EASEMENTI.P. IRON PIPEI.R. IRON RODL= LENGTHLB LICENSED BUSINESSL.B.E. LANDSCAPE BUFFEREASEMENTL.M.E. LAKE MAINTENANCEEASEMENT(M) MEASUREDO.R. OFFICIAL RECORD BOOK(P) PLATP.B. PLAT BOOKP.C. POINT OF CURVATUREPG. PAGEP.K. PARKER-KALONP.R.M. PERMANENT REFERENCEMONUMENTPROP. PROPERTYP.T. POINT OF TANGENCYP.V.C. PLASTIC PIPER= RADIUS=R.C.P. REINFORCED CONCRETE PIPEREF. REFERENCER/W RIGHT OF WAYTYP. TYPICALSEC. SECTIONW/ WITHWIT. WITNESS(9:7:&$ 79SET "MAG" NAIL WITH DISC STAMPED LB6940SET 1/2" IRON ROD WITH CAP STAMPED LB6940SET 4"x4" CONC. MONUMENT STAMPED LB6940FOUND NAIL AS NOTEDFOUND CONC. MONUMENT AS NOTEDFOUND IRON PIPE OR IRON ROD AS NOTEDDRAINAGE INLETDRAINAGE MANHOLEMITERED END SECTIONYARD DRAINLIGHT POLEFLOOD LIGHTCONCRETE POWER POLEWOOD POWER POLEGUY ANCHORTELEPHONE BOXELECTRIC BOXCABLE TV BOXWATER VALVEWATER BOXFIRE HYDRANTBACK FLOW ASSEMBLYAIR RELEASE VALVEIRRIGATION VALVEIRRIGATION SERVICEWELLSANITARY MANHOLESANITARY SERVICESIGNMAIL BOXBLOW OFFFIBER OPTIC CABLE MARKERGAS LINE MARKERGAS VALVE69$5662%,59,0)*9*SHEET NUMBERPLAN REVISIONSSTRAP NUMBERSPROJECT / FILE NO.SCALEFIELD BOOKCHECKED BYDRAWN BYSURVEY DATEDRAWING DATA2 OF 3BOUNDARYSURVEY2378023-50-2508-15-2019P. OLSENSAW1"=100'),/(1$0(/2&$7,213/27'$7(6':*-??':*?6859(<,1*?)5,$0/$<2873/27%< &+5,6(//,60F*5(*25%/9'68,7(32672)),&('5$:(5)2570<(56)/25,'$3+21()$;&,9,/(1*,1((5,1*/$1'6859(<,1*/$1'3/$11,1*)/25,'$&(57,),&$7(62)$87+25,=$7,21(1*,1((5,1*6859(<,1*/%35(3$5(')25352-(&7'(6&5,37,21A SUBDIVISION LYING INSECTIONS 14, 23 AND 26,TOWNSHIP 50 SOUTH,RANGE 25 EAST,COLLIER COUNTY, FLORIDAPLAT BOOK 1, PAGE 27,COLLIER COUNTY RECORDSNaples Grovesand Truck Co’sLittle Farms No. 2LOTS 81 THROUGH 90 OF THERECORD PLAT0,172&20081,7,(686$3$5.2$.6%28/(9$5'68,7(7$03$)/:::0,172&20)$;3+21(352-(&76859(<251279$/,':,7+2877+(6,*1$785($1'7+(25,*,1$/5$,6('6($/2)$)/25,'$/,&(16('6859(<25$1'0$33(5/,&(16(18(5 67$7(2)352)(6 6 ,2 1$/6859(<25'0$33(56&277$:+((/(5 )/25,'$0%1$SEESHEET30 50 100 200SCALE IN FEETFLORIDA PLANE(EAST ZONE)COORDINATE SYSTEMNAD 1983(NSRS2007)N9.A.2.d Packet Pg. 543 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Lot 85Lot 84Lot 83Lot 80SW 1/4 of SE 1/4 of NE 1/4Section26Section25SectionLine1/4SectionLine1/4-1/4SectionLineTownship50South,Range25EastSection26NE 1/4Lot 82Lot 81Lot 78Lot 79SW 1/4 of NE 1/425'(P)25'(P)50'(P)25'(P)25'(P)RIGHTOFWAYLINE(P)(O.R. 4856, PG. 233, C.C.R.)61838080008ALEXIAN ENTERPRISES LLC(O.R. 5199, PG. 3180, C.C.R.)61838040006LARRY & MARJI POMPOSINI(O.R. 4870, PG. 318, C.C.R.)00395560307MINTO SABAL BAY, LLC(O.R. 4870, PG. 318, C.C.R.)00395560307MINTO SABAL BAY, LLCTract"L"(LAKE,L.M.E.&D.E.)(P)Road(P)"Isles of Collier Preserve Phase 12"(P.B. 64, PG. 64, C.C.R.)(O.R. 4856, PG. 233, C.C.R.)61838080008ALEXIAN ENTERPRISES LLCCountyDriveBayshore(UNIMPROVED)(P.B. 1, PG. 27A, C.C.R.)"Naples Groves and Truck Co's Little Farms No. 2"(INTERIOR FENCES & INTERIOR IMPROVEMENTS OTHER THAN THOSE SHOWN WERE NOT LOCATED)Section26Section23Section26Section27Section35Section26SE 1/4SW 1/4NW 1/4S00°19'19"W2688.11'(C)S89°32'19"WN00°19'45"ES89°32'10"W673.65'(C)1344.09'(C)648.48'(C)N00°20'11"E1344.00'(C)N00°21'03"E5375.10'(C)S89°32'10"W5389.90'(C)S00°20'11"W2688.24'(C)(1/4SEC.COR.TO1/4SEC.COR.)(1/4SEC.COR.TO1/4SEC.COR.)(1/4-1/4SEC.COR.TO1/4-1/4SEC.COR.)1347.31'(C)1347.31'(C)2688.37'(C)2686.73'(C)2695.29'(C)N89°32'23"E1321.80'(C)N89°32'21"E1321.88'(C)N89°32'19"E1321.97'(C)N89°32'14"E673.57'(C)672.04'(C)672.04'(C)672.03'(C)672.03'(C)336.01'(C)336.01'(C)336.03'(C)336.03'(C)673.48'(C)670.50'(P)1341.00'(P)1341.00'(P)1341.00'(P)670.50'(P)670.50'(P)669.00'(P)669.00'(P)669.00'(P)669.00'(P)334.50'(P)334.50'(P)334.50'(P)334.50'(P)WEST 1/4 COR. SEC. 26(CCR#22082)SOUTH 1/4 COR.SEC. 26(CCR#22077)FD. 5/8" I.R. "LB 43 WILSON MILLER"0.07' E. OF PROP. COR.FD. 4"x4" C.M. (W/ 1/2" I.R.)0.06' E. OF C/LFD. 4"x4" C.M. (W/ 1/2" I.R.)0.35' E. OF 1/4-1/4 SEC. LINEFD. 4"x4" C.M. (W/ 1/2" I.R.)0.11' N. & 0.07' E. OF PROP. COR.FD. 5/8" I.R. "LB43"0.18' W. OF PROP. COR.FD. 3.5"x3.5" C.M.(TOP BROKEN)EAST 1/4 COR. SEC. 26(CCR #0022081)SET 1/2" I.R. "LB6940"FD. 1" I.R. 0.15' S. & 1.42' E.OF PROP. COR.SET 1/2" I.R. "LB6940"FD. 4"x4" C.M.(W/ 3/4" PIPE BROKEN)SOUTH 1/4 COR. SEC. 23N=637999.27(Y)E=404102.85(X)N=639343.35(Y)E=404110.57(X)N=639338.13(Y)E=403462.10(X)N=637961.07(Y)E=399386.68(X)N=635296.19(Y)E=402065.48(X)N=640671.26(Y)E=402098.38(X)N=638004.73(Y)E=404776.49(X)LEGEND:'B.M. BENCHMARK(C) CALCULATEDCCR# CERTIFIED CORNER RECORDC.M.R. COLLIER COUNTY RECORDSC/L CENTER LINECONC. CONCRETECB= CHORD BEARING=CD= CHORD DISTANCE=CH= CHORD BEARING & DISTANCE=C.M. CONCRETE MONUMENTCOR.CORNERC.U.E. COUNTY UTILITY EASEMENTΔ= DELTA OR CENTRAL ANGLE=(D) DEEDD.B. DEED BOOKEL. ELEVATION(F) FIELDFD. FOUNDF.D.O.T. FLORIDA DEPARTMENT OFTRANSPORTATIONF.P. & L. FLORIDA POWER & LIGHT CO.FRAC. FRACTIONI.E. IRRIGATION EASEMENTI.P. IRON PIPEI.R. IRON RODL= LENGTHLB LICENSED BUSINESSL.B.E. LANDSCAPE BUFFEREASEMENTL.M.E. LAKE MAINTENANCEEASEMENT(M) MEASUREDO.R. OFFICIAL RECORD BOOK(P) PLATP.B. PLAT BOOKP.C. POINT OF CURVATUREPG. PAGEP.K. PARKER-KALONP.R.M. PERMANENT REFERENCEMONUMENTPROP. PROPERTYP.T. POINT OF TANGENCYP.V.C. PLASTIC PIPER= RADIUS=R.C.P. REINFORCED CONCRETE PIPEREF. REFERENCER/W RIGHT OF WAYTYP. TYPICALSEC. SECTIONW/ WITHWIT. WITNESS(9:7:&$ 79SET "MAG" NAIL WITH DISC STAMPED LB6940SET 1/2" IRON ROD WITH CAP STAMPED LB6940SET 4"x4" CONC. MONUMENT STAMPED LB6940FOUND NAIL AS NOTEDFOUND CONC. MONUMENT AS NOTEDFOUND IRON PIPE OR IRON ROD AS NOTEDDRAINAGE INLETDRAINAGE MANHOLEMITERED END SECTIONYARD DRAINLIGHT POLEFLOOD LIGHTCONCRETE POWER POLEWOOD POWER POLEGUY ANCHORTELEPHONE BOXELECTRIC BOXCABLE TV BOXWATER VALVEWATER BOXFIRE HYDRANTBACK FLOW ASSEMBLYAIR RELEASE VALVEIRRIGATION VALVEIRRIGATION SERVICEWELLSANITARY MANHOLESANITARY SERVICESIGNMAIL BOXBLOW OFFFIBER OPTIC CABLE MARKERGAS LINE MARKERGAS VALVE69$5662%,59,0)*9*SHEET NUMBERPLAN REVISIONSSTRAP NUMBERSPROJECT / FILE NO.SCALEFIELD BOOKCHECKED BYDRAWN BYSURVEY DATEDRAWING DATA3 OF 3BOUNDARYSURVEY2378023-50-2508-15-2019P. OLSENSAW1"=100'),/(1$0(/2&$7,213/27'$7(6':*-??':*?6859(<,1*?)5,$0/$<2873/27%< &+5,6(//,60F*5(*25%/9'68,7(32672)),&('5$:(5)2570<(56)/25,'$3+21()$;&,9,/(1*,1((5,1*/$1'6859(<,1*/$1'3/$11,1*)/25,'$&(57,),&$7(62)$87+25,=$7,21(1*,1((5,1*6859(<,1*/%35(3$5(')25352-(&7'(6&5,37,21A SUBDIVISION LYING INSECTIONS 14, 23 AND 26,TOWNSHIP 50 SOUTH,RANGE 25 EAST,COLLIER COUNTY, FLORIDAPLAT BOOK 1, PAGE 27,COLLIER COUNTY RECORDSNaples Grovesand Truck Co’sLittle Farms No. 2LOTS 81 THROUGH 90 OF THERECORD PLAT0,172&20081,7,(686$3$5.2$.6%28/(9$5'68,7(7$03$)/:::0,172&20)$;3+21(352-(&76859(<251279$/,':,7+2877+(6,*1$785($1'7+(25,*,1$/5$,6('6($/2)$)/25,'$/,&(16('6859(<25$1'0$33(5/,&(16(18(5 67$7(2)352)(6 6 ,2 1$/6859(<25'0$33(56&277$:+((/(5 )/25,'$0%1$SEESHEET20 50 100 200SCALE IN FEETFLORIDA PLANE(EAST ZONE)COORDINATE SYSTEMNAD 1983(NSRS2007)N9.A.2.d Packet Pg. 544 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann ^,KK>/DWdE>z^/^ 9.A.2.d Packet Pg. 545 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 546 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 547 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 548 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Z,/ddhZ>ZEZ/E'^ 9.A.2.d Packet Pg. 549 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann ARCHITECTURAL RENDERINGS OF PROPOSED STRUCTURES TWIN VILLAS 50’ SINGLE FAMILY LOTS 62’ SINGLE FAMILY LOTS Please note: The following models are currently built or being constructed in Isles of Collier Preserve. New or additional models may be provided at a later date in reaction to market demands. All units will be in conformance with the property development regulations. 9.A.2.d Packet Pg. 550 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann TWIN VILLAS 9.A.2.d Packet Pg. 551 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 552 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 553 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 554 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 50’ SINGLE FAMILY LOTS 9.A.2.d Packet Pg. 555 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 556 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 557 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 558 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 62’ SINGLE FAMILY LOTS 9.A.2.d Packet Pg. 559 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 560 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 561 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 562 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 563 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann ^dEWZ^Zsy,//d^ 9.A.2.d Packet Pg. 564 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann $&$&)25(;+,%,721/<127)25&216758&7,213/$167$786352-(&7'(6&5,37,21),/(1$0(/2&$7,213/27'$7((;,67,1*67$':*-??':*?=21,1*??(;+,%,76?:('$0$1'3$572)6(&7,213$572)6(&7,2172:16+,36287+5$1*(($67&2//,(5&2817<)/25,'$7+(,6/(672:16+,36287+5$1*(($672)&2//,(535(6(59(7+,63/$1,635(/,0,1$5<$1',17(1'(')25&21&(378$/3/$11,1*385326(621/<6,7(/$<287$1'/$1'86(,17(16,7,(625'(16,7,(60$<&+$1*(6,*1,),&$17/<%$6('83216859(<(1*,1((5,1*(19,5210(17$/$1'255(*8/$725<&21675$,176$1'2523325781,7,(63/27%<$1*(/,&$+$5'<'5$:,1*1279$/,':,7+2876($/6,*1$785($1''$7(&23<5,*+7%$55$&2$1'$662&,$7(6,1&5(352'8&7,21&+$1*(625$66,*10(176$5(352+,%,7('35(3$5(')250,172&20081,7,(686$3$5.2$.6%28/(9$5'68,7(7$03$)/:::0,172&20)$;3+21(0F*5(*25%/9'68,7(32672)),&('5$:(5)2570<(56)/25,'$3+21()$;arracoand Associates, Inc.B&,9,/(1*,1((5,1*/$1'6859(<,1*/$1'3/$11,1*www.barraco.net)/25,'$&(57,),&$7(62)$87+25,=$7,21(1*,1((5,1*6859(<,1*/%&52665()(5(1&(''5$:,1*6%$6(3/$1 67$':*&52665()(5(1&(''5$:,1*6&52665()(5(1&(''5$:,1*6&3/$15(9,6,2166+((7180%(5352-(&7),/(12(;,67,1*63(&,$/75($70(17$5($$&$&$&127,1&/8'('6$%$/%$<38'16:( 6&$/(,1)((7127,1&/8'('/(*(1'$33529('6$%$/%$<38'(;,67,1*63(&,$/75($70(17$5($66$%$/%$<38'$'',7,21(;,67,1*&216(59$7,21$5($$&9.A.2.d Packet Pg. 565 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann )25(;+,%,721/<127)25&216758&7,213/$167$786352-(&7'(6&5,37,21),/(1$0(/2&$7,213/27'$7(352367$':*-??':*?=21,1*??(;+,%,76?02130$1'3$572)6(&7,213$572)6(&7,2172:16+,36287+5$1*(($67&2//,(5&2817<)/25,'$7+(,6/(672:16+,36287+5$1*(($672)&2//,(535(6(59(7+,63/$1,635(/,0,1$5<$1',17(1'(')25&21&(378$/3/$11,1*385326(621/<6,7(/$<287$1'/$1'86(,17(16,7,(625'(16,7,(60$<&+$1*(6,*1,),&$17/<%$6('83216859(<(1*,1((5,1*(19,5210(17$/$1'255(*8/$725<&21675$,176$1'2523325781,7,(63/27%<$1*(/,&$+$5'<'5$:,1*1279$/,':,7+2876($/6,*1$785($1''$7(&23<5,*+7%$55$&2$1'$662&,$7(6,1&5(352'8&7,21&+$1*(625$66,*10(176$5(352+,%,7('35(3$5(')250,172&20081,7,(686$3$5.2$.6%28/(9$5'68,7(7$03$)/:::0,172&20)$;3+21(0F*5(*25%/9'68,7(32672)),&('5$:(5)2570<(56)/25,'$3+21()$;arracoand Associates, Inc.B&,9,/(1*,1((5,1*/$1'6859(<,1*/$1'3/$11,1*www.barraco.net)/25,'$&(57,),&$7(62)$87+25,=$7,21(1*,1((5,1*6859(<,1*/%&52665()(5(1&(''5$:,1*6%$6(3/$1 67$':*&52665()(5(1&(''5$:,1*6&52665()(5(1&(''5$:,1*6&3/$15(9,6,2166+((7180%(5352-(&7),/(12352326('&216(59$7,21$5($6127,1&/8'('6$%$/%$<38'16:( 6&$/(,1)((7127,1&/8'('/(*(1'$33529('6$%$/%$<38'352326('&216(59$7,21$5($66$%$/%$<38'$'',7,21(;,67,1*&216(59$7,21$5($$&9.A.2.d Packet Pg. 566 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann KZ/EEEK͘ϬϱͲϱϵ 9.A.2.d Packet Pg. 567 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 568 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 569 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 570 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 571 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 572 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 573 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 574 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 575 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 576 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 577 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 578 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 579 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 580 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 581 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 582 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 583 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 584 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 585 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 586 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 587 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 588 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 589 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 590 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 591 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 592 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 593 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 594 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 595 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 596 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 597 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 598 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 599 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 600 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 601 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 602 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 603 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 604 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 605 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 606 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 607 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 608 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 609 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 610 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 611 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 612 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 613 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 614 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 615 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 616 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 617 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 618 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 619 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 620 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 621 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 622 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 623 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 624 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 625 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 626 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 627 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 628 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 629 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 630 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 631 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 632 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 633 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 634 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 635 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 636 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 637 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 638 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 639 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 640 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann KZ/EEEK͘ϭϮͲϭϮ 9.A.2.d Packet Pg. 641 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 642 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 643 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 644 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 645 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 646 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 647 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 648 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 649 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 650 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 651 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 652 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 653 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 654 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 655 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 656 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 657 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 658 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 659 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 660 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 661 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 662 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 663 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 664 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 665 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 666 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 667 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 668 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 669 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 670 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 671 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 672 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 673 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 674 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 675 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 676 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 677 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 678 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 679 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 680 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 681 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 682 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 683 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 684 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 685 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 686 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 687 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 688 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 689 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 690 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 691 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 692 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 693 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 694 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 695 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 696 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 697 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 698 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 699 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 700 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 701 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann y,//d^ʹ& xExhibit B: Development Standards xExhibit C: Master Plan & Water Management Plan xExhibit D: Legal Description xExhibit F: List of Development Commitments 9.A.2.d Packet Pg. 702 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann EXHIBIT B DEVELOPMENT STANDARDS No changes proposed to Development Standards in Ord 12-12 of the Sabal Bay MPUD 9.A.2.d Packet Pg. 703 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann $9$/21&$1$/6&$/( 5$3355533555(&9&3353&&&3)5/(/<0$125&$1$//(/<0$,1&$1$/$9$/21&$1$/&*&50)50)*&50)56)5$77/(61$.(+$002&.52$'&57+20$6621'5,9(7+20$6621/$1(%$<6+25('5,9(/(/<0$125&$1$/38':(17:257+(67$7(6$$9$/21(/(0(17$5<9538'+$0,/721+$5%2550)%$<67+$0,/721$9(18('$1)25'67$9$/21&$1$/5557$0, $ 0, 7 5 $, / 8 6 5 2 :67$1'5(:6%/9'7+20$6621'5,9( 52:5$5%5$50)%08'550)&&$5',1$ / : $ <5356)$$ $67$'',7,21$/$&&(6632,1757<3($/$1'6&$3(%8))(52 0,17<3('/$1'6&$3(%8))(5 0,17<3(%/$1'6&$3(%8))(5 0,17<3('/$1'6&$3(%8))(5 0,17<3('/$1'6&$3(%8))(5 0,138'($671$3/(6&20081,7<3$5.38'1$3/(6%27$1,&$/*$5'(1 '()3/($6(0(17 38(&211(&7,21$7,17(56(&7,212)%$<675((7$1'+$0,/721$9(18( '(38'/(/<648$5(127,1&/8'('7<3($/$1'6&$3(%8))(5 0,1%8))(53(5/'&35(6(59(726(59($6%8))(5256833/(0(17$/3/$17,1*6:,//%(3529,'(',1$&&25'$1&(:,7+/'&720((77+(%8))(55(48,5(0(1767<3($/$1'6&$3(%8))(5 0,1%8))(53(5/'&7<3('/$1'6&$3(%8))(5 0,1%8))(53(5/'&%8))(53(5/'&7<3('/$1'6&$3(%8))(5 0,17<3('/$1'6&$3(%8))(5 0,138'%281'$5<7<3/(*(1'55(6,'(17,$/5(&9&5(&5($7,219,//$*(&(17(5&2&200(5&,$/2)),&(3)38%/,&)$&,/,7,(6335(6(59(86(,'35%1(5535(6(59(72%('(('('725%1(55$&&(6632,17:,7+52$':$<72$1')52038%/,&:$7(56833/<:(//5(6(59(')25($6(0(1772&2//,(5&2817<,17(51$/52$':$<6&21&(378$/,11$785((;$&75287($1':,'7+68%-(&772&+$1*($77,0(2)6'3253/$7(;,67,1*/$.(&$1$/35(6(59($5($672%('(('('72522.(5<%$<1$7,21$/(678$5,1(5(6($5&+5(6(59(127(,17(51$/$&&(6632,176$5(6+2:1)25*5$3+,&$/385326(6$1'$5(68%-(&772&+$1*(),1$//2&$7,216:,//%(3529,'('$77,0(2)6'3$33529$//$1'86(6800$5<86($&5($*(55(&9&&23)335%1(55/(/<0$,1&$1$/($6(0(17/(/<0$125&$1$/($6(0(17(;7+20$6621'5(;&$5',1$/:$<727$/&200(5&,$/$&&(6632,17y,//dΗΗ35%1(553$5&(/72%('(('('72522.(5<%$<1$7,21$/(678$5,1(5(6($5&+5(6(59($'',7,21$/67,38/$7,216$&3$5&(/$'',7,215$''$&5()/(,6&+0$113$5&(/$0+3(5&2817<&200(176$0+35(6(59($5($+$7&+/(*(1'3(5&2817<&200(176$0+3(5&2817<&200(176-563(5$77251(<&200(176$0+3(5&2817<&200(176$0+3(5&2817<&200(176$0+5(9125(9,6,21'(6&5,37,215(9'$7('5$:1%<(0312352-67$57'$7(:,/6210,//(567$17(&352-(&7180%(5,1'(;180%(56+((7180%(5&52665()180%(5+25,=217$/6&$/(7,7/(/($''(6,*1(5/($'7(&+1,&,$16(&7:35*(9(57,&$/6&$/(&/,(17352-(&7,668('(6&5,37,21,668('$7(&17<2)&RS\ULJKW:LOVRQ0LOOHU,QF:LOVRQ0LOOHU6WDQWHFF''1''1 1$6(6(6(6(&2//,(55(9,6('3(5&2817<&200(176'$7('-8/<-0/5(9,6('3(5&/,(17-0/&255(&7('/(*$/'(6&5,37,21-0/5(9,6('$1127$7,21)25/(*,%,/,7<$75('8&('6,=(6-0/6$%$/%$<038'038'0$67(53/$16DYHG30$1*(/,&$+$5'<_3ORWWHG$0$1*(/,&$+$5'<_-??GZJ?]RQLQJ??=GZJ_/D\RXW&,9,/(1*,1((5,1*/$1'6859(<,1*/$1'3/$11,1*0F*5(*25%/9'68,7()2570<(56)/25,'$3+21(ZZZEDUUDFRQHW)$;and Associates, Inc.arracoB35(6(59(726(59($6%8))(535(6(59(726(59($6%8))(5256833/(0(17$/3/$17,1*6:,//%(3529,'(',1$&&25'$1&(:,7+/'&720((77+(%8))(55(48,5(0(17612/$1'6&$3(%8))(55(48,5('$'-$&(17721$3/(6%27$1,&$/*$5'(1635(6(59(&216(59$7,21($6(0(1712/$1'6&$3(%8))(55(48,5('$'-$&(17721$3/(6%27$1,&$/*$5'(1635(6(59(&216(59$7,21($6(0(177<3('/$1'6&$3(%8))(5 0,1327(17,$/)8785(&211(&7,2172$'-$&(17&20081,7<9.A.2.d Packet Pg. 704 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 127,1&/8'('''''''''''''$$$$''&&&&(()'27'5$,1$*(75$&7/(/<0$125&$1$/:(,5(;,67,1*/(/<&$1$/:(,5%%))38'%281'$5<7<3%%21/<21/<$9$/21&$1$/6&$/( /(/<0$125&$1$//(/<0$,1&$1$/$9$/21&$1$/$9$/21&$1$/7$0, $ 0, 7 5 $, / 8 6 7+20$6621'5,9(5$77/(61$.(+$002&.52$'&57+20$6621'5,9(7+20$6621/$1(%$<6+25('5,9(%$<67/(/<0$125&$1$/:,1'67$5+$0,/721$9(18(1$3/(6%27$1,&$/*$5'(16+$0,/721+$5%25'$1)25'67*8/)2)0(;,&2(;,67,1*6+233(6$7+$002&.&29(&$5',1$/ : $ <)3/($6(0(17&21&(378$/:$7(50$1$*(0(17%$6,1%281'$5</,1(%$6,1&21752/6758&785(:,7+',6&+$5*(',5(&7,21635($'(56:$/(6:$/(25&$1$/*(1(5$/,=('685)$&(:$7(5)/2:',5(&7,21&8/9(57/$.(6%$6,1/,1(6&21752/6758&785(6&8/9(576$1'6:$/(6/2&$7,2166+2:1$5($3352;,0$7($1'68%-(&772$'-8670(17'85,1*7+(6'32533/352&(665,*+762):$<%5,'*(6$1',17(56(&7,216$5($3352;,0$7($1'68%-(&772$'-8670(17'85,1*7+(6'32533/352&(666,'(6/23(6(7&9(57,&$/75($70(17($57+5,35$35(7$,1,1*:$//$1'*5281'&29(5*5$6608/&+(7&$66+2:1,1&52666(&7,216$5(&21&(378$/$1'68%-(&772$'-8670(17'85,1*7+(6'32533/352&(66+$5'6&$3(0$7(5,$/6$63+$/7&21&5(7(3$9(5%5,&.(7&$66+2:1$5(&21&(378$/$1'68%-(&772$'-8670(17'85,1*7+(6'32533/352&(66/(*(1'+$7&+/(*(1'(;,67,1*/$.(&$1$/35(6(59($5($635(6(59($5($672%('(('('72522.(5<%$<1$7,21$/(678$5,1(5(6($5&+5(6(59(127(6$&3$5&(/$'',7,2155(9125(9,6,21'(6&5,37,215(9'$7('5$:1%<(0312352-67$57'$7(:,/6210,//(567$17(&352-(&7180%(5,1'(;180%(56+((7180%(5&52665()180%(5+25,=217$/6&$/(7,7/(/($''(6,*1(5/($'7(&+1,&,$16(&7:35*(9(57,&$/6&$/(&/,(17352-(&7,668('(6&5,37,21,668('$7(&17<2)&RS\ULJKW:LOVRQ0LOOHU,QF:LOVRQ0LOOHU6WDQWHFF''1-&(-0/''10$< 1$6(6(6(6(&2//,(55(9,6('3(5&2817<&200(176'$7('-8/<-0/5(9,6('$1127$7,21)25/(*,%,/,7<$75('8&('6,=(6-0/5(9,6('685)$&(:$7(5)/2:720$7&+0$67(56,7(3/$1$0+5(029('/$%(/3(5&200(176$0+6$%$/%$<038'&21&(378$/:$7(50$1$*(0(173/$16DYHG$0$1*(/,&$+$5'<_3ORWWHG$0$1*(/,&$+$5'<_-??GZJ?]RQLQJ??=GZJ_/D\RXW&,9,/(1*,1((5,1*/$1'6859(<,1*/$1'3/$11,1*0F*5(*25%/9'68,7()2570<(56)/25,'$3+21(ZZZEDUUDFRQHW)$;and Associates, Inc.arracoB9.A.2.d Packet Pg. 705 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Post Office Drawer 2800 • Fort Myers, FL 33902 Phone (239) 461-3170 • Fax (239) 461-3169 1 of 2 EXHIBIT D DESCRIPTION Lots 81 through 90, inclusive, Naples Groves and Truck Company's Little Farms No.2, according to the plat thereof as recorded in Plat Book 1, Page 27A, Public Records of Collier County, Florida. 9.A.2.d Packet Pg. 706 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann :RUGVXQGHUOLQHG DUHDGGLWLRQVZRUGVVWUXFN WKURXJKDUHGHOHWLRQV 6DEDO%D\038'$PHQGPHQW 38'53/ 385326( 6(&7,219,,, *(1(5$/'(9(/230(17&200,70(17 7KHSXUSRVHRIWKLV6HFWLRQLVWRVHWIRUWKWKHGHYHORSPHQWFRPPLWPHQWVIRUWKH6DEDO%D\ 038' 2QHHQWLW\KHUHLQDIWHUWKH0DQDJLQJ(QWLW\VKDOOEHUHVSRQVLEOHIRU38'PRQLWRULQJXQWLO FORVHRXWRIWKH38'DQGWKLVHQWLW\VKDOODOVREHUHVSRQVLEOHIRUVDWLVI\LQJDOO38' FRPPLWPHQWVXQWLOFORVHRXWRIWKH38'$WWKHWLPHRIWKLV38'DSSURYDOWKH0DQDJLQJ (QWLW\LVWKH&'&/DQG,QYHVWPHQWV,QF6KRXOG WKH0DQDJLQJ(QWLW\GHVLUHWRWUDQVIHUWKH PRQLWRULQJDQGFRPPLWPHQWVWRDVXFFHVVRUHQWLW\WKHQLWPXVWSURYLGHDFRS\RIDOHJDOO\ ELQGLQJGRFXPHQWWKDWQHHGVWREHDSSURYHGIRUOHJDOVXIILFLHQF\E\WKH&RXQW\$WWRUQH\ $IWHUVXFKDSSURYDOWKH0DQDJLQJ(QWLW\ZLOOEHUHOHDVHGRILWVREOLJDWLRQVXSRQZULWWHQ DSSURYDORIWKHWUDQVIHUE\&RXQW\VWDIIDQG WKHVXFFHVVRUHQWLW\VKDOOEHFRPHWKH0DQDJLQJ (QWLW\$V2ZQHUDQG'HYHORSHUVHOORIIWUDFWVWKH0DQDJLQJ(QWLW\VKDOOSURYLGHZULWWHQ QRWLFHWR&RXQW\WKDWLQFOXGHVDQDFNQRZOHGJHPHQWRIWKHFRPPLWPHQWVUHTXLUHGE\WKH 38'E\WKHQHZRZQHUDQGWKHQHZ RZQHU¶VDJUHHPHQWWRFRPSO\ZLWKWKH&RPPLWPHQWV WKURXJK WKH 0DQDJLQJ (QWLW\ EXW WKH 0DQDJLQJ (QWLW\ VKDOO QRWEH UHOLHYHG RI LWV UHVSRQVLELOLW\XQGHUWKLV6HFWLRQ:KHQWKH38'LVFORVHGRXWWKHQWKH0DQDJLQJ(QWLW\ LVQRORQJHUUHVSRQVLEOHIRUWKHPRQLWRULQJDQGIXOILOOPHQWRI38'FRPPLWPHQWV0LQWR 6DEDO%D\//&VKDOOEHWKH0DQDJLQJ(QWLW\IRU7UDFW5 GHSLFWHGRQWKH038'0DVWHU 3ODQ *(1(5$/ $OOIDFLOLWLHVVKDOOEHFRQVWUXFWHGLQVWULFWDFFRUGDQFHZLWK6'3VVXEGLYLVLRQSODWVLI UHTXLUHGDQGDOODSSOLFDEOH6WDWHDQGORFDOODZVFRGHVDQGUHJXODWLRQVDSSOLFDEOHWRWKLV 038' ([FHSW ZKHUH VSHFLILFDOO\ QRWHG RU VWDWHG RWKHUZLVH WKHVWDQGDUGV DQG VSHFLILFDWLRQVRI6HFWLRQ,,,([KLELW$'HVLJQ5HTXLUHPHQWVIRU6XEGLYLVLRQVRIWKH $GPLQLVWUDWLYH&RGHIRU&ROOLHU&RXQW\&RQVWUXFWLRQ6WDQGDUGV0DQXDODGRSWHGWKURXJK 2UGLQDQFH1RVKDOODSSO\WRWKLVSURMHFWHYHQLIWKHODQGZLWKLQWKH038'LVQRW WR EH SODWWHG 7KH 2ZQHUV WKHLU VXFFHVVRUV DQG DVVLJQV VKDOOEHUHVSRQVLEOHIRUWKH FRPPLWPHQWVRXWOLQHGLQWKLV'RFXPHQW 7KH2ZQHUVWKHLUVXFFHVVRUVRUDVVLJQHHVKDOOIROORZWKH0DVWHU3ODQDQGWKHUHJXODWLRQV RIWKH038'DVDGRSWHGDQGDQ\RWKHUFRQGLWLRQVRUPRGLILFDWLRQVDVPD\EHDJUHHGWR LQWKHUH]RQLQJRIWKHSURSHUW\,QDGGLWLRQDQ\VXFFHVVRUVRUDVVLJQHHVLQWLWOHWRWKH 2ZQHUVDUHERXQGE\WKHFRPPLWPHQWVZLWKLQWKLV'RFXPHQW7KHVHFRPPLWPHQWVPD\EH DVVLJQHGRUGHOHJDWHGWRDFRQGRPLQLXPKRPHRZQHUV DVVRFLDWLRQWREHFUHDWHGE\WKH 2ZQHUV8SRQDVVLJQPHQWRUGHOHJDWLRQWKH 2ZQHUVVKDOOEHUHOHDVHGIURPUHVSRQVLELOLW\ IRUWKHFRPPLWPHQWV 9.A.2.d Packet Pg. 707 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann :RUGVXQGHUOLQHG DUHDGGLWLRQVZRUGVVWUXFN WKURXJKDUHGHOHWLRQV 6DEDO %D\038'$PHQGPHQW 38'53/ 038'0$67(5'(9(/230(173/$1 $([KLELW ³$´ 038' 0DVWHU 3ODQ LOOXVWUDWHV WKH SURSRVHG GHYHORSPHQW DQG LV FRQFHSWXDOLQQDWXUH3URSRVHGWUDFWSDUFHORUODQGXVHERXQGDULHV RUVSHFLDOODQG XVHERXQGDULHVVKDOOQRWEHFRQVWUXHGWREHILQDODQGPD\EHYDULHGDWDQ\WLPHDW DQ\VXEVHTXHQWDSSURYDOSKDVHVXFKDVVXEGLYLVLRQSODWRU6'3DSSOLFDWLRQ6XEMHFW WRWKHSURYLVLRQVRI6XEVHFWLRQ(RIWKH/'&DPHQGPHQWVPD\EHPDGH IURPWLPHWRWLPH %$OOQHFHVVDU\HDVHPHQWVGHGLFDWLRQVRURWKHULQVWUXPHQWVVKDOOEHJUDQWHGWR LQVXUHWKHFRQWLQXHGRSHUDWLRQDQGPDLQWHQDQFHRIDOOVHUYLFHVDQGDOOFRPPRQ DUHDVLQWKHSURMHFW &7KH&RXQW\0DQDJHURUKLVGHVLJQHHVKDOOEHDXWKRUL]HGWRDSSURYHPLQRUFKDQJHV DQGUHILQHPHQWVWRWKH6DEDO%D\038'0DVWHU3ODQXSRQZULWWHQUHTXHVWRIWKH 2ZQHUVVXEMHFWWRWKHSURYLVLRQVVHWIRUWKLQ/'&6XEVHFWLRQ( (1*,1((5,1* $([FHSWDVQRWHGDQGDXWKRUL]HGDVDGHYLDWLRQLQWKLV38''RFXPHQWDOOSURMHFW GHYHORSPHQWZLOOEHFRQVLVWHQWZLWKSURYLVLRQVRI6HFWLRQVDQG RIWKH/'& 87,/,7,(6 $$OO&RXQW\RU&LW\ZDWHUGLVWULEXWLRQDQGVHZDJHFROOHFWLRQDQGWUDQVPLVVLRQIDFLOLWLHV WRVHUYHWKHSURMHFWVKDOOEHGHVLJQHGFRQVWUXFWHGFRQYH\HGRZQHGDQGPDLQWDLQHGLQ DFFRUGDQFHZLWK&ROOLHU&RXQW\2UGLQDQFH1RDVDPHQGHGDQGRWKHUDSSOLFDEOH &RXQW\RU&LW\UXOHVDQGUHJXODWLRQV %$OOFXVWRPHUVFRQQHFWLQJWR WKHZDWHUGLVWULEXWLRQDQGVHZDJHFROOHFWLRQIDFLOLWLHVVKDOO EHFRQVLGHUHGWREHFXVWRPHUVRIWKH&RXQW\RUWKH&LW\RI1DSOHVDVWKHFDVHPD\EH DQGVKDOOEHELOOHGE\WKH&RXQW\RU&LW\LQDFFRUGDQFHZLWKWKH&RXQW\¶VRU&LW\¶V HVWDEOLVKHGUDWHV &7KHGHYHORSPHQWVKDOOEHVXEMHFWWRDSSOLFDWLRQIRUDQGFRQGLWLRQVDVVRFLDWHGZLWK DZDWHUDQGVHZHUDYDLODELOLW\OHWWHUIURPWKH&ROOLHU&RXQW\3XEOLF:RUNV'LYLVLRQRU IURPWKH&LW\RI1DSOHV8WLOLWLHV'HSDUWPHQWZKLFKHYHULVDSSOLFDEOHLQDFFRUGDQFH ZLWKDSSOLFDEOHIUDQFKLVHVHUYLFHVERXQGDULHV '7KH2ZQHUVVKDOOUHVHUYHWKUHHUHTXHVWHGHDVHPHQWVDQGDVVRFLDWHGXWLOLW\DQGDFFHVV HDVHPHQWVWRFRQQHFWZLWKDSXEOLFULJKWRIZD\7KHVHVLWHVVKDOOEHXVHGIRUZHOOVQRW WRH[FHHG¶ E\¶IRUHDFKVLWHZLWKDPLQLPXPVSDFLQJRIIHHWEHWZHHQZHOOV 7KLVFRQYH\DQFHVKDOORFFXUDWWKHWLPHWKH6'3RUILQDOVXEGLYLVLRQDSSURYDOIRUWKH DUHDZLWKLQWKHGHYHORSPHQWSKDVHWKDWFRQWDLQVWKHHDVHPHQW (7KH2ZQHUVVKDOOSURYLGHDIRRWZLGHXWLOLW\HDVHPHQWRQWKHGHYHORSPHQWSURSHUW\ DORQJERWKVLGHVRI%D\VKRUH'ULYHLIGHWHUPLQHGWREHQHHGHGE\&ROOLHU&RXQW\ 9.A.2.d Packet Pg. 708 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann :RUGVXQGHUOLQHG DUHDGGLWLRQVZRUGVVWUXFN WKURXJKDUHGHOHWLRQV 6DEDO%D\038'$PHQGPHQW 38'53/ )'RZQVWUHDPZDWHUDQGZDVWHZDWHUV\VWHPFDSDFLWLHVPXVWEHFRQILUPHGDWWKHWLPHRI GHYHORSPHQWSHUPLW6'3RU33/UHYLHZDQGZLOOEHGLVFXVVHGDWDPDQGDWRU\SUH VXEPLWWDOFRQIHUHQFHZLWKUHSUHVHQWDWLYHVIURPWKH3XEOLF8WLOLWLHV(QJLQHHULQJDQG3URMHFW 0DQDJHPHQW'LYLVLRQDQGWKH*URZWK0DQDJHPHQW'HYHORSPHQW5HYLHZ'LYLVLRQ$Q\ LPSURYHPHQWV WR WKH &ROOLHU &RXQW\ :DWHU6HZHU 'LVWULFW¶V ZDWHU GLVWULEXWLRQ RU ZDVWHZDWHUFROOHFWLRQWUDQVPLVVLRQV\VWHPVQHFHVVDU\WRSURYLGHVXIILFLHQWFDSDFLWLHVWR VHUYHWKHSURMHFWZLOOEHWKHUHVSRQVLELOLW\RIWKHGHYHORSHUWRGHVLJQSHUPLWDQGFRQVWUXFW DQGZLOOEHFRQYH\HGWRWKH&ROOLHU&RXQW\:DWHU6HZHU'LVWULFWDWQRFRVWWRWKH&RXQW\ DWWKHWLPHRIXWLOLWLHVDFFHSWDQFH :$7(5 0$1$*(0(17 $,QDFFRUGDQFHZLWKWKH5XOHVRIWKH6RXWK)ORULGD:DWHU0DQDJHPHQW'LVWULFW WKLVSURMHFWVKDOOEHGHVLJQHGIRUDVWRUPHYHQWRIDGD\GXUDWLRQDQG\HDU UHWXUQIUHTXHQF\ %7KH2ZQHUV VKDOO GHVLJQ WKH ZDWHUPDQDJHPHQWIDFLOLWLHV LQ DFFRUGDQFHZLWK &RXQW\RUGLQDQFHV6WDWHDQG)HGHUDOPLQLPXPGHVLJQUHJXODWLRQVLQHIIHFWDW WKHWLPHRIVXEPLWWDORI6'3VRUFRQVWUXFWLRQSODQVRUSODWDSSURYDOVDVWKH FDVHPD\EH &$QH[FDYDWLRQSHUPLWVKDOOEHUHTXLUHGIRUWKHSURSRVHGODNHVLQDFFRUGDQFHZLWK 6XEVHFWLRQFRI2UGLQDQFHRI&ROOLHU&RXQW\&RGHRI/DZVDQG 2UGLQDQFHV$OOODNHGLPHQVLRQVVKDOOEHDSSURYHGDWWKHWLPHRIH[FDYDWLRQSHUPLW DSSURYDODQGVKDOOEHFRQVLVWHQWZLWKSHUPLWVLVVXHGE\WKH6RXWK)ORULGD:DWHU 0DQDJHPHQW 'LVWULFW ''HWDLOHGSDYLQJJUDGLQJDQGVLWHGUDLQDJHSODQVVKDOOEHVXEPLWWHGWR(QJLQHHULQJ 5HYLHZ6HUYLFHV6WDIIIRUUHYLHZDQGDSSURYDO1RFRQVWUXFWLRQSHUPLWVVKDOOEH LVVXHGXQOHVVDQGXQWLODSSURYDORIWKHSURSRVHGFRQVWUXFWLRQLQDFFRUGDQFHZLWK WKHDSSURYHGSODQVLV JUDQWHG (7KLV2ZQHUVVKDOOREWDLQDQ(QYLURQPHQWDO5HVRXUFH3HUPLWRU(DUO\:RUN3HUPLW IURPWKH6RXWK)ORULGD:DWHU0DQDJHPHQW'LVWULFWSULRUWR6'3DSSURYDO )7KH2ZQHUVVKDOODGKHUHWRWKHFRQGLWLRQVVHWIRUWKLQWKH2FWREHUDV DPHQGHG0DUFK$SULODQG2FWREHU&RPSDQLRQ $JUHHPHQW E\ DQG EHWZHHQ &ROOLHU /DQG 'HYHORSPHQW ,QF &ROOLHU 'HYHORSPHQW&RUSRUDWLRQDQG&ROOLHU&RXQW\UHJDUGLQJWKH/HO\$UHD6XUIDFH :DWHU'UDLQDJH,PSURYHPHQWVLQRUGHUWRIXUWKHUWKH/HO\$UHD6WRUPZDWHU ,PSURYHPHQW 3URMHFW /$6,3 7R IXUWKHU FODULI\ WKH DSSOLFDQW¶V UHVSRQVLELOLWLHVDUHDV IROORZV 9.A.2.d Packet Pg. 709 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann :RUGV XQGHUOLQHG DUHDGGLWLRQVZRUGVVWUXFN WKURXJKDUHGHOHWLRQV 6DEDO%D\038'$PHQGPHQW 38'53/ +DPLOWRQ$YHQXHIND)HUQ6WUHHWWKHDSSOLFDQWZLOOPDNHSURYLVLRQV LQWKHODQGSODQGHVLJQWRFRQWLQXHWRDOORZWKHFXUUHQWSRVLWLYHRXWIDOO DQG SURYLGH SK\VLFDO PDLQWHQDQFH WKURXJK WKH QDWXUDO IORZZD\ SRUWLRQVRIWKHRXWIDOOZLWKLQDSSOLFDQW¶VSURSHUW\&ROOLHU&RXQW\ZLOO EHUHVSRQVLEOHWRSURYLGHDOORQJRLQJSK\VLFDOPDLQWHQDQFH RIWKHFRQYH\DQFHZLWKLQWKH+DPLOWRQ$YHQXHIND)HUQ6WUHHWULJKW RIZD\ $YDORQ2XWIDOO&DQDO6\VWHPWKHDSSOLFDQWZLOOPDNHSURYLVLRQLQWKH ODQGSODQGHVLJQWRFRQWLQXHWRDOORZWKHFXUUHQWSRVLWLYHRXWIDOORIWKLV FDQDOE\UHORFDWLQJWKHFDQDOWRWKHZHVWHUO\SURSHUW\OLQHLQWKDWDUHDDV VKRZQRQWKH038'0DVWHU3ODQFRQVWUXFWDXQLIRUPFDQDOVHFWLRQDQG SODFHLWLQDQIRRWZLGHGUDLQDJHHDVHPHQWWREHSXUFKDVHGE\&ROOLHU &RXQW\ZKLFKLVFRQVLVWHQWZLWKSUHYLRXV38'DQG (53DSSURYDOV &ROOLHU&RXQW\ZLOOEHUHVSRQVLEOHWRSURYLGHDOORQJRLQJSK\VLFDO PDLQWHQDQFHRIWKHFRQYH\DQFHDQGHDVHPHQW2ZQHUVDJUHHWRSURYLGH OHJDO DFFHVV WR &ROOLHU &RXQW\ IRU WKH SXUSRVHV RI SURYLGLQJ VDLG PDLQWHQDQFH (19,5210(17$/ $%XIIHUVVKDOOEHSURYLGHGDURXQGZHWODQGVH[WHQGLQJDWOHDVWILIWHHQIHHW ODQGZDUGIURPWKHHGJHRIWKHMXULVGLFWLRQDOZHWODQGERXQGDU\LQDOOSODFHVDQG DYHUDJLQJ WZHQW\ILYH IHHW IURP WKH HGJH RI WKH MXULVGLFWLRQDO ZHWODQG ERXQGDU\ :KHUH QDWXUDO EXIIHUV DUH QRW SRVVLEOH VWUXFWXUDO EXIIHUV VKDOO EH SURYLGHGLQDFFRUGDQFHZLWKWKH6WDWHRI)ORULGD(QYLURQPHQWDO5HVRXUFHV3HUPLW 5XOHV %7KLV38'VKDOOFRPSO\ZLWKWKHJXLGHOLQHVRIWKH8QLWHG6WDWHV)LVKDQG:LOGOLIH 6HUYLFH86):6DQG)ORULGD)LVKDQG:LOGOLIH&RQVHUYDWLRQ&RPPLVVLRQ )):&&DQGDVDSSOLFDEOH&ROOLHU&RXQW\UHJXODWLRQVIRULPSDFWVWRSURWHFWHG VSHFLHV5HVWULFWLRQVZLWKLQEDOGHDJOHQHVWEXIIHU]RQHVVKDOOEHLQDFFRUGDQFH ZLWK 6WDWHDQG)HGHUDO0DQDJHPHQWJXLGHOLQHVDQGPD\UHTXLUHWHFKQLFDODVVLVWDQFHIURP WKH86):6DQG)):&&7KHOLVWHGVSHFLHVGRFXPHQWHGRQWKHSURSHUW\LQFOXGH $PHULFDQDOOLJDWRUJRSKHUWRUWRLVHOLWWOHEOXHKHURQVQRZ\HJUHWWULFRORUHGKHURQ ZKLWHLELVEDOGHDJOHZRRGVWRUN)ORULGDSDQWKHUDQG)ORULGDEODFNEHDU$+DELWDW 0DQDJHPHQW3ODQIRUOLVWHGVSHFLHVVKDOOEHVXEPLWWHGWR(QYLURQPHQWDO6HUYLFHV6WDII IRUUHYLHZDQGDSSURYDOSULRUWR6'3DSSURYDO 9.A.2.d Packet Pg. 710 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann :RUGVXQGHUOLQHG DUHDGGLWLRQVZRUGVVWUXFN WKURXJKDUHGHOHWLRQV 6DEDO%D\038'$PHQGPHQW 38'53/ & ,QDFFRUGDQFHZLWKUHTXHVWVIURP5RRNHU\%D\1DWLRQDO(VWXDULQH5HVHDUFK 5HVHUYH5%1(552ZQHUVDJUHHWRWKHIROORZLQJ 7KH&ROOLHU&RXQW\/HO\$UHD6WRUPZDWHU,PSURYHPHQW3URMHFW/$6,3 3HUPLWUHTXLUHVZDWHUTXDOLW\PRQLWRULQJIRUVRPHSHULRGRIWLPHDWWKH IXUWKHVWGRZQVWUHDPSRUWLRQRIWKH/HO\&DQDO'XULQJ-DQXDU\WKH 2ZQHUVSURYLGHG 5%1(55DFRS\RIWKHPRVWUHFHQWZDWHUTXDOLW\UHSRUW IRUWKHWHVWORFDWLRQVZLWKLQWKH6DEDO%D\038')RUVRORQJDVWKH/$6,3 3HUPLWUHTXLUHVZDWHUTXDOLW\PRQLWRULQJWKH2ZQHUVZLOOSURYLGHDFRS\ RIWKHDQQXDOZDWHUTXDOLW\PRQLWRULQJUHSRUWWR5%1(55$GGLWLRQDO UHSRUWVPD\EHREWDLQHGIURP6):0'XSRQUHTXHVW 7KH 2ZQHUV VKDOO LQFOXGH D SURYLVLRQ LQ WKH FRQVHUYDWLRQ HDVHPHQW UHTXLULQJ QRWLILFDWLRQ WR 5%1(55 LQ DGYDQFH RI DQ\ FKDQJHV WR WKH FRQGLWLRQV RI DQG RU GHGLFDWLRQ ODQJXDJH VHW IRUWK LQ WKH SURMHFW¶V FRQVHUYDWLRQHDVHPHQW7KH5%1(55ZLOOEHDOORZHG WRSDUWLFLSDWHLQWKH GLVFXVVLRQVRIDQ\SURSRVHGFKDQJHV 7KH 2ZQHUVVKDOOXWLOL]HZDWHUPDQDJHPHQW%HVW0DQDJHPHQW3UDFWLFHV %03¶VGXULQJFRQVWUXFWLRQWRPLQLPL]HDGYHUVHLPSDFWVRQZDWHUTXDOLW\ GXULQJGHYHORSPHQW SURYLGLQJSRVWGHYHORSPHQWZDWHUTXDOLW\PRQLWRULQJ DQGUHSRUWLQJDVVHWIRUWKLQ3DUDJUDSK&DERYH$GGLWLRQDOO\WKH 2ZQHUVZLOOVHHNWRLQFUHDVHSXEOLFDZDUHQHVVE\HGXFDWLQJUHVLGHQWVDQG WKHKRPHRZQHUV¶DVVRFLDWLRQWKURXJKWKHXVHRIVLJQDJHDQGWDNHKRPH LQIRUPDWLRQRIWKHSRWHQWLDOGDPDJHIURPVWRUPZDWHUSROOXWLRQRQWKH HQYLURQPHQW DQG WKH LPSRUWDQFH RI SURWHFWLQJ DTXDWLF DQG WHUUHVWULDO UHVRXUFHVZLWKLQDQGQHDUE\WKH5%1(55)XUWKHUWKH2ZQHUVVKDOOHUHFW VLJQDJH DW YDULRXV ORFDWLRQV DORQJ WKH 5%1(55 ERXQGDU\ PDNLQJ UHVLGHQWVDQGJXHVWVDZDUHRIWKHORFDWLRQDQGQDWXUDOUHVRXUFHLPSRUWDQFH RIWKHHVWXDULQHHFRV\VWHPDQGLWVPDQDJHPHQW7KHGHYHORSHUZLOOLQFOXGH LQWKHGHVLJQRIWKHEDFNERQHVXUIDFHZDWHUPDQDJHPHQWV\VWHPIRXU DGGLWLRQDO %HVW 0DQDJHPHQW 3UDFWLFHV %03¶V ZKLFK LQFOXGHV H[WHQGHGK\GUDXOLFUHVLGHQFHWLPHGXHWRLQFUHDVHGODNHDFUHDJHH[LVWLQJ DQGFUHDWHGZHWODQGDUHDV LQFRUSRUDWHG LQWR DWUHDWPHQW WUDLQFRQFHSW XSVWUHDPRIILQDOGLVFKDUJHSODQWHGILOWHUPDUVKHVLQFRUSRUDWHGLQWRD WUHDWPHQWWUDLQFRQFHSWXSVWUHDPRIZHWODQGWUHDWPHQWDUHDVLQFUHDVHG IORZ SDWK EHWZHHQ LQIORZ DQG RXWIORZ WKURXJK ERWK WKH SODQWHG ILOWHU PDUVKHV DQG WKH ZHWODQG WUHDWPHQW DUHDV 7KHVH %03¶V ZLOO EH LQFRUSRUDWHGGRZQVWUHDPRIWKHODNHV\VWHPDQGSULRUWRILQDOGLVFKDUJH IURPWKHV\VWHPWRSURYLGHDGGLWLRQDO³WUHDWPHQW´ RU³SROLVKLQJ´6XFK GHVLJQZLOOEHPDGHSDUWRIWKHGHYHORSPHQW¶VVXUIDFHZDWHUPDQDJHPHQW SODQVWREHUHYLHZHGDQGSHUPLWWHGE\6):0'DVDSDUWRIWKH(53 DSSOLFDWLRQ 7KH2ZQHUVVKDOOGLVFORVHLQWKHKRPHRZQHUDVVRFLDWLRQGRFXPHQWVWKDWWKH IROORZLQJDFWLYLWLHVPD\RFFXURQWKHDGMDFHQW5%1(55ODQGVH[RWLF SODQW 9.A.2.d Packet Pg. 711 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann :RUGVXQGHUOLQHG DUHDGGLWLRQVZRUGVVWUXFN WKURXJKDUHGHOHWLRQV 6DEDO%D\038'$PHQGPHQW 38'53/ UHPRYDODQGRQJRLQJPDLQWHQDQFHXWLOL]DWLRQRISUHVFULEHGEXUQVDVDPHDQV RIKDELWDWPDQDJHPHQWFRQWUROOLQJLOOHJDOGXPSLQJPDQDJHPHQWRIDFFHVV ZLWKLQ 5%1(55 ODQGV FRQWUROOLQJ DQG WUDSSLQJ ZKHQ QHFHVVDU\IHUDO QXLVDQFHDQGGRPHVWLFDQLPDOV 7KHWZRDUFKHRORJLFDOVLWHVGHWHUPLQHGWREHRISUHKLVWRULFFXOWXUDOVLJQLILFDQFH FUDQGFUVKDOOEHSUHVHUYHGDQGWKH2ZQHUVVKDOOFRRUGLQDWHZLWK WKH)ORULGD'LYLVLRQRI+LVWRULF5HVRXUFHVWRPLQLPL]HDQ\GLVWXUEDQFHWRWKHVH VLWHVGXULQJGHYHORSPHQWDQGDVDUHVXOWRIH[RWLFYHJHWDWLRQUHPRYDO 75$163257$7,21 $7KHGHYHORSPHQWVKDOODELGHE\6HFWLRQRIWKH/'&LQUHJDUGVWR7UDQVSRUWDWLRQ 'HPDQG 0DQDJHPHQW 7'0 VWUDWHJLHV UHTXLUHG IRU D SURMHFW WKDW DIIHFWV D 7UDQVSRUWDWLRQ&RQFXUUHQF\([HPSWLRQ$UHD7&($ %7KH2ZQHUVWKHLUVXFFHVVRUVRUDVVLJQVDJUHHWKDWWKHVRXWKZHVWFRQQHFWLRQWR86 DFURVVIURP6W$QGUHZV%RXOHYDUGZLOOEHDWWKHVROHGLVFUHWLRQRI)'27DQGVKDOODOLJQ ZLWK WKH H[LVWLQJ 6W $QGUHZV %RXOHYDUG 8SRQ FRQQHFWLRQ WR WKLV VLJQDOL]HG LQWHUVHFWLRQ WKH 2ZQHUV WKHLU VXFFHVVRUV RU DVVLJQV VKDOO DVVXPH VROH ILQDQFLDO UHVSRQVLELOLW\IRULQWHUVHFWLRQLPSURYHPHQWVUHODWLQJWRWKHXVHRIWKLVLQWHUVHFWLRQE\WKLV GHYHORSPHQW7KLVVKDOOLQFOXGHEXWQRWEHOLPLWHGWRWKHIROORZLQJ L $Q\ LQFUHDVH LQ WKH VWRUDJH FDSDFLW\ RI WKH QRUWKZHVWERXQG OHIW WXUQ ODQHV DSSURDFKLQJWKHVLJQDOFRQVWUXFWHGDWWKHWLPHRIFRQQHFWLRQ LL 'HVLJQ SXUFKDVH DQG LQVWDOODWLRQ RI DQ\ SK\VLFDO LQWHUVHFWLRQ LPSURYHPHQWV LQFOXGLQJ D PDVW DUP VLJQDO KHDGV SHGHVWULDQ VLJQDO KHDGVDQG DQ\ VLJQDO FRQWUROOHUVWKDWDUHQHFHVVDU\WRDFFRPPRGDWHWKLVGHYHORSPHQWVFRQQHFWLRQWRWKH VLJQDO LLL&RXQW\ RU )'27¶V FRVWV IRU VHWXS DQG PRGLILFDWLRQ RI LQWHUVHFWLRQ FRQWUROV LQFOXGLQJDPDVWDUPVLJQDOKHDGVSHGHVWULDQVLJQDOKHDGVDQGDQ\UHODWHGVLJQDO WLPLQJFKDQJHVWKDWDUHQHFHVVDU\WRDFFRPPRGDWHHDFKSKDVHRIWKLVGHYHORSPHQW 7KH2ZQHUVWKHLUVXFFHVVRUVRUDVVLJQVDJUHHWRUHLPEXUVHWKH)'27RUWKHDJHQF\ PDLQWDLQLQJWKHWUDIILFVLJQDOZLWKLQGD\VRIWKHDJHQF\¶VUHTXHVW LY &RUUHFWLRQRIDQ\QRQ$'$FRPSOLDQWIHDWXUHVZLWKLQWKH3XEOLF5LJKWRI:D\DWDOO IRXU TXDGUDQWV RI WKLV LQWHUVHFWLRQ WR EHFRPH FRPSOLDQW ZLWK WKH WKHQFXUUHQW $PHULFDQVZLWK'LVDELOLWLHV$FWUHTXLUHPHQWV´ &7KH2ZQHUV WKHLUVXFFHVVRUVRUDVVLJQVDJUHHWKDWDWWKH6W$QGUHZV%RXOHYDUGDFFHVV WKH\ZLOOPDLQWDLQDWKURDWGLVWDQFHRIDWOHDVWIHHWDVPHDVXUHGIURPWKHHGJHRI SDYHPHQWRI86WRWKHFORVHVWSRLQWRIDQ\JDWHRUJDWHKRXVH '7KH2ZQHUVWKHLUVXFFHVVRUVRUDVVLJQVDJUHHWKDWWKHSURMHFW¶VPDLQUHVLGHQWLDODFFHVV RQ86PD\EHDVLJQDOL]HGLQWHUVHFWLRQLIDSSURYHGE\)'277KH2ZQHUVWKHLU VXFFHVVRUV RUDVVLJQVVKDOO DVVXPH VROH ILQDQFLDOUHVSRQVLELOLW\ IRU LQWHUVHFWLRQ 9.A.2.d Packet Pg. 712 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann :RUGVXQGHUOLQHG DUHDGGLWLRQVZRUGVVWUXFN WKURXJKDUHGHOHWLRQV 6DEDO%D\038'$PHQGPHQW 38'53/ LPSURYHPHQWVUHODWLQJWRWKHXVHRIWKLVLQWHUVHFWLRQE\WKLVGHYHORSPHQW7KLVVKDOO LQFOXGHEXWQRWEHOLPLWHGWRWKHIROORZLQJ L 'HVLJQ SXUFKDVH DQG LQVWDOODWLRQ RI LQWHUVHFWLRQ LPSURYHPHQWV LQFOXGLQJ PDVW DUPVVLJQDOKHDGVSHGHVWULDQVLJQDOKHDGVDQGDQ\VLJQDOFRQWUROOHUVWKDWDUH QHFHVVDU\WRDFFRPPRGDWHWKLVGHYHORSPHQW¶VFRQQHFWLRQWRWKHVLJQDO LL $Q\DGGLWLRQDOVLJQDOWLPLQJDGMXVWPHQWVGLUHFWO\UHODWHGWRWKLVGHYHORSPHQW¶VWUDIILF VKDOODOVRUHPDLQWKHILQDQFLDOUHVSRQVLELOLW\RIWKLVGHYHORSPHQWLQSHUSHWXLW\ LLL'HVLJQSXUFKDVHDQGLQVWDOODWLRQRI$'$FRPSOLDQWLWHPVZLWKLQWKHSXEOLFULJKW RIZD\ (7KHPD[LPXPWRWDO GDLO\WULSJHQHUDWLRQIRUWKHDFUH7UDFW5DVVKRZQRQWKH 0DVWHU3ODQ VKDOOQRWH[FHHG WZRZD\30SHDNKRXUQHWWULSVEDVHGRQWKHXVHFRGHV LQ WKH ,7( 0DQXDO RQ WULS JHQHUDWLRQ UDWHV LQ HIIHFW DW WKH WLPH RI DSSOLFDWLRQ IRU 6'36'3$RUVXEGLYLVLRQSODWDSSURYDO )7KHGHYHORSHUVKDOOREWDLQDULJKWRIZD\SHUPLWSULRUWRFRPPHQFLQJFRQVWUXFWLRQRI7UDFW 5 $'',7,21$/&200(176 $3ULRUWRWKHLVVXDQFHRIWKHWK FHUWLILFDWHRIRFFXSDQF\IRUDVLQJOHIDPLO\KRPHWKH 2ZQHUVWKHLUVXFFHVVRUVRUDVVLJQVVKDOOSURYLGHDPLQLPXPRIRQHSOD\JURXQGIRUXVH E\UHVLGHQWVDQGWKHLUJXHVWVPHHWLQJ$670GHVLJQJXLGHOLQHV %7KH2ZQHUVWKHLUVXFFHVVRUVRUDVVLJQVVKDOOLQVWDOODSDWKZD\DORQJWKHODNHZKHUHWKH ODNHIURQWV7KRPDVVRQ'ULYHDQGVKDOOSURYLGHDPLQLPXPRIWKUHHEHQFKHVIRUSXEOLF XVHIRUWKLVSRUWLRQRIODNHIURQWDJHDWWKHWLPHGHYHORSPHQWRFFXUVDGMDFHQWWRWKHODNH &0LQWR 6DEDO %D\ //& ZLOO FRQWLQXH LQIRUPDWLRQDO PHHWLQJV ZLWK WKH &RPPXQLW\ 5HGHYHORSPHQW$JHQF\$GYLVRU\%RDUG XQWLOWKHFRQVWUXFWLRQRQ7UDFW5LVFRPSOHWHG '(QWU\JDWHVDW%D\VKRUH'ULYHZLOOEHVLPLODUWRH[LVWLQJJDWHVRQ 6DED'ULYHDWWKH 7KRPDVVRQ'ULYHHQWU\LQFOXGLQJDJDWHFKDLQOLQNFRQFUHWHZDOODQGODQGVFDSLQJ 9.A.2.d Packet Pg. 713 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann y,//d'ʹ^>z KhEZzD,t>/E^ 9.A.2.d Packet Pg. 714 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.d Packet Pg. 715 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /d/KE>/E&KZDd/KE ZYh^dz^d&& 9.A.2.d Packet Pg. 716 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 2271 McGregor Boulevard • Fort Myers, Florida 33901 Phone (239) 461-3170 • Fax (239) 461-3169 Fleischmann Parcel Additional Information Requested by Staff 19. Wellfield Risk There are no known Wellfield Risk Management Special Treatment Overlay Zones (WRM- ST) within the project area. According to the Collier County Wellfield Protection Zones 2010 GIS map, the City of Naples Coastal Ridge Well Field is the nearest WRM-ST area and is approximately 4 miles to the northwest. 12. Demonstrate that the design of the proposed stormwater management system and analysis of water quality and quantity impacts fully incorporate the requirements of the Watershed Management regulations of 3.07.00. The subject parcel will be designed and permitted to provide, at minimum, the water quality volume and attenuation as required by the Collier County Land Development Code, South Florida Water Management District, and any other local, state, or federal agency. Water quality volume may be provided via wet detention, filter marsh, or created wetland similar to the treatment system(s) within the Sabal Bay MPUD. The design criteria will include providing 150% water quality storage volumeprior to controlled discharge to onsite wetlands to the south. The subject parcel is directly adjacent and outside of the Lely Canal Basin within what is considered “miscellaneous coastal basin” and will continue to discharge as such. Therefore, the discharge from the storm water management system will be limited to 0.15 cfs per acre according to Collier County Ordinance 2001-27. The subject parcel is bounded along the north and east boundary lines by the Sabal Bay MPUD and has a general existing grade towards Dollar Bay to the south-southwest. The Avalon Outfall Canal borders the subject parcel to the east and serves as a hydraulic barrier from the Sabal Bay MPUD storm water management system. With the existing boundary conditions the onsite wetlands are considered isolated. Therefore, any wetland areas impacted as part of the development of the subject parcel will not require storage compensation. 9.A.2.d Packet Pg. 717 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 2271 McGregor Boulevard • Fort Myers, Florida 33901 Phone (239) 461-3170 • Fax (239) 461-3169 24.a. Provide overall description of the project with respect to environmental and water management issues. The subject parcel will be designed and permitted to meet the storm water management system requirements of the Collier County Land Development Code, South Florida Water Management District, and any other local, state, or federal agency. Water quality aspects may be provided via wet detention, filter marsh, or created wetland in a similar manner as the treatment system(s) employed within the Sabal Bay MPUD. The site is bounded to the north and east by the Sabal Bay MPUD and separated from the Sabal Bay MPUD storm water management system to the east by the Avalon Outfall Canal, which serves as a hydraulic barrier. The site currently drains to the south-southwest towards Dollar Bay. The discharge from the site will be limited to the allowable rate per Collier County Ordinance 2001-27 with the receiving body being Dollar Bay via the onsite preserve to the south. 9.A.2.d Packet Pg. 718 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann ,65,002.$/((5' 7$ 0 , $ 0 , 7 5 / ( 2,/:(//5' 65&2//,(5%/9'&50,//(5%/9'/,9,1*67215'(9(5*/$'(6%/9'67$0,$0,75/16$10$5&25'-$1(66&(1,&'51$20,673$77(5621%/9''$9,6%/9' 67(:$57%/9' 9$1'(5%,/7%($&+5' 6$%$/3$/05' 5$',25'(9(5*/$'(6%/9'13,1(5,'*(5' /<1&+%/9'$,5325738//,1*5'15$1'$//%/9'&$03.($,65'*22'/(77()5$1.5'12,/ :(// *5$'( 5' *2/'(1*$7(3.:<0(55,77%/9'9$1'(5%,/7'52/'7+$9(1( 7+$9(6(&25.6 & 5 ( : 5 ' *2/'(1*$7(%/9'(6$17$%$5%$5$%/9''(6272%/9'17+67 1 7+$9(1($9(0$5,$%/9'7+676:5'$9(1( 1'$9(6( *5((1%/9' *2/'(1*$7(%/9': %/$&.%8515' 7+$9(6(75$,/%/9'/2*$1%/9'1*25'21'53/$775'60,7+5'&5$<7215')5$1*,3$1,$9( /$.(75$))25'5' :$*21:+((/5'7+676:81,215'7+$9(6( :+,7(%/9' 7+$9(6( 7+$9(6( 7+$9(6(67676:7+$9(1( 7+$9(1( 7+$9(1(/$005'67676:7+676:1'$9(6(7+676:7+676:1'$9(1(7+676:7+676:5'676:667672$.(6%/9'67$9(1: 7+$9(1( 1 % $ 5 ) , ( / ' ' 5 7+$9(1( 7+$9(1( 7+$9(6( 7+$9(1( 6$1&78$5<5' 7+$9(1( 7+$9(6( 7+$9(6( 67$9(1( 7+$9(1( 7+$9(1( 7+$9(1( 7+$9(1( 7+$9(1( 7+$9(6(5,'*('57+$9(1( 7+$9(6( 7+$9(1(5'676:(67677+$9(6( 7+$9(1( 7+$9(1( 7+$9(1( 7+$9(1( 7+$9(6( 7+$9(1( 7+$9(6( 7+$9(1( 7+$9(6( 1'$9(1( 7+$9(6: 7+$9(6( 7+$9(6( 7+$9(6( 1'$9(1( 7+$9(6( 7+$9(6( 67$9(1(7+671(7+$9(6( 1'$9(1( 7+$9(6( 7+$9(6( 7+$9(1( 7+$9(1( 7+$9(1( 1'$9(1( 7+$9(6( 7+$9(1(%$/'($*/( '5 1'$9(6( 5$77/(61$.(+$002&.5' 1'$9(6( 7+$9(6(52&.5'1'$9(6( 7+$9(6( 1'$9(6( 7+$9(6( 7+$9(6 6+(5%/9'& $ 3 5 , % / 9 ' 7+$9(6( 7+$9(6( 7+$9(6( 7+$9(6( 7+$9(6( 7+$9(6($5%25%/9'7+$9(6(675$1'%/9'1'$9(6( .($1($9( 7+$9(6( 7+$9(6( 7+$9(6(7+6717+20$6)$505'7+$9(6( 1'$9(6( 1'$9(6( 7+$9(6(/,/$&/17+$9(6( 3(33(55' 7+$9(6( 1'$9(6( 7+$9(6( 7+$9(6( 7+$9(6( 7+$9(6( 7+$9(6(/2*$1%/9'6%(5621%/9' 7+$9(6( 1'$9(6( 7+$9(6( 7+$9(6(9,1(<$5'6%/9'7+$9(6(%,5'215'(67(<$9( 1'$9(6(*23+(55,'*(5'7+$9(6(1&2//,(5%/9':,/621%/9'13,3(5%/9' %,*&<35(665',1(=5'$17+(03 . : <,9<:$<%(&.%/9':+,7(/$.(%/9'6+(//,6/$1' 5'67+677+676(7+676(7+676(5,**65'7+676(1'676(7+676(17+6735,&(67 6,;/6)$505'9$/(:22''57+20$6621'5 17+677+676:*5$1'/(/<'57+676(1'676(7+676(),''/( 5 6 & 5 ( ( . 3 . : <1257+%522.('57+676()5,(1'6+,3/17+676(7+$9(1 *5((1:$<5'0$66(<671257+5'7+671(7+671(7+671(/,03.,15' 7+$9(6(&$56215'67676:1'671(%$6,/5':(67&/2;6 7 7:,1($*/(6%/9'7+6763$/0'51'$9(6:67671:25$1*(%/26620'5 67$9(6 7+671:7+671:48$55<'5:22' / $1' * 5$'( 5'5'676:7+676:7+676:5'671:.,1*6:$<3(/,&$1%$<%/9'7+671:7+671:7+671:%851+$05'7+671(7+671(7+671(7+671(7+671(&23(/1 7+671(3$&,),&*5$'(5'7+(/$1(7+671:7+$9(6(7+671:1'671(61$.(5' 3(/,&$10$56+%/9'72%,$667)5$1&(6671'671:*$ / / (21 ' 5 %$<6+25('5/$.(:22'%/9':0$,167 '(6272%/9'60 $ ' , 6 2 1 $ 9 ( :7+676:%(17215'%$5()227%($&+ %/9'.5$3(5'%21,7$%($&+5' .( 1 ' $ / / ' 5 /$*(5/1%(/$,5/17+671:0$1$7((5' -81*%/9'(7+676:7+671:6+$'<+2//2:%/9': :,**,163$665' 75$))25'2$.65'7+671:67$9(1 7+$9(6 7+$9(1 7+$9(1 62//677$</255' 7+$9(1 5'$9(1:7+671:7+$9(1:67671:720$725''835((*5$'(675$1'5'7+$9(1: 7+$9(1: 7+$9(1: 1'$9(1 7+$9(1:67671:7+671:7+$9(1: 7+$9(1:7+671:58052:7+$9(6: 1'$9(1: 7+$9(1:7+676:67$9(6: 6$1'3,3(5'5%$5()227:,//,$065'5'671:/(/<5(6257%/9':+,7$.(55' 5'$9(6 7+$9(1 7+$9(1:7+671:7+$9(1: 7+$9(6: 67$9(1: :,/')/2: ( 5 : $ <7+676:$,532575'7+$9(1:7+7(56:7+676:7+$9(6 5'$9(6: 7+$9(1: 7+$9(1:67+67&5(:65' 67$9(1 7+$9(1 (0$,167 7+$9(1 7+$9(1 7+676:7+$9(1*8/)6+25('5 -81*%/9': 5'$9(1:$,5325738//,1*5'6+,&.25<5'5'$9(1 *8/)6+25(%/9'67+$9(6(%/8(6$*('50$,16$,/'5 5'$9(1(*$5/$1'5'7+$9(6: 7+$9(6: -( ) ) ( 5 6 2 1 $ 9 ( : 7+$9(6::(%(5%/9'67+676/$$.62/1/(%8))65'/$(57(6/175,1,7<3/-$1'&%/9' ) / 2 5 , ' $ 1 $ 9 (%(1),(/'5'17+677+$9(6:6$1'3,3(5677+$9(6: (9(5/<$9( 7$+ , 7 , 5' '$1,(/65'6816(7%/9':,/621%/9'6'(//$'57+$9(6( ,9<'5 67$9(6::,/':22'%/9'$1*(/$5' 0$5./(<$9(+,*+&52)7'57+$9(6: %852$.6/1 )2575()8*(5'0$56+'5 7+$9(6: 7+$9(6: 67$9(6: $8'8%21%/9'6255(172/15'$9(6: 6$,17$1'5( : 6 % / 9 ' 6767 +817(565' %5$17/(<%/9' 7+$9(6 '29(75((67&+$03,216+,3'5 *$,/%/9' :2/)(5'&5($7,9('56816+,1(%/9'&<35(66: $ < (:(%(5%/9'1'2*:22':$</$1'0$5.676$1,7$7,215'5,9(565'6+2/7 = 6 7 0,//(5%/9'(;7,6/$1':$/.&,5 :,/'785.(<'5 0$57, 1 67 1' 6 7 5'67 &(/(67('50(1725'5 :(673257/10<57/(5'&$5,&$5'7+676(35,1*/(/1/$)$<(77(/16<&$025('5 *,1 /17+671(7+671(7+676(*8/)6+25(%/9'16($*5$66/1 $8725$1&+5'352*5(66$9(5,&+$5'667(;&+$1*($9( 9(521$:$/.&,5 1'671(7,%8521%/9'(&$<6'57($.:22''5 2/'/,9,1*67215'6$1'+,//671(:0$1'5 6+$'</1 3$/067/21*%2$7'5 +$5%285'5 6+$'<2$.6/1 7+676:&+85&+5'/((67 (678$5<'5 75((/,1('5 67$5*5$66/1 &28175<6,'('57$53215'&('$575((/1 +(5,7$*(%$<%/9'1277,1*+$0'5 (5,('5 '20(67,&$9( /$1&(:22':$<6&2// ,(5%/9'7(;$6$9(5,'*(5'1$3$:22'6:$<*25'21,$5''8'$5'7+$9(1 +,''(12$.6/1 :,17(59,(:'51'$9(*$7256/28*+/16+()),(/'$9(6$1&78$5<5'12875,**(5/1 *52 9 ( ' 5 $512/'$9( )5,7&+(<5' &25$/:22''5 7+$9(522.(5</1&233(5/($)/1 &/$66,&6'563$1,6+2$.6/1 %2;:22':$< %52$'$9(6 72:(55' '(/$62//1 3$,17('/($)/1<$+/67786&$1<5(6(59('5 -21(6*5$'(5'.$0/8&.'56811<*529($9(2$.02173.:<:(67$9(61'676$%/(5,'*(/1 1$3/(6+(5,7$* ( ' 5 3,(5(6+($7+:22''5&25620 ( ' , 7 ( 5 5 $ & , 5 $878012$.6/1 &25.6&5(:/1&+(55<:22''5 %851,1*75(('5:('*('5 $/%,5'7+7(56:.$32.677+671.(5,,6/$1'5' 5,'*(67 .22:$&+2%((75/ -$ 0 $ , & $ 5 ' (1*/,6+2$.6/1 (':$5'6*529(5'6+$'2:/$:1'5',;,('5 321'$33/('5(32//<$9(6$1'$/:22'/1 &855<5'67$1',1*2$.6/1 321'$33/('56 +,&.25<:22''5 ('*(0(5(:$<6 *2/'(12$.6/1 %26721$9(321'$33/('5:68 1 6 ( 7 5 '6$10$5&26%/9'3$5.6+25('5 7+$9(6:0$5%/(6721('532,1 &, $ 1 $ ' 5 6%$5),(/''5$87801:22'6%/9'7+676:/$'<%8*/17+676:321'$33/('51 %277/(%586+/1 +817 ( 5 % / 9 '1(:3257'57$//2:22':$< 7+67 028/'(5'50<57/(/1:(67%/9'/,1& 2 / 1 %/9 ' 581 $ : $ < / 1*$%5,(/&,5*5((175(('5$//(< 67$9(6 522675'5(75($7'5 602.(+286(%$<'56$1'</1&$77 6 6 7 7+3/6: 7$0$5,1'5,'*('5 7, * ( 5 7 $ , / & 7 68*$5%(55<67*8/)3$5.'5 5('+$:./1('(1$9( %$</$85(/'5 52%(576$9(: 6+$:%/9'1$3/(6%/9'5,9,(5$'5 7+676:$,53$5.%/9'7$</257(50$5%(//$/1 0$',6213$5.%/9'*22'/$1''5&$5,%%($15'0$+2*$1<5,'*('5 3$/0(772:22'6'5 0,6 6 , 2 1 ' 5 672&.$'(5'&2817<%$515':,1'67$5%/9'7+7(56:&('$5+$0 0 2 & . % / 9 ' &5((.6,'(%/9'+$:$,,%/9'/$5('267:22'6('*(3 . : < %$,/(</1,%,6: $ < -2+16215' 63, 1 1 $ . ( 5 ' 5 5$%%,75815' &5((&+5' 3( 1 1 < / 1 0225,1*/,1('5 7,92/,'5 *5,)),15'($67$9()25(67*/(1%/9' 86(33 $ ' 5 1$32 /, / 1:+,33225:,///1(175$'$$9( 673/6:3$5'5:+,77(1'5%,5',('5 0$*12/,$321''53/$7($85'% $ < & 2 / 2 1 < ' 5 )2 5 ( 6 7 + , / / 6 % / 9 ' (9(5(7767 :,&./,))('5 *5 2 9 ( 6 5 '%$527'50$1$'2'5 &$03$1,/(&,5 248,115' 3/29( 5 $ 9 (&28*$5'50$125%/9'6($*$7('5 &5<67$//$.('5 .,1*),6+5'0$3/(/1<$&+7+$5%25'5 .(17' 5 526( &77+7(56:%52:$5'679,//$*(:$/.&,5 52< $/ 0 $5 & 2 : $<7$/21'56,/9(5/$.(6%/9' (17(535,6($9(('*(0(5(:$<(%5<1:22' ' 5 9,.,1*:$<6$,17&/$,56+25(65'%(//$,5(%$< '5 .$5,1$&71'676:52<$/:22'%/9'1856(5</1-2+165' */$'(6%/9' $9 , $ 0 $ 5 & , 57+676:*5$1$'$'5/$03/,*+7(5'55('+$:./1%/8(%,//$9( 2:(16:$ < '$'(67 &/ 8 % & ( 1 7 ( 5 % / 9 ' +$:7+251:22'6:$< /,9,1*6721:22'6/16721(*$7('5&2 6 7 $ & , 5 /(/$1':$<&$%5(2'548((16:$< 7 + &7 6:48$,/9,//$*(:$<6 7 ( 5 / , 1 * 2 $ . 6 ' 5 (1&25(:$< /,77/(/($*8(5' &(5520$5'5 025*$15',/(;&,52/'(&<35(66 '5 3,6$:$<7$85(1&752<$/+$002&.%/9'.(16,1*721+,*+677+676:/$0%721/1*5$1$'$%/9 ' 2/'*529(65 ' +2//2:'5 6+$'<+2//2:%/9'( 0$5%(//$'5 75(()$505' 783( / 2 5 ')2;),5(/1526($9(%$66/13 2 5 7 ( 5 6 7 $6+)25'/1 /(0$16'51$66$85' $9 , / $ $ 9 ( 323(-2+13$8/ , , % / 9 ' &/8%(67$7(6'5 7 + 6 7 67 5 $ ' $ 3 / /($51,1*/1 3 (11 < 5 ' 6,/9(5)2;'5 %$<67 7,92/,&7&$-(387'57+$9(1 '2*/(*'5$1'5(:'5(/6$67 0,/$1267 ,19(51(66&/8%'5)8(/)$50 5 ' :,1',1 * 2$ . 6 : $ < 35263(&7$9(&$3(6$%/('5%( $ & + 5 ( 6 2 5 7 ' 57(5</5'/($:22'&,5*8,/)25'5' 3203(,/1 6815,6(%/9'7+676:)2;7$,/&7 3,1(677+$9(1 &<35(66'5 (/0&7 /(/<,6/$1'&,517+676800(53/:+,''(1/2235'0,//581&,5&5(679,(: :$<.,1*6/$.(%/9'6 7 ( , 1 % ( & . : $ <&52:1'53257$835,1&('55,9,(5$%/9':7+3/6:%2&$&,5(*5(7$9('$1%85<%/9'%($5 6 3 $ : 7 5 /677(56:&,7586/$.('5%52/,2/ 1 086(2&,5$/$0$1'$'5(+$0,/7215'81,7<:$<&2562%(/ / 2 ' 5 0251,1*681/1 */(1($*/(%/9'/ 8 , 6 $ / 1 ,1',*2/$.(6'5 * 5 ( < 2 $. 6 '5 1 *8/)3257&73/<02 8 7 + 3 / 2,/:(//3$5.5' $&5(0$.(55' &,7<*$7(%/9'1 52%,1$9( 7+&7 6 : 7+$9(1( /,0(6721(75/:,/6+,5(/$.(6%/9'52<$/&29('5 726&$1 $ : $ </(:,6/1(8523$'57+$9(6 *$5'(16%/9''(/%522.:$<%5$1'</1( '*(: $ 7(5 & 7 ($*/ ( & 5 ( ( . ' 5&$5/721/$.(6%/9'.(17670$5.(767$(5,(/1287(5'5+21'85 $ 6 $ 9 ( 7+$9(6(6$1'(56%/9'%(&.721 5 '67$7(67*8/)675($0'53(/,&$167:(67(//('5$33/(%<'5 7+$9(6(-8/,(7%/9' :,/':22'/15(*$/:$<+<$&,17+&7 7 + 6 7 6: <0&$5' 832/2/1 $72//&7 +,'($:$<&,5(%85173,1('5 520$&7 3$'2 9 $ 6 7 0 $ 5 6 $ / $ : $ <+(1/(<'5&+(6+,5(:$</$.(3$5.%/9')25(67/$.(6'5%$(=5'&+(55<2$.675/32 / < 1 ( 6 , $ & 7 02 1 7 ( 5 ( < ' 5 0,5525'575,$1*/(%/9'.(//(+(567 7+67 -26()$:$<',/6$/16287+325 7 & 9 +$//5'5 2 & . + , / / & 7 3$5.6721(3/ 3$/0$9(6811<6/23('5)$%/(&+( :$<&29(&,5('(1%$<'5 17+67:,6&216,1'5 66($6&70$+2*$1<'5 :+,'%(<:$< )2817$,19,(:&,5 )$,50217/1 )$ ,5 /$: 1 & 7 021 7 5 ( 8 ; / 1%<5216:$<%(1,&,$&7 /$17(51/1 .$5(1'5 -$0$,&$&7)$,5:$<&7 +(1'(5621'56$92 1 $ : $ < %(// ( 5 $ : $ / . % / 9 ' *8/)&2$67 ' 5 5,9(5:22'5'&+$17(//('53$1$0$9((',1*7213/2/'7$0,$0,75/+(1/(<67$6721'5+23(&,5 5' 7(5 6: :(1'</15,9(56,'(&,5/,3$5 , & 7 '28*/$6676,/ 9 ( 5 2 $ . 6 ' 5 &857,6679(50217/1 :< $ 7 7 / 1 :(,5'5/$.(9,(:'53$17(5$/1 ., 1 6 $ / ( % / 9 ' -$<*5((1%5,(5679$/(1&,$'5&+8/$9,67$67$8*867$'5'(17'50$5(7('5&87/ $ 66 /1 $/,&(/1 (16(1 $ ' $ ' 5 121$0(/1 *529(/$1'7(5 +2//<$9(0<67,&5,9(5'57$//2$.5' 6%($ & + ' 5 &85&,(5'+$:.65,'*('5 3$17+ ( 5 / 1 7+&7 6 : ;(1,$/1 17+6775, 1 , ' $ ' 6 7 3,1(:22'6&,5 &85/(:$9(%86+67:5'676:6&+22/'5+(521/17200$6,&7 /,*+7+286(5' $0,7<5' 2$.67 :$7 (5 /($) & 7 35(6:, & . / 1 5'3/6: ,1$*8$:$< 7523+<'5 7( 5 5 $ & , 1 $ : $ < 58%<:$< 5(')2; 5 8 1 .,/.(11<:$<72:(5'5%86,1(66&,5 /255$,1($9( %$ / 7 8 6 5 2 / ' 5 +2*$1&7&2&2187$9( /2:(//' 5 6(0,12/($9(7$5$&,5',$1$$9( 3(56,0021'5 3,672,$ :$< % $ 5 & $50 , / : $ < 7857/(+$7&+5' ,9,6$$9( %(/9, / / ( % / 9 ' /( * $ & < / 1 /(0$ & 7 %8/586+/15,$/72 :$< %(//&,5 %,6& $ < 1 ( & 7 .$<$.'5 687+(5/$1'$9(0$7+(:6679$/(17,1$&7 3,1(.(</1 *8(9$5$$9( /,0(.(</1 62 & , ( 7 < & 7 :$/.(5%,/75' :$** / ( : $ <32720$&&76,/9(5$'2'5 :+,7(:$<7,*(5 /,/< '53($&+&73(/721$9(: , / / , $ 0 6 / 1 &/8%+286('5 3,1(75(('5',02&./1:20 % / ( 6 5 '3,$&(5(:$<% $ 1 $ 1 $ / 1 6($*5$3($9( 3$/0(772'81(6&,5 $3352$&+%/9'+21(<%(('5 0,5$+$07(5/21*6+25(:$<6 &$<0$1/15'67:$ 9 , $ 7 ,2 1 ' 5 6 )8/72167,5216721(7(5+$002&.2$.'5&(//( : $ < %$<9,(:$9(,%,6&/8%'5,5*$1*5'7$ + , 7 , 6 7 3$/0635,1*6%/9'%5$0% / ( & 7 '2/$167 -8/,$/1%522.6,'('59$//(<675($0'5%(508'$/16$0$5$9(:22'6,'($9( &52: 1 ( ' ( $ * / ( / 1 */2%$/'5 &<35(6632,17'5&2/21,$/'5 7$</2567/$85(/*5((1/16&/$1&<$9( */(1('(1%/ 9 ' &$52/,1$:$<9(5$1'$:$<+25,=21/1 3,1(&767$5),6+ $9(0$5,12&,5,1/(7&29(/1:7+671:,/0$5/19(5'('5%877(5)/<3$/0'5-$'('5 67$5%2$5''5 6$13$%/2&7 9(7(5$160(025,$/%/9'9(1(723/526%28*+:$< &2//,(5&(17(5:$<,5,6&7*$81767/$. ( + $ 0 0 2 & . ' 5,'</:22'/1%$6,.'53,1(*529(/1 &+85&+677+676:$5'(1$9( /(('$9(6.<:$<'50$9(5,&.&70$57,12&,563$1,6+026 6 7 5 /0$5&21,&70$5%/( & 7 +,*+&251(55'(6&$0%,$%$<*/(1($*/(&,5 6/$7 ( &767+671'676:& 2 5 6 , 1 , : $ < (,03(5,$/'5 0( ' , & , : $ <0$<)/2:(5:$<2/($1'(5'50,66,21+,//6'5 .5$)75'3($&+3/ '((5:22'&,5 '2&.6 , ' ( ' 5 *(1 2 9 $ & 79(1(=,$:$<%2/(52:$<%86+%/9'%2/( 5 2 ' 5 *5266(72:$< .,1*'20&7 35,1&('5 0(66,1$/1/8&.</1 58;7215' /$*81$:$<5'676:2635(<6/1'*6+(//'5/$1,(5&7 &/($5/$.(&,5 :,//2:3$5.'5 &$0(/27&,5 (&+2&,51'7(56:3,1($9( 6($%5((=($9( 6, ( 1 $ : $ < :(%%5' 75(( 7 2 3 6 ' 5:,1'621*&,5/$&267$&,50$/,%8/$.(&,5 3$*(7&,5 0$5,$11$:$<:,1' 6 2 5 6 4 7+$9(6(7+671(7+$9(6( 7+$9(6( 7+$9(1( 1'$9(1( 7+$9(6(7+671(3$17(5$/1 7+$9(6(7+$9(6( 7+$9(1( 7+$9(6( 7+$9(6( 7+$9(6( 7+$9(6(0(55,77%/9''(6272%/9'67+671(7+$9(1( 1'$9(1( 7+$9(6(7+676:7+$9(6( 7+$9(6( 7+$9(1( 7+$9(6(7+671(7+$9(6(:,/6+ ,5( /$.(6%/9' 67$9(6: 5'$9(1(7+676:7+$9(6( 7+$9(1:7+676:7+$9(6( 7+$9(6( 7+$9(6(5'676:5'$9(6: 1'$9(1( 7+$9(1( 7+$9(6( 1'$9(6( &/8% + 2 8 6 ( ' 5 7+$9(6( 7+$9(6( 7 $ 0 , $0 , 7 5 / ( 7+$9(6( 7+$9(6( 7+$9(6(7+$9(6( 7+$9(6( 7+$9(6(67676:7+$9(6( 7+$9(6( 7+$9(6(7+67 1 7+$9(6( $//(< 1'$9(6( 1'$9(6( $//( < 7+$9(6( 7+$9(6( 7+$9(6(1'671(7+$9(1( 1'$9(6( 7+$9(6( 7+$9(1( 7+$9(6(:,/621%/9'167$9(1: 7+$9(1( 7+$9(1(7+6711'$9(6( 7+$9(6( 7+$9(6( 1'$9(1(7+676:7+$9(6( 7+$9(6( 7+$9(6( 7+$9(1( 7+$9(1(7+671(7+671(7+$9(6( 7+$9(1( 1'$9(6( 7+$9(6( 7+$9(6( 7+$9(1( 7+$9(1( 1'$9(6( 7+$9(6(7+671(7+$9(6( 7+$9(1( 7+$9(1( 7+$9(1( 7+$9(6('(6272%/9'6%$/'($*/('5 $//(<7+$9(6('(6272%/9'17+$9(1( 7+$9(6: 7+$9(1( 7+$9(6( 7+$9(6( 7+$9(1(1'671(7+$9(1( 720$7 2 5 ' 7+$9(1( 7+$9(1( 7+$9(6( 7+$9(6(7+677+$9(6( 7+$9(1( 7+$9(6( 7+$9(6( 7+$9(6( 7+$9(1( 1'$9(1( 7+$9(6( 7+$9(1( 7+$9(6( 7+$9(6( 7+$9(6( 7+$9(6( 7+$9(6( 7+$9(1( 1'$9(1( 7+$9(6( 7+$9(6: 7+$9(1( 7+$9(1( 7+$9(6( 5'$9(1( 67$9(1( 7+$9(6( 7+$9(6(651'$9(1( 7+$9(6( 7+$9(6( 1'$9(6( 7+$9(6:7+671(3,1(671'$9(6( 7+$9(6( 7+$9(6( 7+$9(1( 7+$9(1: 7+$9(1(7+671(7+$9(6(7+671(7+$9(6( 7+$9(6( 7+$9(1( 67$9(1(7+676:7+671(7+$9(1( 7+$9(1( 7+$9(6( -81*%/9'(7+677+$9(1( 7+$9(6($//(<, $17+(03.: < 7+$9(1( 7+$9(6( 7+$9(6( 1'$9(6( 7+$9(6( 7+$9(6( 7+$9(1( 7+$9(1( 7+$9(6: 7+$9(6( 7+$9(1( 7+$9(6( 1'$9(6( 7+$9(6( 1'$9(6( 7+$9(6( 7+$9(6( 7+$9(6: 7+$9(6( 1'$9(6( 5'$9(1: (17(535,6($9( -81*%/9'( 7+$9(6: 7+$9(6( 7+$9(1( 7+$9(6( 7+$9(6( 7+$9(6( 7+$9(1( 7+$9(6( 7+$9(6( 1'$9(6(&2//,(5%/9'1'$9(6( 7+$9(6( 7+$9(1( 7+$9(1( 7+$9(6( 1'$9(6( 1'$9(6( 1'$9(6( 7+$9(6( 7+$9(6( 7+$9(6( 1'$9(6( 7+$9(1( &ROOLHU&RXQW\:HOO)LHOG3URWHFWLRQ=RQHV 0LOHV :HOO)LHOG3URWHFWLRQ=RQHV :=RQH <HDU7UDYHO7LPH,VRFRQWRXU :=RQH <HDU7UDYHO7LPH,VRFRQWRXU :=RQH <HDU7UDYHO7LPH,VRFRQWRXU :=RQH <HDU7UDYHO7LPH,VRFRQWRXU . 'DWD6RXUFH$HULDOV&ROOLHU&RXQW\3URSHUW\$SSUDLVHU &UHDWHG%\*,6&$'0DSSLQJ'HSDUWPHQW *URZWK0DQDJHPHQW'LYLVLRQ3ODQQLQJDQG5HJXODWLRQ )LOH:)3=P[G'DWH 0DSLV$SSUR[LPDWH'RQRWXVHIRUGHFLVLRQV 7KLVPDSPD\LQFOXGHDSSURYHGDQGXQDSSURYHGGDWD /HH&RXQW\ ,PPRNDOHH :HOO)LHOG $YH0DULD :HOO)LHOG &LW\RI1DSOHV (DVW*ROGHQ*DWH :HOO)LHOG 2UDQJHWUHH :HOO)LHOG &ROOLHU&RXQW\8WLOLWLHV *ROGHQ*DWH :HOO)LHOG )ORULGD*RYHUQPHQWDO 8WLOLW\$XWKRULW\ *ROGHQ*DWH&LW\ :HOO)LHOG &LW\RI 1DSOHV &RDVWDO 5LGJH :HOO)LHOG &ROOLHU&RXQW\8WLOLWLHV *ROGHQ*DWH :HOO)LHOG 3RUWRIWKH,VODQGV :HOO)LHOG /HH&RXQW\ (YHUJODGHV&LW\ :HOO)LHOG 9.A.2.d Packet Pg. 719 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann /^>^K&K>>/ZWZ^Zs '>E^d/E'^hDDZz DWEd> 9.A.2.d Packet Pg. 720 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann ISLES OF COLLIER PRESERVE EAGLE NESTING SUMMARY MAP AND TABLE 9.A.2.d Packet Pg. 721 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann NEW NESTEAGLE NESTCO-009BABANDONEDEAGLE NESTCO-0091EAGLE NESTCO-009AEAGLE NESTCO-024AABANDONED1EAGLE NESTCO-024BEAGLE NESTCO-028 LOST2015-16 ACTIVE2016-17 UNDETERMINED2017-18 UNDETERMINED2018-19 UNDETERMINED2019-20 ACTIVE2004-05 ACTIVE2005-06 ACTIVE2006-07 INACTIVE2007-08 INACTIVE2008-09 UNDETERMINED2009-10 UNDETERMINED2010-11 UNDETERMINED2011-12 UNDETERMINED2012-13 UNDETERMINED2013-14 UNDETERMINED2014-15 UNDETERMINED2015-16 UNDETERMINED2016-17 UNDETERMINED2017-18 UNDETERMINED2018-19 UNDETERMINED2019-20 UNDETERMINED2004-05 UNDETERMINED2005-06 UNDETERMINED2006-07 ACTIVE2007-08 ACTIVE2008-09 INACTIVE2009-10 UNDETERMINED2010-11 ACTIVE2012-13 UNDETERMINED2013-14 UNDETERMINED2014-15 UNDETERMINED2015-16 UNDETERMINED2016-17 UNDETERMINED2017-18 UNDETERMINED2018-19 UNDETERMINED2019-20 UNDETERMINED2007-08 ACTIVE2008-09 ACTIVE2009-10 ACTIVE2010-11 ACTIVE2011-12 ACTIVE2012-13 ACTIVE2013-14 ACTIVE2014-15 INACTIVE2015-16 ACTIVE2016-17 ACTIVE2017-18 ACTIVE2018-19 INACTIVE2019-20 INACTIVE'%++01$:5(9,6,216'$7('$7('$7('5$:,1*1R6+((71R:&,'$7(1760HWURSROLV$YHQXH6XLWH)W0\HUV)/3KRQH)D['5$:1%<'(6,*1('%<5(9,(:('%<,6/(62)&2//,(535(6(59($(5,$/:,7+($*/(1(67/2&$7,216$1'5(&(171(67,1*+,6725<(;+,%,7$GGHGWK WK\HDULQIRUPDWLRQ$GGHGWK WK\HDULQIRUPDWLRQ$GGHGWK WK\HDULQIRUPDWLRQQHZDHULDO$GGHG7K WK\HDULQIRUPDWLRQQHZDHULDO$GGHGWK\HDULQIRUPDWLRQQHZDHULDO9.A.2.d Packet Pg. 722 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Passarella & Associates, Inc.1 of 3 #04WCI1042 02/05/2020 ISLES OF COLLIER PRESERVE SUMMMARY OF BALD EAGLE NEST DATA February 2020 Nest I.D. No.Nesting Season Determination No. of Fledglings Nest Data Provided By CO-009 2000-2001 Active Unknown FWCC 2001-2002 Inactive None KLECE 2002-2003 Inactive; great horned owls present None KLECE and FWCC 2003-2004 Inactive None PAI 2004-2005 Inactive; quarter of nest remains None PAI 2005-2006 Inactive None PAI 2006-2007 Inactive; nest not present in slash pine None PAI 2007-2008 Inactive; nest not present in slash pine None PAI 2008-2009 Abandoned None PAI 2009-2010 No nest observed None PAI 2010-2011 No nest observed None PAI 2011-2012 No nest observed None PAI 2012-2013 No nest observed None PAI 2013-2014 No nest observed None PAI 2014-2015 No nest observed None PAI 2015-2016 No nest observed None PAI 2016-2017 No nest observed None PAI 2017-2018 No nest observed None PAI 2018-2019 No nest observed None PAI 2019-2020 No nest observed None PAI CO-009A 2002-2003 Active Unknown KLECE 2003-2004 Active Unknown KLECE 2004-2005 Active One PAI 2005-2006 Active Unknown PAI 2006-2007 Inactive; great horned owls present None PAI 2007-2008 Inactive; nest in disrepair None PAI 2008-2009 Undetermined Unknown No data 2009-2010 Undetermined Unknown No data 2010-2011 Undetermined Unknown No data 2011-2012 Undetermined Unknown No data 2012-2013 Undetermined Unknown No data 2013-2014 Undetermined Unknown No data 2014-2015 Undetermined Unknown No data 2015-2016 Undetermined Unknown No data 9.A.2.d Packet Pg. 723 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Passarella & Associates, Inc.2 of 3 #04WCI1042 02/05/2020 (Continued) Nest I.D. No.Nesting Season Determination No. of Fledglings Nest Data Provided By CO-009A (cont.) 2016-2017 Undetermined Unknown No data 2017-2018 Undetermined Unknown No data 2018-2019 Undetermined Unknown No data 2019-2020 Undetermined Unknown No data CO-009B 2007-2008 Active One PAI 2008-2009 Active One PAI 2009-2010 Active One PAI 2010-2011 Active Two chicks PAI 2011-2012 Active Two chicks PAI 2012-2013 Active One chick PAI 2013-2014 Active Unknown PAI 2014-2015 Inactive; great horned owls present Unknown PAI 2015-2016 Active Nest lost PAI 2016-2017 Active; late start (February) Unknown PAI 2017-2018 Active; late start (January)Unknown PAI 2018-2019 Inactive; great horned owls present Two owlets PAI 2019-2020 No nest observed None PAI CO-024A 2002-2003 Active Unknown FWCC 2003-2004 Active Two FWCC and PAI 2004-2005 Active Two PAI 2005-2006 Active; nest being rebuilt Unknown PAI 2006-2007 Active Unknown PAI 2007-2008 Active Two PAI 2008-2009 Inactive None PAI 2009-2010 Active One PAI 2010-2011 Active One chick PAI 2011-2012 Active Two chicks PAI 2012-2013 Active Unknown* PAI 2013-2014 Active Two eaglets PAI 2014-2015 Active One eaglet PAI 2015-2016 Active Unknown PAI 2016-2017 Inactive; great horned owls present One owlet PAI 2017-2018 Lost; nest tree down None PAI 2018-2019 Lost; nest tree down None PAI 2019-2020 Lost; nest tree down None PAI CO-024B 2008-2009 Active None PAI 2009-2010 Inactive; great horned owls present None PAI 2010-2011 Inactive; great horned owls present None PAI 2011-2012 Inactive; great horned owls present None PAI 2012-2013 Inactive; great horned owls present None PAI 9.A.2.d Packet Pg. 724 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Passarella & Associates, Inc.3 of 3 #04WCI1042 02/05/2020 (Continued) Nest I.D. No.Nesting Season Determination No. of Fledglings Nest Data Provided By CO-024B (cont.) 2013-2014 Inactive; great horned owls present None PAI 2014-2015 Abandoned Three owlets PAI 2015-2016 Abandoned Unknown PAI 2016-2017 Abandoned; no nest present None PAI 2017-2018 Abandoned; great horned owls present Unknown PAI 2018-2019 Abandoned None PAI 2019-2020 Abandoned; great horned owls present None PAI CO-028 2002-2003 Active Unknown FWCC 2003-2004 Inactive None FWCC 2004-2005 Inactive None FWCC 2005-2006 Undetermined Unknown No data 2006-2007 Active Unknown FWCC 2007-2008 Active Unknown FWCC 2008-2009 Undetermined Unknown FWCC 2009-2010 Active Unknown No data 2010-2011 Undetermined Unknown FWCC 2011-2012 Undetermined Unknown FWCC 2012-2013 Active Unknown FWCC 2013-2014 Active Unknown FWCC 2014-2015 Undetermined Unknown ** 2015-2016 Undetermined Unknown ** 2016-2017 Undetermined Unknown ** 2017-2018 Undetermined Unknown ** 2018-2019 Undetermined Unknown ** 2019-2020 Undetermined Unknown ** New Nest (directly south of Hamilton Harbor) 2015-2016 Active Unknown PAI 2016-2017 Undetermined Unknown No data 2017-2018 Undetermined Unknown No data 2018-2019 Undetermined Unknown No data 2019-2020 Active Unknown PAI *Nest failure, re-nesting observed. **FWCC nest data not available. FWCC – Florida Fish and Wildlife Conservation Commission KLECE – Kevin L. Erwin Consulting Ecologists, Inc. PAI – Passarella & Associates, Inc. USFWS – U.S. Fish and Wildlife Service 9.A.2.d Packet Pg. 725 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann ^/dW>E&KZdZdZͲϵ 9.A.2.d Packet Pg. 726 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 1*3(5,0(7(5%(50(/(9$7,2172%('(7(50,1('%<6):0'35,1&,3$/6758&785(35(6(59( 0,1,080 0,1,0805($5<$5''5$,1$*(1*35(6(59( /$.(0$,17(1$1&(($6(0(17/$.(&21752/(/(9$7,21)25(;+,%,721/<127)25&216758&7,2135(3$5(')25352-(&7'(6&5,37,21),/(1$0(/2&$7,213/27'$7(35236,7(3/$1':*-??':*?=21,1*??(;+,%,76?02130$1'3$572)6(&7,213$572)6(&7,2172:16+,36287+5$1*(($67&2//,(5&2817<)/25,'$7+(,6/(672:16+,36287+5$1*(($672)&2//,(535(6(59(0,172&20081,7,(686$3$5.2$.6%28/(9$5'68,7(7$03$)/:::0,172&20)$;3+21(7+,63/$1,635(/,0,1$5<$1',17(1'(')25&21&(378$/3/$11,1*385326(621/<6,7(/$<287$1'/$1'86(,17(16,7,(625'(16,7,(60$<&+$1*(6,*1,),&$17/<%$6('83216859(<(1*,1((5,1*(19,5210(17$/$1'255(*8/$725<&21675$,176$1'2523325781,7,(63/27%<&52665()(5(1&(''5$:,1*60F*5(*25%/9'68,7(32672)),&('5$:(5)2570<(56)/25,'$3+21()$;&,9,/(1*,1((5,1*/$1'6859(<,1*/$1'3/$11,1*)/25,'$&(57,),&$7(62)$87+25,=$7,21(1*,1((5,1*6859(<,1*/%$1*(/,&$+$5'<&52665()(5(1&(''5$:,1*6&52665()(5(1&(''5$:,1*6&'5$:,1*1279$/,':,7+2876($/6,*1$785($1''$7(&23<5,*+7%$55$&2$1'$662&,$7(6,1&5(352'8&7,21&+$1*(625$66,*10(176$5(352+,%,7('6+((7180%(53/$15(9,6,2163/$167$786352-(&7),/(12352326('0$67(56,7(3/$1)25575$&7 %8))(56 ,1',*&$/&83'$7(' 3(5&2817<&200(176 3(5$77251(<&200(176 3(5&2817<&200(176127,1&/8'(' 35(6(59(6(7%$&.3266,%/(287)$///2&$7,21$9$/21&$1$/($6(0(176725(0$,1127,1&/8'('&211(&7,2172(;,67,1*35(6(59(16:( 6&$/(,1)((735(6(59(726(59($6%8))(56((127(5352326('5(6,'(17,$/35(6(59(726(59($6%8))(56((127(127(35(6(59(60$<%(86('726$7,6)<7+(/$1'6&$3(%8))(55(48,5(0(176$)7(5(;27,&9(*(7$7,215(029$/,1$&&25'$1&(:,7+/'&6(&7,216$1'(6833/(0(17$/3/$17,1*6:,7+1$7,9(3/$170$7(5,$/66+$//%(,1$&&25'$1&(:,7+/'&6(&7,2135(6(59($& 0,16$%$/%$<38'$'',7,21$&6$%$/%$<38'$'',7,2135(6(59($&35(6(59($&(;,67,1*,1',*(128635(6(59(7235,1&,3$/6758&785(35(6(59(72/$.(3$5&(/$'',7,21,03529('%$<6+25('5,9(5,*+72):$<81,03529('%$<6+25('5,9(5,*+72):$<%8))(53(5/'& 0,1 2)7+((;,67,1*,1',*(128672%(35(6(59('0$;,080':(//,1*81,760$;,080'(16,7<'8$&5(23(163$&(5(48,5('[$& $&727$/3529,'('35(6(59( $&27+(5 $&5352326('5(6,'(17,$/0,1 $&5,17+((9(177+$77+(35(6(59('2(61276$7,6)<7+(%8))(55(48,5(0(17$)7(55(029$/2)(;27,&66833/(0(17$/3/$17,1*6:,//%(3529,'(',1$&&25'$1&(:,7+/'&720((77+(5(48,5(0(1762)$7<3($%8))(5(;+,%,7(7<3('/$1'6&$3(%8))(5 0,1%8))(5 3(5 /'&7<3( $ /$1'6&$3(%8))(5 0,17<3('/$1'6&$3(%8))(5 0,19.A.2.d Packet Pg. 727 Attachment: ATTACHMENT C - Applicants Back Up for Hearing Package (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann %2%##))%$()"$/"%( 2+( %$1))")%1#%*/$$8 %$**)9 + *2 $*%'+)* (2%*$*".&$)%$% )")6%""(()(, *5)#/+$()*$$$%(%%$%(#*%$#*$(($$*%*"/ -""%+(%$+"/=A**@2?<&#** )")%%""(()(,"+%+)#*$ (%%#3($&""$$((&()$**,(%#*(%-* $#$*&(*#$*%(*) )+(%$(",#"*"+(3 %$:%""(%+$*/"3%,3&(% * $+#(%(*)$('+)*)><=B<<<>?<@$*&("$'+)*%$)!$%-$)* ")#$$&("3 ) 5,(,-)+#))%$)%(*&(%&%).&$)%$ -)*%"**%""%-$ %$($)2 •&(%&%).&$)%$.&$)*$+#(%()$)-*%+*$/%(()&%$$ $()$%##+$*/7-#$*)3 *)%#)*)*)##$*)-"" $*%)+&&%(*#%(()$*)$+(($*%#%-$()#/()+"*$*"/(, &(%&%(*%$""/"))))*%*%)#$*)*$*/+(($*"/$ %/3 •&(%&%).&$)%$%* )#)*%%$,/#%)*%*$*)%* ,"%&(1 $*%3$,"%&#$*)%#&"*1&%))".&$))))%*-* *&(%&%).&$)%$#/%#*()&%$)"*/%(*%""*,%#%-$()3 $*)&%))")%#%*%).&$))#/""*%+(($*$%$7")#$$&(" ()$*)*)#/**)$%$7")#$$&("%#%-$()/**$*)% *&(%&%).&$)%$"("/&&(*%$**,"%&($*+*+( ")#$$&("%#%-$()3 *(+1*)-%+"$%*)%#*$+(($*()$*) -%+"()%$"/,.&*-$*/&+()*(%#)3 •+(($* )")%##+$*/8-*%+**")#$$&("*%$9)%+*)%* )&"*.$)*(*))%*-**/)%(,"%&#$*)*(*-()* &(%&%).&$)%$")$)*))&"*.$)*(*3.&$$*)*.$+*%(*/ *%*$*( )")%"/ 8$"+),%*&(%&%).&$)%$9%+" &%*$*""/)+ *+(($*%#%-$()*%$-$+$-"%#*%$"$$" %"*%$3 •,"%&()+#))%$))+)*%$7%$%##*#$*)%(*(("* #&(%,#$*)$%%($*%$-**/)%($* 3 *5)+$"( -*($/%*%).&$))-%+"*()&%$)"*/%+(($*8$%$7")#$$ &("9&(%&(*/%-$()3#%('+*"&&(%%+"%())$#$*%*) *(("*.&$))*%*()$*)%*")#$$&("1 $*%%(%*1+* $%*+(($* )")%%""(()(,()$*)-%($%*&(*%*&(%&%) ")#$$&("3 •")#$$&(")%#*%$+#(%+)%&(*%(*%))3 $*%5)&"$)) )+#**$"+)*(+*+("(((*%&(,$*#%,#$*%*)*%(*%))$*%() %*&("*/$*$%(%#%$)*(+*%$3)%$(,-%*%) )+#))%$)*)+$"(-%-""()&%$)"%($/%$7%$$$" ()&%$)"*)%(*#$*$$%*)((()/)*#)8+($"$!$)9 Input received from Gary Lubben via email on July 16, 2020 9.A.2.e Packet Pg. 728 Attachment: Attachment D - Public Input received (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) %($/$(#$*".&$)))%+"*("%*%$&"$)&(%,$'+*3 *-%+" "*%"*%$)("($*)+#))%$)*%*%+$*/$")%("* $#$#$*)*%* %+#$*)3 •$,(%$#$*(,-$))%*)+#))%$)#/$*%$""(*%$3 """))))#$*),$%$+*%(),("/()1*4 $%$"+),5 $$)%("(,-)%(",$* $*"$)*$)*))#)*%)-* +(($*()$*%)(,*%$)%")$*&(%&%),"%&#$*(3 $,(%$#$*"(,-)+#))%$)")%%$5*&&(*%())-*()*($ $% )$!)")%%+&/*%&(*%(*%)$)%$*&("3))%##%$ &$%#$%$3%&(*%(*%)$))+&&%(*)/#%*$*(&$$)-* %0$)%%*()&)3)*($ $%)$!)($$(1$%$7,$%#%+))$!) **"&*%%$*(%"%*()$!&%&+"*%$)3%#%*))$!)(,$%#%+)$ $(%+)*%+#$)3*#$#+#$))))#$*-*(*) $%)$!)( &()$*$*")#$$&("-%+"&&(-(($*3 $!/%+%((+""/%$)($*%$($) 5,()%,3 $*%)+"*,(/$ %##+$*/($-(&&/-*%*%+(%#$*,"%&(3())$* ))+)()$)!$()%$"$(%##%*%$))#)$**$"%")%*) &(% *$&(%3 9.A.2.e Packet Pg. 729 Attachment: Attachment D - Public Input received (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.e Packet Pg. 730 Attachment: Attachment D - Public Input received (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.e Packet Pg. 731 Attachment: Attachment D - Public Input received (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 1 LauraDeJohnVEN From:george.marienthal@comcast.net Sent:Wednesday, October 21, 2020 10:00 AM To:LauraDeJohnVEN Cc:ThomasClarkeVEN; BrockMaryJo Subject:Re Petition Number PL20190002305 EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Dear Laura DeJohn, thank you for your October 16, 2020, letter concerning petition number PL20190002305. I received the letter because I allegedly live within 500 or 1,000 feet of the proposed development. My address is 61 Constitution Drive. The letter is basically indecipherable for the following reasons. The first sentence is approximately 250 words in length. (Normal business sentences should be around 17 words in length, per The Elements of Style by Strunk and White.) The purpose of the petition, I believe, is to add 230 dwelling units, which is buried in the middle of the 250 word sentence. The map on the reverse of the letter is absolutely indecipherable. For example, it shows Bayshore Drive ending at Thomasson Drive, not factually correct. No street names below Thomasson Drive are shown. It is impossible to determine how close or far the development is to my residence. In summary, I respectfully request that your notice of public hearing be revised and reworked to become understandable. Thanks and regards, George Marienthal, (301) 807-6350 9.A.2.e Packet Pg. 732 Attachment: Attachment D - Public Input received (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 9.A.2.fPacket Pg. 733Attachment: PL20190002305 Affidavit of Posting Notice & Sign Pictures (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann 9.A.2.fPacket Pg. 734Attachment: PL20190002305 Affidavit of Posting Notice & Sign Pictures (14206 : PL20190002305 - Sabal 9.A.2.gPacket Pg. 735Attachment: Hybrid Meeting Waiver (14206 : PL20190002305 - Sabal Bay MPUD (PUDR) - Fleischmann Parcel) 11/19/2020 COLLIER COUNTY Collier County Planning Commission Item Number: 9.A.3 Item Summary: ***Note: This item was continued from the November 5, 2020 CCPC meeting.*** PL20190002105 CU: A Resolution of the Board of Zoning Appeals of Collier County, Florida providing for the establishment of a conditional use to allow a horticultural waste facility for the collection, transfer, processing, and reduction of solid waste with the accessory use of incidental retail sale of processed horticultural material within an Agricultural (A) zoning district in the Rural Fringe Mixed Use District (RFMUD), Receiving Lands, pursuant to Section 2.03.08.A.2.a.3.c.iv of the Collier County Land Development Code for a ±16.43-acre property located on the northeast corner of the intersection of Tamiami Trail East (U.S. 41) and Riggs Road, approximately five miles east of Collier Boulevard (C.R. 951), in Section 20, Township 51 South, Range 27 East, Collier County, Florida. [Coordinator: Timothy Finn, AICP, Principal Planner] Meeting Date: 11/19/2020 Prepared by: Title: – Zoning Name: Tim Finn 11/03/2020 11:06 AM Submitted by: Title: Manager - Planning – Zoning Name: Ray Bellows 11/03/2020 11:06 AM Approved By: Review: Planning Commission Diane Lynch Review item Completed 11/06/2020 10:52 AM Zoning Ray Bellows Review Item Completed 11/06/2020 12:02 PM Growth Management Operations & Regulatory Management Donna Guitard Review Item Completed 11/09/2020 11:26 AM Growth Management Department James C French Review Item Completed 11/09/2020 6:00 PM Zoning Ray Bellows Review Item Completed 11/10/2020 4:08 PM Planning Commission Edwin Fryer Meeting Pending 11/19/2020 9:00 AM 9.A.3 Packet Pg. 736 CU-PL20190002105, RICHDALE RECYCLING Revised Date: November 4, 2020 Page 1 of 13 STAFF REPORT TO: COLLIER COUNTY PLANNING COMMISSION FROM: ZONING DIVISION – ZONING SERVICES SECTION GROWTH MANAGEMENT DEPARTMENT HEARING DATE: NOVEMBER 19, 2020 SUBJECT: CU-PL20190002105; RICHDALE RECYCLING ______________________________________________________________________________ PROPERTY OWNER//AGENT: Owners: Agent: Dominick Cammuso 6350 Davis Blvd. Suite 102 Naples, FL 34112 Paula N. C. McMichael, AICP, Director of Planning Hole Montes, Inc. 950 Encore Way Naples, FL 34110 REQUESTED ACTION: To have the Collier County Planning Commission (CCPC) consider an application for the establishment of a conditional use to allow a horticultural waste facility for the collection, transfer, processing, and reduction of solid waste with the accessory use of incidental retail sale of processed horticultural material within a Rural Agricultural (A) zoning district in the Rural Fringe Mixed Use Overlay-Receiving Lands (A/RFMUO-Receiving Lands), pursuant to Section 2.03.08.A.2.a.(3)(c)iv of the Collier County Land Development Code for a ±16.43-acre property. GEOGRAPHIC LOCATION: The subject property is located on the northeast corner of the intersection of Tamiami Trail East (U.S. 41) and Riggs Road, approximately five miles east of Collier Boulevard (C.R. 951), in Section 20, Township 51 South, Range 27 East, Collier County, Florida. (See location map on the following page) 9.A.3.a Packet Pg. 737 Attachment: Staff Report - Richdale Recycling (13087 : PL20190002105 Richdale Recycling (CU)) CU-PL20190002105, RICHDALE RECYCLING Revised Date: November 4, 2020 Page 2 of 13 PURPOSE/DESCRIPTION OF PROJECT: The petitioner seeks a Conditional Use to allow a facility for the collection, transfer, processing, and reduction of horticultural solid waste and an accessory use of incidental retail sale of processed horticultural material (topsoil and mulch). The owner is currently operating a wholesale nursery from this location. The conceptual site plan provides ingress/egress from Riggs Road, landscape buffering, AG Resource Transfer Area, Nursery, an existing lake, staging area, shed, parking area, and a preserve fronting U.S. 41. 9.A.3.aPacket Pg. 738Attachment: Staff Report - Richdale Recycling (13087 : PL20190002105 Richdale Recycling (CU)) CU-PL20190002105, RICHDALE RECYCLING Revised Date: November 4, 2020 Page 3 of 13 9.A.3.aPacket Pg. 739Attachment: Staff Report - Richdale Recycling (13087 : PL20190002105 Richdale Recycling (CU)) CU-PL20190002105, RICHDALE RECYCLING Revised Date: November 4, 2020 Page 4 of 13 SURROUNDING LAND USE AND ZONING: This section of the staff report identifies the land uses and zoning classifications for properties surrounding the boundaries of the subject property, which is developed with a wholesale nursery and zoned Rural Agricultural (A) zoning district with a Rural Fringe Mixed Use Overlay- Receiving Lands (A/RFMUO-Receiving Lands): North: Developed residential, with a current zoning designation of A/RFMUO-Receiving Lands. East: Developed agricultural, with a current zoning designation of A/RFMUO-Receiving Lands. South: Tamiami Trail East (a six-lane arterial roadway) Tracts A and B, including the Academy Golf & Driving Range at Eagle Lakes Golf Course in Royal Palm Golf Estates Unit One and Tract A (Open Space) and right-of-way for Royal Hammock Boulevard in Royal Palm Golf Estates Replat #3, all of which are zoned Boyne South PUD (RPUD) with a Rural Fringe Mixed Use Overlay-Neutral Lands (A/RFMUO-Neutral Lands). Tract A of Royal Palm Golf Estates Unit One has Conditional Use approval for the establishment of a driving range (R-96-16) and a time extension (R-97-71). West: Riggs Rd (local road), then developed as a wholesale nursery, with a current zoning designation of Agricultural (A) zoning district. Aerial (Hole Montes) 9.A.3.a Packet Pg. 740 Attachment: Staff Report - Richdale Recycling (13087 : PL20190002105 Richdale Recycling (CU)) CU-PL20190002105, RICHDALE RECYCLING Revised Date: November 4, 2020 Page 5 of 13 GROWTH MANAGEMENT PLAN (GMP) CONSISTENCY: Comprehensive Planning staff has reviewed this request and offered the following comments: Future Land Use Element (FLUE): The subject property is currently designated Rural Fringe Mixed Use District Receiving Lands, as identified on the Future Land Use Map of the Future Land Use Element (FLUE). Receiving Lands are those lands within the Rural Fringe Mixed Use District that have been identified as being most appropriate for development and to which residential development units may be transferred from areas designated as Sending Lands. Based on the evaluation of available data, these lands have a lesser degree of environmental or listed species habitat value than areas designated as Sending and generally have been disturbed through development, or previous or existing agricultural operations. Various incentives are employed to direct development into Receiving Lands and away from Sending Lands, thereby maximizing native vegetation and habitat preservation and restoration. Such incentives include, but are not limited to: the TDR process; clustered development; density bonus incentives; and, provisions for central sewer and water. Based upon the above analysis, this proposed Conditional Use may be deemed consistent with the FLUE. (See Attachment B – FLUE Consistency Review) Transportation Element: The project is consistent with Policy 5.1 of the Transportation Element of the Growth Management Plan, which states, “The County Commission shall review all rezone petitions, SRA designation applications, conditional use petitions, and proposed amendments to the Future Land Use Element (FLUE) affecting the overall countywide density or intensity of permissible development, with consideration of their impact on the overall County transportation system, and shall not approve any petition or application that would directly access a deficient roadway segment as identified in the current AUIR or if it impacts an adjacent roadway segment that is deficient as identified in the current AUIR, or which significantly impacts a roadway segment or adjacent roadway segment that is currently operating and/or is projected to operate below an adopted Level of Service Standard within the five-year AUIR planning period unless specific mitigating stipulations are also approved. A petition or application has significant impacts if the traffic impact statement reveals that any of the following occur: a. For links (roadway segments) directly accessed by the project where project traffic is equal to or exceeds 2% of the adopted LOS standard service volume; b. For links adjacent to links directly accessed by the project where project traffic is equal to or exceeds 2% of the adopted LOS standard service volume; and c. For all other links the project traffic is considered to be significant up to the point where it is equal to or exceeds 3% of the adopted LOS standard service volume. Mitigating stipulations shall be based upon a mitigation plan prepared by the applicant and submitted as part of the traffic impact statement that addresses the project’s significant impacts on all roadways.” 9.A.3.a Packet Pg. 741 Attachment: Staff Report - Richdale Recycling (13087 : PL20190002105 Richdale Recycling (CU)) CU-PL20190002105, RICHDALE RECYCLING Revised Date: November 4, 2020 Page 6 of 13 According to the TIS provided with this petition dated October 9, 2019, the proposed Recycling Center will generate a projected total of +/- 7 PM peak hour, 2-way trips on the adjacent roadway Tamiami Trail East (US 41). According to the current 2019 AUIR, this road segment (link 95.3) Greenway Road to San Marco Drive operates at a LOS of “B” with a remaining capacity of 774 trips (peak capacity service volume is 1,075). Therefore, the subject Conditional Use can be found consistent with Policy 5.1 of the Transportation Element of the Growth Management Plan, and as noted above the Traffic Impact Statement (TIS) indicates that the adjacent roadway network has sufficient capacity to accommodate this project within the 5-year planning period. Transportation Review: Transportation Division staff has reviewed the petition request, the CU document and Master Plan for right-of-way and access issues and is recommending approval with the following Condition of Approval: Transportation Planning Condition of Approval: “The maximum total daily trip generation for the CU shall not exceed +/-7 two-way PM peak hour net trips based on the use codes in the ITE Manual on trip generation rates in effect at the time of application for SDP/SDPA or subdivision plat approval.” Stormwater Review: The proposed conditional use request is not anticipated to create drainage problems in the area. Stormwater best management practices, treatment, and storage will be addressed through the environmental resource permitting process with the South Florida Water Management District. County staff will also evaluate the project’s stormwater management system, calculations, and design criteria at the time of site development plan (SDP) and/or platting (PPL). Landscape Review: The buffers labeled on the Master Plan meet or exceed the LDC requirements. In the event that the preserve along the South does not meet the buffer requirements after the removal of exotics, supplemental planting will be provided in the 6’ wide landscape reservation area shown on the Site Plan to meet the buffer requirement Environmental Review: Environmental Planning staff has reviewed the petition to address environmental concerns. The property is located within Rural Fringe Mixed Use Overlay- Receiving Lands (RFMUO-Receiving Lands). The minimum conditional use preserve requirement is 2.55 acres (40% of 6.37 acres). The property was cleared under an after-the-fact Agricultural Clearing Permit (PL20130002368); however, due to the 25-year rezone limitation for an ACP, native vegetation will be required to be restored in accordance with LDC Section 10.02.06.C.1.a. A listed species survey and applicable wildlife management plans for species, including but not limited to Florida Black Bear (Ursus americanus floridanus) and Florida Panther (Felis concolor coryi), will be required at time of SDP and/or PPL review. Conservation & Coastal Management Element (CCME): Environmental review staff has found this project to be consistent with the Conservation and Coastal Management Element (CCME). The project site was issued an After-the-Fact Agricultural Clearing Permit (PL20130002368) for horticulture activities. A created preserve of 2.55 acres (40% of 6.37 acres 9.A.3.a Packet Pg. 742 Attachment: Staff Report - Richdale Recycling (13087 : PL20190002105 Richdale Recycling (CU)) CU-PL20190002105, RICHDALE RECYCLING Revised Date: November 4, 2020 Page 7 of 13 of native vegetation prior to clearing) shall be placed under preservation and dedicated to Collier County. Zoning Review: The subject property is located in the A/RFMUO-Receiving Lands. The RFMU Receiving Lands are those lands within the RFMU district that have been identified as being most appropriate for development and to which residential development units may be transferred from RFMU sending lands. Based on the evaluation of available data, RFMU receiving lands have a lesser degree of environmental or listed species habitat value than RFMU sending lands and generally have been disturbed through development or previous or existing agricultural operations. Various incentives are employed to direct development into RFMU receiving lands and away from RFMU sending lands, thereby maximizing native vegetation and habitat preservation and restoration. Such incentives include, but are not limited to, the Transfer o f Development Rights (TDR) process, clustered development, density bonus incentives, and provisions for central sewer and water. Currently, the site is operating as a wholesale nursery and is requesting a conditional use to operate a horticultural recycling facility as the primary use. Pursuant to LDC Section 2.03.08.A.2.a.(3)(c)iv, the proposed use, Facilities for the collection, transfer, processing, and reduction of solid waste is allowed at the subject site as a Conditional Use. A Conditional Use is defined as a use that due to special circumstances, is not permissible in a zoning district but may be appropriate if controlled as to the number, area, location, or relation to the neighborhood. The applicant also requests to have the ability to conduct wholesale-retail sales of the mulch and continuing the wholesale nursery as accessory uses. Staff determined this would not be an issue because retailing activity is considered as an accessory use. An accessory use is defined as a use located on the same lot or parcel and incidental and subordinate to the principal use. The facility will accept clean horticultural debris for processing into recycled horticulture (mulch and topsoil). These will be sold in bulk (wholesale). It is difficult to estimate a volume of these products, as it will depend on the amount of clean horticulture delivered to the site. Hours of operation (including sales) will be Monday-Friday, 7 AM – 5 PM, and Saturday 7:30 AM to Noon. The existing use of the site as a nursery may continue along with the added use of the transfer site for horticulture waste recycling. Deliveries and pick-ups will take place intermittently during hours of operation. Deliveries and pick-ups will be made by variously sized vehicles, from pick-up trucks with small trailers to 100-yard tractor-trailers. There will be no overnight storage of tractor-trailers. The operation of the site currently utilizes and will continue to utilize a front-end loader, screening plant, water truck, and backhoe. The facility will also utilize a woodchipper/mulching machine on an as-needed basis. The equipment will not be run continuously. It will only be run during hours of operation on an as-needed basis, approximately once per month for 5-7 days at a time. The parking lot and staging areas will be kept clean of debris. The facility will not accept sludge, accelerants, fertilizer, or construction debris. Horticulture piles will provide buffering between the public right-of-way and the interior operations of the site. The site has been designed to utilize setbacks and landscape buffers to provide visual screening and reduce noise emanating 9.A.3.a Packet Pg. 743 Attachment: Staff Report - Richdale Recycling (13087 : PL20190002105 Richdale Recycling (CU)) CU-PL20190002105, RICHDALE RECYCLING Revised Date: November 4, 2020 Page 8 of 13 from the site operations. Pile height will be limited to 30 feet. The applicant estimates that piles will be processed within three to four weeks. In August 2011, Dominick Cammuso purchased the subject property from Flamingo Bend Nursery, Incorporated. In the same month, Mr. Cammuso formed a profit corporation called Peewee’s Disposal Incorporated of Florida, which was later renamed Professional Disposal Incorporated. In 2012, the County issued a Land Use and Zoning Certificate (Non-residential) for Anna’s Green Acres for a wholesale nursery. Moreover, as of November 3, 2020, there are no open code cases on the property. (See Attachment C – Code Enforcement Correspondence) STAFF ANALYSIS: When considering a Conditional Use petition, the CCPC must make findings that 1) approval of the Conditional Use will not adversely affect the public interest and will not adversely affect other property of uses in the same district of a neighborhood; 2) all specific requirements for the individual Conditional Use will be met; and 3) satisfactory provisions have been made concerning the following matters, where applicable: 1. Section 2.03.08.A.2.a.3.c.iv, of the LDC, permits conditional uses in the Rural Agricultural (A) zoning district in the Rural Fringe Mixed Use Overlay-Receiving Lands (A/RFMUO-Receiving Lands). The requested use for facilities for the collection, transfer, processing, and reduction of solid waste is allowed as a conditional use in the Rural Agricultural (A) zoning district with a Rural Fringe Mixed Use Overlay-Receiving Lands (A/RFMUO-Receiving Lands) subject to the standards and procedures established in section 10.08.00, conditional uses procedures, of the LDC 2. Consistency with the Land Development Code (LDC) and the Growth Management Plan (GMP). As previously mentioned, the proposed use is allowed as a Conditional Use at the subject site pursuant to LDC Section 2.03.08.A.2.a.(3)(c)iv. Comprehensive Planning staff determined this use is allowed under the FLUE of the GMP. The Conditional Use Plan illustrates the location of the existing lake, landscape buffers, parking area, and preserves. With respect to drainage, the applicant will be required to submit a permit application to the South Florida Water Management District (SFWMD). The County will more thoroughly evaluate for stormwater management during the SDP process. Since the drawing will be required to be compliant with the LDC during the SDP review process, this petition is considered consistent with both the LDC and the GMP. 3. Ingress and egress to the property and proposed structures thereon, with particular reference to automotive and pedestrian safety and convenience, traffic flow and control, and access in case of fire or catastrophe. Ingress and egress to the subject property will be limited to a single access point on Riggs Road as shown on the master site plan. The TIS submitted by the applicant indicates that the 9.A.3.a Packet Pg. 744 Attachment: Staff Report - Richdale Recycling (13087 : PL20190002105 Richdale Recycling (CU)) CU-PL20190002105, RICHDALE RECYCLING Revised Date: November 4, 2020 Page 9 of 13 adjacent roadway network has sufficient capacity to accommodate this project within the 5- year planning period as noted above and not adversely impact the surrounding roadway network. The roadway infrastructure has adequate capacity to serve the proposed project at this time, i.e., GMP consistent at the time of rezoning as evaluated as part of the GMP Transportation Element consistency review. The project’s development must also comply with all other applicable concurrency management regulations and operational improvements when development approvals are sought at time of Site Development Plan (SDP) review. In regard to parking requirements, it is of staff’s opinion that the proposed recycling facility use would be comparable to a landfill as the horticultural recycling facility use is not listed in Section 4.05.04, Table 17, Parking Space Requirements. It is also important to note that the landfill parking ratio was utilized for another horticultural recycling facility (Yahl Mulching) located at 2250 Washburn Avenue. As such, the minimum parking requirements for a landfill are 2 spaces per employee of largest work shift (2 spaces x 6 employees = 12 required spaces). In total, the property requires 12 spaces. The conditional use site plan shows that 26 spaces will be provided; therefore, this petition shows compliance with the LDC requirements. 4. The effect the Conditional Use would have on neighboring properties in relation to noise, glare, economic, or odor effects. The abutting properties to the east and west have agricultural uses, and many of the properties within the immediate vicinity of the subject property can be characterized as either agricultural or low-intensity commercial. Staff does not have any reason to anticipate negative effects on the abutting non-residential properties. The abutting property, to the north, is zoned A/RFMUO-Receiving Lands and has been developed with a single-family home. The Conditional Use Plan proposes a Type C buffer along the north property line where abutting this property. The Conditional Use Plan also shows the location of an existing lake and proposed off-street parking area. Just west of the existing lake is an area labeled “Ag Resource Transfer Area.” Staff understands this area would serve as the place for the collection, transfer, processing, and reduction of horticultural solid waste. The landscape buffer, lake, and off-street parking area would separate the subject property from the dwelling on the abutting property to the north. Staff does not anticipate the Conditional Use would have a negative effect on the abutting A/RFMUO-Receiving Lands- zoned property to the north. The Conditional Use Plan illustrates the location of a 2.55-acre preserve along the south property line of the subject property. The Conditional Use Plan proposes a 20-foot wide Type C buffer. Preserves may be used to satisfy the landscape buffer requirements after exotic vegetation removal in accordance with LDC Sections 4.06.02 and 4.06.05.E.1. Supplemental plantings with native plant materials shall be in accordance with LDC Section 3.05.07. For areas along the southern property line that require the establishment of a Type C buffer, these areas shall reach the 80% opacity requirement as specified in the LDC within 9.A.3.a Packet Pg. 745 Attachment: Staff Report - Richdale Recycling (13087 : PL20190002105 Richdale Recycling (CU)) CU-PL20190002105, RICHDALE RECYCLING Revised Date: November 4, 2020 Page 10 of 13 six months of the approval of the SDP. The proposed Conditional Use would be effectively separated from the adjacent residences of Boyne South PUD due to the following mitigating factors: 1) the presence of the aforementioned preserve and Type C buffer along the south property line of the subject property; 2) the right-of-way of U.S. 41 East is approximately 200 feet wide, and 3) the northeast area of Boyne South PUD (along U.S. 41 East) is primarily comprised of a natural area and a golf driving range. Staff does not anticipate the Conditional Use would generate an unexpected level of noise, glare, or odor to the homes in Boyne South PUD. 5. Compatibility with adjacent properties and other property in the district. The abutting properties to the east and west have agricultural uses, and many of the properties within the immediate vicinity of the subject property can be characterized as either agricultural or low-intensity commercial. The abutting property to the north is zoned A/RFMUO-Receiving Lands, which allows for a number of agricultural activities. The subject site would be separated from the homes in the adjacent Boyne South PUD by a preserve and landscape buffer on the subject property, in combination with the approximate 200-foot wide expanse of the U.S. 41 East right-of-way, and the existing non-developed areas of Boyne South PUD. Staff does not anticipate a compatibility issue between the proposed Conditional Use and the adjacent properties. ENVIRONMENTAL ADVISORY COUNCIL (EAC) RECOMMENDATION: This project does not require Environmental Advisory Council (EAC) review, as this project did not meet the EAC scope of land development project reviews as identified in Section 2 -1193 of the Collier County Codes of Laws and Ordinances. Environmental Planning staff recommends approval of the proposed petition. JANUARY 15, 2020 NEIGHBORHOOD INFORMATION MEETING (NIM): The applicant conducted a duly noticed and advertised NIM on January 15, 2020, at the Rookery Bay National Estuarine Research Reserve Auditorium located at 300 Tower Road; however, the main gate into this facility was locked and attendees were unable to attend this meeting. As such, the meeting was canceled and rescheduled to February 10, 2020, at the same location. FEBRUARY 10, 2020 NEIGHBORHOOD INFORMATION MEETING (NIM): The applicant conducted a duly noticed and advertised NIM on February 10, 2020, at the Rookery Bay National Estuarine Research Reserve Auditorium located at 300 Tower Road. The meeting commenced at approximately 5:30 p.m. and ended at 6:45 p.m. The applicant’s agent explained the request for the conditional use. Paula McMichael, the agent, conducted the meeting with introductions of the consultant team and staff, and an overview of the proposed horticultural recycling facility. 9.A.3.a Packet Pg. 746 Attachment: Staff Report - Richdale Recycling (13087 : PL20190002105 Richdale Recycling (CU)) CU-PL20190002105, RICHDALE RECYCLING Revised Date: November 4, 2020 Page 11 of 13 The agent explained that the applicant is adding an Air Curtain Incinerator (ACI) which will burn horticultural material. The ACI will not release smoke, particulate matter, and will not release exhaust. She emphasized that this is not open burning. She then added that the applicant will also be operating a concrete crusher which will have a water hose to keep down the dust. Following the agent’s presentation, the meeting was opened to the attendees to make comments and ask the consultant team questions regarding the proposed horticultural recycling facility. Issues of concern were the ACI, the concrete crusher, traffic, debris on Riggs Road, debris catching on fire, property values going down, environmental concerns, noise, and the mulch piles. All these concerns were answered by the agent. The property owner, Dominick Cammuso, explained that the concrete crusher won’t be mixed with any other material. The machine is not big and a six-foot berm around the property will mitigate the noise. The machine will have a diesel engine and will crush slowly and will have water jets to keep down the dust. The agent explained that the facility will be open Monday through Friday from 7 am to 5 pm and Saturday from 7:30 am to noon. A copy of the sign-in sheet and NIM summary are included in the Backup Materials. (See Attachment E – Backup Materials) In the months following this NIM, the applicant has omitted all referenced of the ACI and concrete crusher from all plans and documentation. The conditional will only allow a horticultural waste facility for the collection, transfer, processing, and reduction of solid waste with the accessory use of incidental retail sale of processed horticultural material and operating the current whole nursery. COUNTY ATTORNEY OFFICE REVIEW: The County Attorney’s Office reviewed the staff report on 10-29-20. RECOMMENDATION: Staff recommends that the Collier County Planning Commission (CCPC) approve Petition CU- PL20190002105, subject to the following conditions: 1. The Richdale Recycling Conditional Use shall be limited to that which is depicted on the “Richdale Recycling Site Plan Conditional Use, dated 8/2019,” prepared by Hole Montes. 2. The following are commitments offered by the property owner for this petition: a. No inorganic solid waste shall be brought to the site, including demolition debris. b. The wind rows shall not exceed a maximum height of 30 feet. c. There shall be no operations on-site on Sundays. 3. In order to ensure the retailing component of the operation remains as an accessory use to the waste transfer station, retailing activity shall be limited primarily to the wholesale of mulch, topsoil, fill, and other products resulting from resource recovery operations. 9.A.3.a Packet Pg. 747 Attachment: Staff Report - Richdale Recycling (13087 : PL20190002105 Richdale Recycling (CU)) CU-PL20190002105, RICHDALE RECYCLING Revised Date: November 4, 2020 Page 12 of 13 4. The property owner shall provide at least one permanent bathroom facility (e.g., port -o-john) on-site. The location will be required to be shown on the first SDP or SIP, application for this site, as applicable. 5. Preserves may be used to satisfy the landscape buffer requirements after exotic vegetation removal in accordance with LDC Sections 4.06.02 and 4.06.05.E.l. Supplemental plantings with native plant materials shall be in accordance with LDC section 3.05.07. In order to meet the requirements of a Type C buffer along the southern boundary, a 6 -foot-wide landscape buffer reservation located outside of the preserve has been identified on the master plan. In the event that the preserve does not meet buffer requirements after removal of exotics and supplemental planting within the preserve, plantings will be provided in the 6’ wide reservation to meet the buffer requirements. The type, size, and number of such plantings, if necessary, will be determined at time of initial SDP or SIP, as applicable, and included on the landscape plans for the SDP if required. These plantings shall meet the opacity requirement as specified in the LDC within six months of the approval of the first SDP or SIP, as applicable. 6. The previously submitted August 7, 2015, Limited Environmental Soil Sampling Report (“Previous Analysis”) found detections of organochlorine pesticides exceeding the Soil Cleanup Target Levels (SCTL) for leachability per chapter 62-777, FAC. Prior to receiving a Certificate of Occupancy (CO), the applicant must submit an Environmental Soil and/or Groundwater Sampling Report (“Contaminant Report”) to Collier County Pollution Control meeting SCTL thresholds of 62-777, FAC. The Contaminant Report shall include laboratory analysis of organochlorine pesticides, organophosphorus pesticides, and silver, in addition to the compounds tested for in the Previous Analysis. The Contaminant Report shall utilize the HA-1, HA-3, HA- 5, and HA-6 sample locations from the Previous Analysis. The Contaminant Report shall include a sample collected from the Fuel Tank location, as described on page 3 of the Florida Department of Environmental Protection May 19, 2009, Flamingo Bend Nursery Inc Inspection Report FLR000154591, and the sample shall be analyzed for Polycyclic Aromatic Hydrocarbons (PAHs) and Total Recoverable Petroleum Hydrocarbons (TRPHs). Should the applicant, at any time, find detections in excess of the SCTL thresholds, the applicant shall remediate the site in accordance with the Contaminated Site Cleanup Criteria established in 62-780, FAC. 7. The property owner shall provide quarterly reports to Collier County Solid Hazardous Waste Management Department identifying the types, amounts of recyclable material collected, and each recycling facility to which the recyclable material was taken (Recycling Ordinance 2009- 56). Quarterly reports shall be emailed to recycling@colliercountyfl.gov. 8. All other applicable state or federal permits must be obtained before commencement of the development. 9. Pursuant to Section 125.022(5) F.S., issuance of a development permit by a county does not in any way create any rights on the part of the applicant to obtain a permit from a state or feder al agency and does not create any liability on the part of the county for issuance of the permit if the applicant fails to obtain requisite approvals or fulfill the obligations imposed by a state or federal agency or undertakes actions that result in a violation of state or federal law. 9.A.3.a Packet Pg. 748 Attachment: Staff Report - Richdale Recycling (13087 : PL20190002105 Richdale Recycling (CU)) CU-PL20190002105, RICHDALE RECYCLING Revised Date: November 4, 2020 Page 13 of 13 10. Hours of operation for the facility will be Monday to Friday from 7 am to 5 pm and Saturday 7:30 am to Noon. 11. All hazardous products as defined in LDC Section 1.08.02 and petroleum products are required to be stored in secondary containment if stored on site. If required, the containment structure shall be capable of containing 110% of the volume of the largest container located within, be composed of materials impervious to the regulated substance, and be able to withstand deterioration from external environmental conditions. For containment areas with more than one storage container, capacity calculations shall be made after deducting the volume of the storage containers, other than the largest container. All regulated substances must be removed from the containment structure within 24-hours of a spill or accidental release. Containment structures shall be sheltered so that the intrusion of precipitation is effectively prevented. 12. The applicant shall provide a pollution prevention and response plan at time of SDP or SIP submittal. 13. All onsite operations must comply with Chapter 62-709, FAC, (Criteria for Organics Processing And Recycling Facilities). 14. The maximum total daily trip generation for the CU shall not exceed +/-7 two-way PM peak hour net trips based on the use codes in the ITE Manual on trip generation rates in effect at the time of application for SDP/SDPA or subdivision plat approval. Attachments: A) Proposed Resolution B) FLUE Consistency Review C) Code Enforcement Correspondence D) Opposition Letters E) Application/Backup Materials F) Property Hearing Signs G) Hybrid Meeting Waiver 9.A.3.a Packet Pg. 749 Attachment: Staff Report - Richdale Recycling (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.b Packet Pg. 750 Attachment: Attachment A - Proposed Resolution (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.b Packet Pg. 751 Attachment: Attachment A - Proposed Resolution (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.b Packet Pg. 752 Attachment: Attachment A - Proposed Resolution (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.bPacket Pg. 753Attachment: Attachment A - Proposed Resolution (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.b Packet Pg. 754 Attachment: Attachment A - Proposed Resolution (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.b Packet Pg. 755 Attachment: Attachment A - Proposed Resolution (13087 : PL20190002105 Richdale Recycling (CU)) ‒ 1 ‒ PL20190002105, Go Pro Disposal and Recycling ::: CU Consistency Review Growth Management Department Zoning Division C O N S I S T E N C Y R E V I E W M E M O R A N D U M To: Timothy Finn, AICP, Principal Planner, Zoning Services Section From: Corby Schmidt, AICP, Principal Planner, Comprehensive Planning Section Date: February 4, 2020 Subject: Future Land Use Element (FLUE) Consistency Review of Proposed Conditional Use PETITION NUMBER: PL20190002105 [REV: 2] PETITION NAME: Richdale Recycling (fka Go Pro Recycling) ) Conditional Use (CU) REQUEST: To obtain a Conditional Use (CU) in Rural Fringe Mixed Use Overlay Receiving Lands to allow for expansion of an existing operation for horticultural waste resource recovery on the site. Such expansion includes operations and activities that are presently absent, and will be entirely new to the site. These include accepting and recycling (crushing) concrete products, installing and operating an air curtain incinerator (ACI) for burning horticultural waste; permitting (short term parking of) tractor trailers; permitting retail sales activities accessory to primary operations; and so forth. LOCATION: The subject site, consisting of ±16.43 acres, is located on the north side of Tamiami Trail East, on the east side of Riggs Road, approximately one-quarter mile (directly), and approximately one- third mile (by roadway), west of Six L’s Farm Road, and across US 41 to the north from Royal Hammock Boulevard, in Section 20, Township 51 South, Range 27 East, Collier County, Florida. COMPREHENSIVE PLANNING COMMENTS: The subject property is currently designated Rural Fringe Mixed Use District Receiving Lands, as identified on the Future Land Use Map of the Future Land Use Element (FLUE). Receiving Lands are those lands within the Rural Fringe Mixed Use District that have been identified as being most appropriate for development and to which residential development units may be transferred from areas designated as Sending Lands. Based on the evaluation of available data, these lands have a lesser degree of environmental or listed species habitat value than areas designated as Sending and generally have been disturbed through development, or previous or existing agricultural operations. Various incentives are employed to direct development into Receiving Lands and away from Sending Lands, thereby maximizing native vegetation and habitat preservation and restoration. Such incentives include, but are not limited to: the TDR process; clustered development; density bonus incentives; and, provisions for central sewer and water. 9.A.3.c Packet Pg. 756 Attachment: Attachment B - FLUE Consistency Review (13087 : PL20190002105 Richdale Recycling (CU)) ‒ 2 ‒ PL20190002105, Go Pro Disposal and Recycling ::: CU Consistency Review The RFMUD Receiving Lands designation includes specific provisions regarding Maximum Density, Clustering, Minimum Project Size, Emergency Preparedness, Allowable Uses, Density Blending, Open Space and Native Vegetation Preservation Requirements, and so forth. Maximum Density: N/A. Clustering: N/A. Minimum Project Size: N/A. Emergency Preparedness: a) In order to reduce the likelihood of threat to life and property from a tropical storm or hurricane event, community facilities, schools, or other public buildings shall be designed to serve as storm shelters if located outside of areas that are likely to be inundated during storm events, as indicated on the Sea, Lake, and Overland Surge from Hurricane Map for Collier County. Impacts on evacuation routes, if any, must be considered as well. Applicants for new residential or mixed use developments proposed for Receiving Lands shall work with the Collier County Emergency Management staff to develop an Emergency Preparedness Plan to include provisions for storm shelter space, a plan for emergency evacuation, and other provisions that may be deemed appropriate and necessary to mitigate against a potential disaster. N/A. b) Applicants for new developments proposed for Receiving Lands shall work with the Florida Forest Service and the Managers of any adjacent or nearby public lands, to develop a Wildfire Prevention and Mitigation Plan that will reduce the likelihood of threat to life and property from wildfires. This plan will address, at a minimum: project structural design; the use of materials and location of structures so as to reduce wildfire threat; firebreaks and buffers; water features; and, the impacts of prescribed burning on adjacent or nearby lands. As this is an on-site expansion of an existing use, minimal structures are expected, and the site has been previously cleared, staff is of the opinion that a Wildfire Prevention and Mitigation Plan is not warranted. Allowable Uses: Uses within Receiving Lands are limited to the following: a) – o) N/A. p) Facilities for the collection, transfer, processing and reduction of solid waste. q) – w) N/A. Density Blending shall be permitted subject to the provisions set forth in the Density Rating System. N/A. Open Space and Native Vegetation Preservation Requirements: a) Usable Open Space: Within Receiving Lands projects greater than 40 acres in size… N/A. 9.A.3.c Packet Pg. 757 Attachment: Attachment B - FLUE Consistency Review (13087 : PL20190002105 Richdale Recycling (CU)) ‒ 3 ‒ PL20190002105, Go Pro Disposal and Recycling ::: CU Consistency Review b) Native Vegetation Preservation: Native vegetation shall be preserved as set forth in CCME Policy 6.1.2. Comprehensive Planning staff defers to Environmental Services staff for project consistency with CCME Policies. Second submittal revisions did not affect consistency with the Future Land Use Element. Future Land Use Element Policy 5.6 requires new developments to be compatible with the surrounding land area. Comprehensive Planning leaves this determination to the Zoning Services staff as part of their review of the petition in its entirety. The County recognizes Smart Growth policies and practices in its consideration of future land use arrangements and choice-making options. FLUE Objective 7 and Policies 7.1 through 7.4 promote Smart Growth policies for new development and redevelopment projects pertaining to access, interconnections, open space, and walkable communities. Each policy is followed by preliminary and partial review staff observations and comments [in bold italicized text]. Objective 7: Promote smart growth policies, reduce greenhouse gas emissions, and adhere to the existing development character of Collier County, where applicable, and as follows: Policy 7.1: The County shall encourage developers and property owners to connect their properties to fronting collector and arterial roads, except where no such connection can be made without violating intersection spacing requirements of the Land Development Code. [The Conditional Use Site Plan depicts a subject property that fronts Tamiami Trail East (US 41, classified as a major arterial road). The subject property also fronts along Riggs Road, which is an unclassified two-lane undivided roadway. The Site Plan depicts indirect connection to Tamiami Trail via Riggs Road as its point of entry.] Policy 7.2: The County shall encourage internal accesses or loop roads in an effort to help reduce vehicle congestion on nearby collector and arterial roads and minimize the need for traffic signals. [This resource recovery station is an expansion project, introducing new activities and operations onto the site, within which operations are internalized.] Policy 7.3: All new and existing developments shall be encouraged to connect their local streets and/or interconnection points with adjoining neighborhoods or other developments regardless of land use type. The interconnection of local streets between developments is also addressed in Policy 9.3 of the Transportation Element. [The site fronts Riggs Road (along its western boundary) and provides access to it. Riggs Road continues further north and provides access to adjoining properties. The site abuts US 41 to the south. The Site Plan depicts no interconnection with adjoining neighborhoods or other developments to the east and north. The new activities and operations on the site are internalized, staff is of the opinion that interconnection with dissimilar land uses to the east and north is unwarranted.] 9.A.3.c Packet Pg. 758 Attachment: Attachment B - FLUE Consistency Review (13087 : PL20190002105 Richdale Recycling (CU)) ‒ 4 ‒ PL20190002105, Go Pro Disposal and Recycling ::: CU Consistency Review Policy 7.4: The County shall encourage new developments to provide walkable communities with a blend of densities, common open spaces, civic facilities and a range of housing prices and types. [The proposed project is not a community, and an evaluation of this Policy is unnecessary.] CONCLUSION: Based upon the above analysis, this proposed Conditional Use may be deemed consistent with the FLUE. PETITION ON CITYVIEW cc: Ray Bellows, Zoning Manager, Zoning Services Section David Weeks, AICP, Growth Management Manager, Comprehensive Planning Section G: Comp\Consistency Reviews\2019 \\bcc.colliergov.net\data\GMD-LDS\CDES Planning Services\Consistency Reviews\2020\CU\CU-PL2019-2105 Richdale Recycling_R2 FNL.docx 9.A.3.c Packet Pg. 759 Attachment: Attachment B - FLUE Consistency Review (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: MuchaJoseph Tuesday, November 3,2020 9:3'l AM FinnTimothy RE:ANOTHER UPDATE REQUEST - Richdale Recycling - Conditional Use P120190002105 Nothing open as of today From : Fin nTimothy <Timothy. Fin n @ co I lie rco u ntyfl.gov> Sent: Tuesday, November 3,2020 9:28 AM To: M uchaJose ph <Jose ph. M ucha @col I ie rco u ntyfl.gov> Subject: ANOTHER UPDATE REQUEST- Richdale Recycling - Conditional Use P120190002105 Hi Joseph, Are there still no open code cases on the property? From: M uchaJoseph <Joseph. M ucha @colliercountyfl.gov> Sent: Thursday, October 1,,2020 3:15 PM To: FinnTimothy <Timothv.Finn @col liercountvfl.gov> Subject: RE: UPDATE - RE: Richdale Recycling - Conditional Use P120190002105 Good Afternoon Tim, There still is no open code cases on this property as of October 1't From: FinnTimothy <Timothy. Finn @colliercountyfl.gov> Sent: Wednesday, September 30,2O2O 4:02 PM To: M uchaJose ph <Jose ph. M ucha @co I I ie rco u ntyfl.gov> Subject: UPDATE - RE: Richdale Recycling - Conditional Use p120190002105 Hi Joseph, Please see correspondence below from April 15. Are there still no open code cases on the property? From: M uchaloseph <Joseph. M ucha @col liercountvfl.sov> Sent: Wednesday, April 15, 2020 L0:52 AM To: Fin nTimothy <Timothv. Finn@colliercountvfl.gov> Cc: LetourneauJeffrey <Jeffrev.Letourneau@colliercountvfl.gov>; Eric Short <Eric.Short@colliercountvfl.sov> Subject: RE: Richdale Recycling - Conditional Use P120190002105 Tim, There are no open code cases on the property. Our code case back from 2016 (CE1U20160016958) was closed due to voluntary compliance. They essentially ceased bringing the unauthorized material to the property and removed the existing unauthorized materialthey had from the site. I have attached a copy of the code case foryour review. lfound one BTR (below) for a nursery. To be honest, I haven't heard anything about this property for about 3 years. 1 9.A.3.d Packet Pg. 760 Attachment: Attachment C - Code Enforcement Correspondence - Nov 3, 2020 (13087 : PL20190002105 Richdale Recycling (CU)) 2O2O Details - Business Tax Account PROFESSIONAL DISPOSAL lN Business Tax Account #111635 2420 Paid 201 I Paid 201 I Paid 2017 Paid Mailing addres: Owner(s) Account number: Business start date: Physical business !ocation: Business address: Receipts And Occupations 1 1 1635 01t18t2012 Collier County PROFESSIONAL DISPOSAL INC 11820 RIGGS RD Receipt 111635 PUBLIC SERVICES PI.ANT NURSERY SERVICE 593-2773 1 0r0 1 i20 1 9-0 I I 30 t2020 From: Eric Short Sent: Wednesday, April 1-5, 2020 70:22 AM To: MuchaJoseph Cc: FinnTimothy ; LetourneauJeffrey Subject: FW: Richdale Recycling - Conditional Use P120tr90002105 Joe, Please review and assist Mr. Finn Thanks, W. Eric Short District I nvestigations Supervisor Collier County Government Code Enforcement Division 2800 N. Horseshoe Dr. 2 9.A.3.d Packet Pg. 761 Attachment: Attachment C - Code Enforcement Correspondence - Nov 3, 2020 (13087 : PL20190002105 Richdale Recycling (CU)) Naples, FL34104 {239)2s2-s732 E ric.Sho rt @coll ierco u ntvfl.gov Mission Statement: "To protect the health, sofety, and welfore of Collier County residents ond visitors through educotion, coope roti on, a nd com p I i o nce." "HOW ARE WE DOING?" Pleose CLICK HERE to fill out a CUSTOMER SURVEY. we appreciate gour ftedback! From: FinnTimothy <Timothy. Finn@colliercountvfl.gov> Sent: Wednesday, April 15, 2020 10:16 AM To: E ric Sho rt < E ric.Sho rt @col I ie rco u ntvfl.eov> Subject: Richdale Recycling - Conditional Use P120190002105 Hi Eric, Can you provide any assistance on whether there are current code enforcement cases held on the property for the above referenced project and attached staff report. Please review prior staff report from 2077 . Please note that this conditional use petition was withdrawn right before the CCPC hearing and never officially received approval. As of now, the owner is back requesting another conditional use for similar uses (Richdale Recycling - Conditional Use - P120190002105) There were code enforcement cases that are referenced on pages 8 and 9. Were these cases ever complied with or are they outstanding? Are there newer code enforcement cases? Additionally, what does their current occupational license or business tax receipt permit them to do? Any help you can provide would be greatly appreciated. Thank you Eric. Hope you are doing well! Timothy Finn, AICP Principol Plonner Corurrrty Zoning Division NOIE: New Emoi/Address os of l2/09/2017: Timothy. Fin n@colliercou ntyf l. gov 2800 North Horseshoe Drive, Noples Florido 34104 Phone: 239.252.4312 Tell us how we ore doing by taking our Zoning Division Survey at htto,llbit.ly/CollierZonina. Under Florida Law, e-mail addresses are public records. lf you do not want your e-mail address released in response to a public records request, do not send electronic mail to this entity. lnstead, contact this office by telephone or in writing 3 9.A.3.d Packet Pg. 762 Attachment: Attachment C - Code Enforcement Correspondence - Nov 3, 2020 (13087 : PL20190002105 Richdale Recycling (CU)) FinnTim From: Sent: To: Subject: MuchaJoseph Thursday, October 1,2020 3:15 pM FinnTimothy RE: UPDATE - RE: Richdale Rerycting - Conditional Use pL2Oj9OO02105 Good Afternoon Tim, There still is no open code cases on this property as of October 1'r. From: FinnTimothy <Timothy.Finn@colliercountyfl.gov> Sent: Wednesday, September 30, 2020 4:02 pM To: MuchaJoseph <Joseph.Mucha@colliercounMl.gov> Subject: UPDATE - RE: Richdale Recycling - Conditional Use pt2O19O0OZ1O5 HiJoseph, Please see correspondence below from April 15. Are there still no open code cases on the property? Tim, There are no open code cases on the property. our code case back from 2016 (cELU2o16oo16g5g) was closed due to voluntary compliance. They essentially ceased bringing the unauthorized material to the property and removed the existing unauthorized material they had from the site. I have attached a copy of the code case for your review. I found one BTR (below) for a nursery. To be honest, I haven't heard anything about this property for about 3 years. I From: MuchaJoseph 4oseoh. Mucha@collffi > Sent: Wednesday, April 15, 2020 10:52 AM To: FinnTimothy <Timothv.Finn@colliercountwl.sov> Cc: LetourneauJeffrey @>; Eric Short <Eric.Short(ocolliercountyfl.sov> Subrect: RE: Richdale Recycling - Conditional Use pL2O19O0O21O5 9.A.3.d Packet Pg. 763 Attachment: Attachment C - Code Enforcement Correspondence - Nov 3, 2020 (13087 : PL20190002105 Richdale Recycling (CU)) 2020 Details - Business Tax Account PROFESSTONAL DtSPOSAL tN 2020 Account numb€r: Business start date: Physical business location: Busines5 address: 20't9 Pard PROFESSIONAL OISPOSAL INC 11820 RIGGS RD 2018 Pard 2017 Pard Mailang addr.s! Ownc(s) Receipts And Occupations Rlclapt 111635 PUBLIC SERVICES PLANT NURSERY SERVICE 5992773 1Ot01t2O1949t3Ot2020 From: Eric Short Sent: Wednesday, April 15, 2020 10:22 AM To: Muchaloseph Cc: FinnTimothy ; LetourneauJeffrey Subrect: FW: Richdale Recycling - Conditional Use P120190002105 Joe, Please review and assist Mr. Finn. Thanks, W. Erlc Short District lnvestigations Supervisor Collier County Government Code Enforcement Division 2800 N. Horseshoe Dr. Busrness Tax Account #1 1 1635 Pad 111635 01n8r2012 Cdlbr County 2 9.A.3.d Packet Pg. 764 Attachment: Attachment C - Code Enforcement Correspondence - Nov 3, 2020 (13087 : PL20190002105 Richdale Recycling (CU)) Mission Statementi "To protect the heolth, sofety, ond welfore of Collier County residents ond visito3 through educotion, cooperotion, dnd com plidnce. " "HOW ARE WE DOtNc?" pledse cllcK HERE to fl out d CttSToMER su?v'v. w, aPPrtaiaa aour fadback! From: FinnTimothy <Timothv.Finn@colliercountvfl.qqv> Sent: Wednesday, April 15, 2020 10:15 AM To: Eric Short <Eric.Short@colliercou Subject: Richdale Recycling - Conditional Use p[2019OOO2los Hi Eric, Can you provide any assistance on whether there are current code enforcement cases held on the property for the above referenced projest and attached staff report. Please review prior staff report from 2017. please note that this conditional use petition was withdrawn right before the CCPC hearing and never officially received approval. fu of now, the owner is back requesting another conditional use for slmilar uses (Richdale Recycling - Conditional Use - P120r90002105) There were code enforcement cases that are referenced on paSes 8 and 9. Were these cases ever complied with or are they outstanding? Are there newer code enforcement cases? Additionally, what does their current occupational license or business tax receipt permit them to do? Any help you can provide would be greatly appreciated. Thank you Eric. Hope you are doing well! Timothy Finn, AICP Principol Plonner Counqt Zoning Division NOIE: New Emoil Address os of l2l@120t7 Iimolhv.Finn@c lliercountvfl.oov 2800 Norlh Horseshoe Drive. Noples Florido 34104 Phone: 239.252.4312 fell us how we ote doing by toking ou Zoning Division SuNey ot hllp:l lbit.ly liollie,zonint. Under Florida Law. e-mail addresses are public records. lf you do not want your e-mail address released in response to a public records request, do not send electronic mail lo this enlity. lnstead, contacl this office by telephone or in writing. 3 Naples, Fl- 34104 {23912s2-5732 Eric. Short@ co lliercountvfl.sov 9.A.3.d Packet Pg. 765 Attachment: Attachment C - Code Enforcement Correspondence - Nov 3, 2020 (13087 : PL20190002105 Richdale Recycling (CU)) tu Report Title: Code Case Details Date: 41151202010232:47 AM CaseNumber; CELU20160016958 Case Number:cELU20160016958 Land Use Priority Normal lnspector:BenjamlnPlourd J urrsd rctron:Collier County Code Enforcement Origin:Complaint Detail Description Complainant states property belng uti compostlng only, not processing and constructlon ralated debris etc. lized as a transfer station. He states the allowable use is hauling on and off site, concrete, clearing materials and Location Comments:11820 Rlggs Rd. Status:Closed Entered By:christopharambach Case Disposition Voluntary Compliance Address 11820 Riggs RD, Naples Property 770080800 Property Own DOMIN!CK Business Management & Budget Office 1 Date & Time Entered.l,lonuzorc 12:03:52 pMCase Type:l 9.A.3.d Packet Pg. 766 Attachment: Attachment C - Code Enforcement Correspondence - Nov 3, 2020 (13087 : PL20190002105 Richdale Recycling (CU)) Code Case Details Execution Dale 4l15l2O2O 10:32:47 AM D€sc Ar3ignod Requirad Oulcomo Commonta Verify Complainant christopheram bach 10114n016 1011412016 Complele lnitial lnspection ctlristopheram bach 10t14t2016 10t14t2016 lncomplete Complainant states property being utjlized as a transfer station. He states the allowable us€ is composting only, not procossing and hauling on and off site concrete, land clearing materials elc. I adMsed lnv Davidson will contact him for sp€cifics next week and tollow up accodingly. CA59 CE Staff Review christophsram bach 10114t2016 10t14t2016 Complete Compf ainant Tony Mi glial€,-239-253- 1 282 -confirmed by myself. Plsase contact him for sp€cifcs. CA59 CE Staff Review ColleenDavids on '10t14t2016 10t19t2016 Complete Please contact complainant for specifics. Code has Cas6 history going back 10 yrs on this parcel for the same alleg€d violation. Pleass r€search all past code case history. CA59 Complainant advised you will contacl him next we€k. lnitial lnspection Follow-up ColleenDavids on 10t19t2016 10t20t2016 lncomplete '10/19/16 I conducled a sit8 visit and took photos. I observed heavy macfiinery on the property wilh piles of dirt, concrete, yard debris & dumpster. Thers will ne€d to be extensive ressarch done on the pmpsrty as there is a pending/ open application for a Conditional Use. CD14 lnltal lnspection Follow-up on 10124t2016 10t27 /2016 lncomplete 10/27116 Conducted a sile visit and observed at 1r55pm a landscapo truc* with yard debris and at 2:03 pm the same landscap€ fuck lefr empty. There is no issue with yard debris. I did observe a red disposal/ dumpstsr truck pull out ofthe property at 2:01 pm empty. I was unabl€ lo detemine what was in the dumpster. I have attachod a piciure of the landscape truck. lnitial lnspeclion Follow-up ColleenOavids on 10t28t2016 10127t2016 lncomplete 10/27116 The.e is a Conditional Use Ior this property (P1201 30000320) cunently under review. CD14 lnfial lnspection Follow-up ColleenDavids on 1112t2016 111312016 lncomplets 1 1/y16 I corductod a site visit, pa*ed away fom the property on Tamiami T.ail, and did not observe any Uucks goiog to or from this property. I anived at 2:45 and left at approximately 3:45. CD14 BanjaminPlour d 11t16t2016 11tl8t2016 lncomplete Monitored site from down the road. Did not obsarve any bucks coming or going from the property. Obsarvalim time trcm 1:30pm- 2:30pm PlourdBenjsmin 111'1812016 4:22 PM lnitial lnspection Follow-up CollBsnDavids on 11t22t2016 11t2212016 lncomplete 1 1/22116 I conducled a site visit to monitor and did not observe any vehicles @ming or going from this prop€rty. CD14 lnatial lnspection Follow-up ColleenDavids on 11129t2016 1',t t2912016 lncomplete 1129/16 Conditional Uss (P120130000320) is cunently in the hearing process. I will continue to monitor and if a Conditional Use is approved, this cas€ will be clossd. CO14 Business Management & Budget Office 2 Complstod ColleenDavids lnitial lnspeclion Follow-up 9.A.3.d Packet Pg. 767 Attachment: Attachment C - Code Enforcement Correspondence - Nov 3, 2020 (13087 : PL20190002105 Richdale Recycling (CU)) Dogc Aarlgned Rlquirod Comploted Outcoms lnitial lnspection Follow-up ColleenDavids on 12t15t2016 12t15t2016 lncomplete 1Z't 5/16 Conditional Uso (P1201 30000320) remains in the hearing process. I will coniinue lo monitor. CD14 lnitial lnspection Follow-up ColleenDavids on 12t30t2016 12J3012016 lncomplete 1230/16 Conditional Us€ remains in Hearing Procoss. Wll continue to monitor. CD'14 lnitial lnspeclion Follo\r-up BenjaminPlour d 2nt2017 2ft 12017 TOT arsa investigalor BP- there Condilional Use Application is under hear process. Continue to monitor to see if Condational Use is approved. CD14 Conditional use is in "Verify hearing schedule" Status, will continue to monitor. PlourdBenjamin 02y0712017 9:39 AM lnitial lnspection Follow-lp BenjaminPlour d 3n t20 t7 3n 2017 lncomplete Called and spoke with complainanl who slated that there was a company on sits crushing concrste. I informed him that I was now the invostigator working ths c€se and would do a site visit to se€ what I could observe. Plourd Benja min O3lO7l2O17 9:27 AM BenjsminPlour d 3120t2017 3t2012017 lncomplete On site, observed a ciain link fence wilh an opon gat€. Th6re is a no tr€spass sign posted on the fence. From Riggs road I observed several trucks and large piles of dirt and grass. I did not obssrva any @ncrete or building material. Photos tak€n. The conditional use hearing is still pending. PlourdBenjamin 03/20/20'17 3:30 PM lnilial lnspection Follow-up BenjaminPlour d vn12017 3130t2017 On site, stopped at the gals dus to No Trespass signs posted at th6 sntlanca. I could see large piles o, what appeared to be landscaping dsbris and di.t. I was abl€ to get a workers atl€ntion who sent over another employee. I spoke with supervisor Miko (239) 82t5561 who staled that he is not procassing any consete on site and lhat the concroto piles that are on site are going to be used for on site improvements (.oads and a banier for a prosorv€ area). He also stated that the only grgen \ asto being processed is his own. I requested to bs shown around the property and He stated that he did not feel comfortable allowing ac€ess without th6 ownors pormission. He said he would give my contact information to the own€r and have him give me a call. PlourdBenjamin 03/30/2017 8:44 AM Business Management & Budget Office Code Case Details Execution Date 411512020 10:32:47 AM Commgnts lncomplate lnitial lnspection Follow-up lncomplste 9.A.3.d Packet Pg. 768 Attachment: Attachment C - Code Enforcement Correspondence - Nov 3, 2020 (13087 : PL20190002105 Richdale Recycling (CU)) Code Case Details Execution Oate 411512020 10:32:47 AM Oesc Aarlgnod Requlred Completcd Outcomo Commonta lnitial lnspection Follow-up BenjaminPlour d 4n/2017 4nt2017 lncomplete On sits with Sr. investiqator Johnathan Musse. We met rryith owner Ma( Cummuso who signed entry consent and showsd us around ths property. I observed large piles of organic waste including but not limited to trees, dirl and palm fronds. I also obs€rved largs piles of concrste. Some otthe concrBte contained re-bar all of this conqete appeared to be separated from the othe, piles of consete without re-bar. Mr. Cummuso staled that mncrete is brought to the property from ofi site by their company. They intend on using the concrete for onsite development, specifically roads and a bem around the property. They are waiting on a conditional usa hearing to detormin€ if they c€n change their allowable us6. Mr. Cummuso staled that the organic material b€ing procsss€d is sold. I also obseryed several dumpster on site, containing concrets and one of ths dumpste/s contained tir6s. Mr. Cummuso stated that these dumpsle/s arc us6d for slorage. Photos taken. PlourdBsnjamin 0410712017 4107 PM BsnjaminPlour d 4t7 t2017 Complete Meeting on sile '10 AM lnitial lnspeclion Follow-up BenjaminPlour d 4t25t2017 4t25t2017 lncomplete Determination packet for zoning to be prepared. PlourdBenjamin Ml25l2O17 10:13 86njaminPlout d 5t1t2017 5t1t2017 lncompl€le D€temination pscket senl to zoning on 4/25/2017. Waiting on findings. PlourdBenjamin 05/01nfil 12:47 PM Atiach Picture(s)BenjaminPlour d 5t15t2017 5t15t2017 Complete CE Staff Review BenjaminPlour d 5t15t2017 5115t2017 Complele ol ners phone numb€r Matt Cammuso (239)- 34G.5900 lnitial lnsp€ction Follow-up BenjaminPlour d 5t15t2017 5t15t2017 Violation(s) Found Rec€ived determination bacl hom zoning. Violations found. Atlached the dEtsrmination to documents and images. PlourdBenjamin 05/15/2017 8:36 AM BeniaminPlour d 5t17t2017 5117 t2017 Complete Generate Notice of Violation BenjaminPlour d 5t17t2017 5t14t2017 Complete 5t18t2017 5t18t2017 lncomplete Owner does not live at property with violation Wll post and mail NOV. PlourdBenjamin OSl18l2O17 A.25 AM BenjaminPlour d Complete Please mail to own€r certified and regular Thanks. MagdaGonzal oz 5t't8t2017 5119t2017CE Mailing 5t18t2017 st22t2017 CompleteB€njsminPlour d Post Courthouse 51222017 CompleteB€njaminPlour d 5t1812017Post Property Complete Mailed NOV cerureg Scannod and attached NOV AOM -mg 5t1912017 5t19t2017MagdaGonzal ez CE Staff Review ry Business Management & Budget Offlce 4 CE Meeting lnitial lnspection Follow-up Rocord Violations Personal Servics Attempt 9.A.3.d Packet Pg. 769 Attachment: Attachment C - Code Enforcement Correspondence - Nov 3, 2020 (13087 : PL20190002105 Richdale Recycling (CU)) Code Case Details Execution Date 411512020 10:32:47 AM Dosc As!lgnGd Roqulrsd Complotad Outcomo Commonts 5t222017 51222017 Completo Plgase scan entry consent into case. Thanks CE Staff Review MagdaGonzal ez 5t22t2017 5t2212017 Compl€te Scanned and attached entry consant form - mg BenjaminPlour d 5t23t2017 5t24t2017 Complete CE Staff Review MagdaGonzal ez 5t24t2017 5124t2017 Complete Please scan AOP into case thanks CE Stafl Revie\,v MagdaGonzal ez 5124t2017 5t24t2017 Complele Scanned and attached AOP-mg Re.lnspection BenjaminPlour d 6t21t2017 6t22t2017 Non- Compliant I have not had any contact with the property owners sinca issuing NOV. I c€lled and tefr a \roice mail for Man asking for a status on the rsmoval ol ths @ocret€ and requested a r6tum call. PlourdBenjanin 06,n212017 9:Og AM CE Phone Call BenjaminPlour d 612712017 6127 t2017 Complete Received a voics mail from Miko Murphy 825- 5561 who stated that ho would b€ back in lown on ThuMay and would be aue to meet on sita afrer that. I refumsd his call and ws were able to set up a tim6 to msot at ths proporty. Friday the 30lh at 10 AM. PlourdBeniamin 06/2712017 2:37 PM Relnspection BeniaminPlour d 6t30t2017 6t30t2017 Meeting on silo vyith Mike who is tho site supervisor. He showed SupeMsor Mucha and mysell around to where the @ncrats was b€ing stored. I observed that thor€ is still two pilos of gravel on site and that all of the large pieces of concrete and re ba. have besn removed. There are largs piles of dirt that mike stated are being ussd tor fill. Hs also stated that the remaining gravel is going to be used in relation lo the site improvemont plan for roads and olher on site pro.iects. He stated that thsir conditional uss hearing is going to be held in September of this year and once that usa is approv€d they will be moving forward with the sito improvement plan. I advised Mike that no new deliveries of conset€ or building matsrial is pormined. Photos taken. PlourdBenjamin 06/30/2017 4:18 PM CE Statr Review MagdaGonzal ez 7t6t2017 7 t612017 Complete Sc€nned and attached letter returned -mg Re-lnspection BeniaminPlour d 7t1912017 7119t2017 Non- Compliant No new activity observ€d going lo or from property. Wll continue to monitor, PlourdBenjamin 07/19/2017 9:07 AM Re-lnspection BenjaminPlour d 8n 2017 Bfi12017 Non- Compliant Have not observed any prohibited deliveries or pick ups to or from the property. Monitored from 41 for 30min. PlourdBanjamin OglO7l2O17 4:16 PM Not Applicable BeniaminPlour d 10t3t2017 10t3t2017 Not Required Enter Case Disposition BenjaminPlour d 10t3t2017 10t3t2017 Complete Verify Conditions & Close Case JosephMucha 10t3t201?1014t2017 Complete Business Management & Budget Office 5 CE Staff Review MagdaGonzal Affi davit of Servic€/Posting lNon- Compliant 9.A.3.d Packet Pg. 770 Attachment: Attachment C - Code Enforcement Correspondence - Nov 3, 2020 (13087 : PL20190002105 Richdale Recycling (CU)) Code Case Details Execution Dale 411512020 10:32'.47 AM Dogc Aaalgnod Compl€ted Outcomo Comments Re-lnspection BenjaminPlour d 10t3t2017 1013t2017 Compliant Met on site with the site supervisor and one of the owners. I observed that all concrete previously observed on the property has been removed. Photos taken. Violation abated, close cas6. PlourdB€njamin 1010312017 2154 PM Vlolatlon llescriptlon Status Entered Corrocted Amount Cammgnta Prohibited Use Conected 5t15t2017 10t312017 $0 large piles of conqele beino stored on site. Land Use - Generally Corrected 5t15t2017 10t3t2017 s0 Title Reason Result Complianc€Flns/Day Condltlon Business lvlanagement & Budget Office 6 Required 9.A.3.d Packet Pg. 771 Attachment: Attachment C - Code Enforcement Correspondence - Nov 3, 2020 (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: Ronald Wahl < rkwahl93@msn.com > Friday, February 14, 2020 12:02 PM FinnTimothy Richdale Recycling Proposal EXTERNAL EMAIL: This email is from an external source. confirm this is e trusted sender and use extreme caution when opening attachments or clicking links. We are strongly opposed to Richdale Recycling building at the Riggs Road location. We oppose the concrete crushing operation and the noise it will bring. The second reason for opposition also relates to noise. The trucks hauling material to and from the facility will greatly reduce our property value. We live in Reflection Lakes and directly across 41 is a wall erected by the state. Our community has no such sound barrier. The noise of the trucks bounces off the wall and is amplified which makes my lanai facing 41 virtually unusable. More truck travel will be intolerable. Dump trucks and , of course, larger trucks are the biggest abusers. The facility will be using these trucks. The many hours of operation at the proposed facility means six days a week that will negatively impact our home. We oppose the building of Richdale Recycling! Ron and Sheila Wahl 14704 Cranberry CT. Naples, FL rkwa hl98@ msn.com 1 9.A.3.e Packet Pg. 772 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: Harry < cedarbush@megawire-ca > Saturday, March 14, 2020 11'22 AM FinnTimothy GoPro Rerycling facility EXTE R N AL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or cllcking links. My name is Harry Follings and I am emailing you to let you know that my wife and I strongly object to the rezoning of the land located on the corner of Riggs Road and US 41. I find it hard to believe it would even be considered especially with the past problems. lt just is the wrong place for such an operation. Harry & Bonnie Follings 18127 Royal Hammock Blvd. Naples Florida 1 9.A.3.e Packet Pg. 773 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTim From: Sent: To: Subject: Pat Pikesh < ppikesh@yahoo.com > Monday, March 23, 2020 6:45 PM FinnTimothy Dump/Richdale Recycling EXTERNAL EMAIL: This email is from an external source. confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Mr. Finn, It has been brought to our attention as residents of Riggs road that a dump is being proposed for the corner of Riggs and 41. I am imploring to you to consider the negative affects this will have on our neighborhood. At present we have a large amount of traffic that uses our dead in road as a turn around point. The fact that dump trucks will be using this as such is very detrimental to our neighborhood. Please feel free to call me if I can be of further assistance and would like to have notification of any scheduled meetings that I might attend to promote the benefits of our neighborhood. Thank you, Kevin and Patricia Pikesh 11053 Riggs Road Sent from Yahoo Mail for iPad 1 9.A.3.e Packet Pg. 774 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) Finn From: Sent: To: Cc: Subject: Jeffrey Burns <zzzburns@gmail.com> Thursday, March 26, 2020 8:58 AM FinnTimothy FialaDonna Riggs Rd recycling mulch and concrete facility. EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. We object to having this type of facility in a residential zone. lt will generate noise, dust and additional traffic in an area that is growing with more housing developments and residential services Iike Publix, barber shops,etc. lt does not need industrial businesses that nobody would want to live next to. Jeffrey & Nancy Burns 14710 Sonoma Blvd 34LL4 Sent from my iPad 1 9.A.3.e Packet Pg. 775 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTim From: Sent: To: Cc: Subject: aulita845@qmail.com Saturday, October 24, 2020 4:41 PM FinnTimothy FialaDonna; SolisAndy; SaundersBurt; TaylorPenny; McDanielBill Recycling plant EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. I write this letter to you tp voice my opposition to what I feel would be travesty to East Naples and Marco lsland on numerous fronts. A privately owned material recycling plant has been proposed for US 41, adjoining Collier Seminole State Park as RigBs Road. The facility, proposed by Richdale Recycling, would process crushed concrete and agriculture products for much of Collier County. Needless to say, the impacts of this project will be felt well beyond the other end of San Marco Road... lmagine an Air Curtain lnclnerator burning agricultural waste just down from the Goodland Bridge. Think about the impacts to our waterways from Mountains of decomposing plant material carried to our canals from the annualsheet flow that covers Picayune Strand and Collier Seminole? We wonder where the source of Nitrogen and Phosphorous that is destroying our waters? Look no further. Think about industrial concrete crushing just down the road, then imagine if the asbestos lined water pipes of years past end up there. This is such a bad idea on so many fronts, I felt I needed to let you know how I feel. The project will go before you on November sth Please consider this project and vote no to further consideration Debora & Chester Vanderbeek 1 9.A.3.e Packet Pg. 776 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTim From: Sent: To: Cc: Subject: Susan Knox < snk83@comcast.net> saturday, october 24, 2020 5i22 PM FinnTimothy FialaDonna; SolisAndy; SaundersBurt; TaylorPenny; McDanielBill Petition PL 201 90002105 EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Dear Mr. Finn, I live on Marco lsland and my husband and I are very opposed to having a material recycling plant "in our backyard". Our waterways are already impaired and in need of a corrective plan. Please find another location. Thank you, Michael & Susan Knox 1779 Wavecrest Ct. Marco lsland 1 9.A.3.e Packet Pg. 777 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: Diana Clarke < dclarke246@aol.com > Saturday, October 24. 2020 5:33 PM FinnTimothy Proposed recycling plant EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Mr Finn and the planning commission of Collier county, We strongly object to the proposed privately owned recycllng plant. ltwill notbeinthebestinterestofourcounty residents nor the waterways of Collier county for this type of plant to operate in our area. Sincerely, Diana. & Richard CIarke Marco lsla nd Sent from my iPad 1 9.A.3.e Packet Pg. 778 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Cc: Subject: Randy Harris < rcharris1973@yahoo.com > Saturday, October 24, 2020 5:51 PM FinnTimothy FialaDonna; Andy.Solis@colliercountyfk.gov; SaundersBurU TaylorPenny; McDanielBill Proposed Rerycling Facility Mr. Finn, It is my understanding you are the Principal Planner on a Recycling Facility being proposed by Richdale Recycling to be located at Us 41 adjacent to Collier Seminole State Park. I strongly urge you and the County Commission to reject this proposal. I have many environmental concerns about this project as I live on Marco lsland and this is too close to our water ways and our overall environment. Randy Harris Marco lsland, FL 1 EXTERNAL EMAIL: This email ls from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. 9.A.3.e Packet Pg. 779 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: Gmail < pgolato53@gmail.com > Saturday, October 24, 2020 6:23 PM FinnTimothy Proposed recycling plant EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Dear Timothy. As a property owner close to the proposed site, I respectfully ask that you not support this proposal. This will bring even more air and water pollution than we already have. I am sure you are receiving many requests to stop this and I ask again for you to please not support this project. Thank you. Stay safe and healthy. Peter Golato 1275 Rlalto Way Na ples, FL 34114 Peter A Golato Sent from my iPhone 6 1 9.A.3.e Packet Pg. 780 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimoth From: Sent: To: Cc: Subject: Deborah Grodman < dagrodman@yahoo.com > Saturday, October 24, 2020 6:44 PM FinnTimothy FialaDonna; SolisAndy; SaundersBurU TaylorPenny; McDanielBill Richdale Rerycling EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Dear Mr. Fin n, I am a Marco lsland resident. I have heard about the proposal for the above-mentloned plant. l'd like to strongly oppose this plant. Please reconsider what such a business would impact not only the fragile environment, but also the health of the people as materials enter waterways. This is something that once constructed, will impact not only our generation, but those to come. Regards, -Debora h A. Grodman- 1 9.A.3.e Packet Pg. 781 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimot From: Sent: To: Cc: Subject: bobby@ecosharks.org Saturday, October 24, 2O2O 7:21 PM FinnTimothy FialaDonna; SolisAndy; SaundersBurt TaylorPenny; McDanielBill Petition PL 201 900021 05 EXTERNAL EMAILT Thls email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Dear Mr. Finn, A materials processing plant so close to Marco lsland would be devastating to our property value. There are so many more sites that would serve the same purpose w/o destroying our community. Thank you, Bobby 1258 Apricot Avenue Marco lsland, FL 34145 239.322.3448 olfice 786.897.9875 cell Eco Sharks 1 Bobby Monroe 9.A.3.e Packet Pg. 782 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: Beth Steward <bsbk1 3@comcast.net> Saturday, October 24, 2020 8:32 PM FialaDonna; FinnTimothy; SolisAndy; SaundersBurt; TaylorPenny; McDanielBill Recycling plant near Collier Seminole? NO, please! EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. I can't imagine what a terrible impact this would have on our environment and infrastructure! Please don't let them build this! Collier-Seminole is one of our fragile local ecosystems....please protect it. Beth Steward Marco lsland 1 9.A.3.e Packet Pg. 783 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimot From: Sent: To: Cc: Subject: frank schultz <fschultzoT@yahoo.com> Sunday, October 25, 2020 7:53 AM FinnTimothy FialaDonna; SolisAndy; SaundersBurU TaylorPenny; McDanielBill Fw: re recycling plant letter from Carlos Portu EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. NO to the recycling plant at the proposed location. business on Marco lsland I live at7152 Live Oak, Naples and have a Best regards, Frank Schultz Gulf Coast Realty Broker / Owner Schultz Home Team 235 N Collier Blvd Marco lsland, FL 34145 Cell: 239-821-3839 Fax: 305-503-8574 Website: www. Sch u ltzHomeTeam.com -:- Forwarded Message --- From: Shirley Schultz <shirleyschultz@yahoo.com> To: Frank Schultz <fschultz0T@yahoo.com> Sent: Saturday, October 24, 2020, 09:33:33 PM EDT Subject: re recycling plant letter from Carlos Portu I write this post to you in the hopes you will join me in a fight against what I feel would be travesty to East Naples and Marco Island on numerous fronts. A privately owned material recycling plant has been proposed for US 41, adioining Collier Seminole State Park as Riggs Road. The facility, proposed by Richdate Recycling, would process crushed concrete and agriculture products for much ofCollier County and operate as a privately owned for profit entity. Needless to say, the impacts ofthis proiect wilt be felt well beyond the other end ofSan Marco Road... Imagine an Air Curtain Incinerator burning agricultural waste iust down from the Goodland Bridge. Think about the impacts to our waterways from Mountains of decomposing plant material carried to our canals from the annual sheet flow that covers Picayune Strand and Collier Seminole? We wonder where the source of Nitrogen and Phosphorous that is destroying our waters? Look no further. 1 Dear Friends and Neighbors- 9.A.3.e Packet Pg. 784 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) Think about industrial concrete crushing just down the road, then imagine if the asbestos lined water pipes of years past end up there. This is such a bad idea on so many fronts, I could not help but seek the support of all of you in making sure this never comes to fruition. The project will go before the Planning Board for Collier County on November 5th. Petition PL 20190002105 You can join via Zoom and even register to speak during public comment. Also, Please consider taking the time to write to the Principal Planner on the proiect, Mr. Timothy Finn to voice your opposition to the proiect. Any public feedback letters will be forwarded to the Planning Commission. Also, feel free to copy our county commissioners! timothy.fi nn@ colli ercountyfl . gov D onna. Fi a la @ co ll i ercou ntyfl .gov Andy.Solis@ colliercountyfl .gov Burt.Saunders@ colliercounWfl .gov Penny.Taylor@colliercountyfl .gov Bill. McDaniel@ colliercountyfl .gov 2 l* i' {rT :; i it /E €--& \r-! I .e *l** \ B \\: +I .1 9.A.3.e Packet Pg. 785 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimoth From: Sent: To: Subject: Attachments: Brian Alletto < allettoO5@gmail.com > Sunday, October 25, 2020 8:08 AM FinnTimothy RichdaleRecyclingConditionalUse(CU-PL-20f90002105) HM File No.: 20'19.058 Site Plan - rev 8-5-2020.pdf EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Good Morning Timothy, I would like to share my thoughts and tell you why this is a horrible decision. The company that owns that land has already been using it and bringing in several large dump trucks every morning. They park their heavy rigs in the middle of the road and it causes us to have to drive into the grass to get around. They killed numerous turtles, frogs, etc. Due to their commercial size; they can't see any ofthese protected species. There is no adequate lighting for any commercial vehicles. They will do it whether you all say yes or no. As they are doing stuff now with the land. They are bringing in materials and doing it manually but they are essentially already doing what they make money to do. I know there is a lot involved because once the lady on the street had it stopped last time; the county inspector was there the next day trying to find everything in the book to write violations for. Therefore; I told her I think this company has a lot of lobbyist help for this reason. The timelines of the county inspector showing up was too coincidental. I plan to speak for these reasons at the next meeting. I am sure Waste Management has a lot of contacts inside. Tr,lcl ien$h: 2r feel. Trud( rldlh 8.5 feer However, we need a minimum of l0reel o( wlddr to get the uuct lhrouoh an opeoing, such as a gale. sometimes I 0 feet is not even mough if the ground is not level or there is poor visabilily. -&r \ !6I ff.i rfl,4' : *:1i rl Tfi 1 a t o 9.A.3.e Packet Pg. 786 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) Q,OF 1M. NO PROTRUSIONS DRIW AISLE. 2, AT flE TIME OF INTNAf, S.D,P. OR PLAT, SISTING VEGflATIOil VIILL MEETTHE L.D,C, BUFFERREOUIRflEMS OR SUPPLEMEMAL PMTNG WLL BE PROVDEDAS NECES$RY, PRESERVE AREA CALCULATIONS: IOTAL Sm=i6.,(} Ac. UISTING MIIW WGETATOil TO BASE NATNE RETEffitON REOUTREMENT:€.37 Ac.{% REOUIRED MTNE WGETATION RETEMTION{.37 Ac.xffi=2.S Ac. PRESERE GO BE CREAED)=2.55 Ac. SITE INFORMATION: TOTI mEA=l6.€ k(r) (100%) aUmlNG=2m !.t (r) (0.m3%) WASTE OISPOSAL: WASIE OISPOW BY WASE MNAGEM€ffi ROLLOUT TOTER TO BE USED AS NOIED GENERAL NOTES: 1, 1? CRUSHED CONCRfrE ROLLEO & COMPACTEO TO PROVIDE LBR ffiOVE FIil[ GMDED SURFACE OF MORE frAN 1'FOR PARXING E REQUIRED PARKING: 2 SPACES PER EMPLOYEE 2(6=12 SPACES REOUIRED 26 SPACES PROVIDEO ZOilEO: A, AGRICUITUnE UND USE: SINGI-E FAMIIY/Ag 20 wPE C UXoSPE BUFrtn tr'\ ta.tt\ \ZONED: A,AGRICUITURE UNOUSE:61'5FARM \ L 15', 2t PnEStAVf STTUC( (rtuXcrpA0 1o', PRrst*Va Smq IACCTsSY) AREA(StE tOIt r) zONEO: A, AGRICUTTURE UNO USE: 5t's FARM 50' 5TIBACX \ STAGING AREA .i.\ lr ) ! I I I I I 5 Ctct noLa AG RESoURCE /') -/\ TTMNSFERAREAJ l//lrl and NURSERY \. ZONED: A, AGRICUTTUREND US€: FLAMINGO BENO NURSERY I!l iG6iuD t.o.w./PMnw uxt 20'm'cwM&ffrn [--o'rro-r*oru I r_::l_ alR.OW./ P{OpfRryLtilE TAM|AM| TRATL (U.5.41) ZONED: BOYNE SOUIH P.U.o. LANOUSC: RES|DEtlTlAt ri I EXtSTtN6 UKE ,/ IN AG RESOURCE TMNSFER AREA 19058_SP EXHIBITRICHDALE RECYCLING I{Vt S Enm l&y Napl€., FL.9110 Phm: (239) 2*2m FbAa Affab d A6od.t@ No 1772 HOLE MONTES Effitffimrffisilnm SITE PLAN CONDITIONAL USE 2019.o5a 1oF1 L--- 9.A.3.e Packet Pg. 787 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: Elaine Felipe <efelipe9l 3@gmail.com> Sunday, October 25, 2020 9:33 AM SolisAndy; McDanielBill; SaundersBurt; FialaDonna; TaylorPenny; FinnTimothy Concerned voter EXTERNAT EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. I write this post to you as I have became aware that a private owned material recycling plant has been proposed for Us 41, adjoining Collier Seminole State Park as Riggs Road. The facility, proposed by Richdale Recycling, would process crushed concrete and agriculture products for much of Collier County and operate as a privately owned for profit entity. Needless to say, the impacts of this project will be felt well beyond the other end of San Marco Road... lmagine an Air Curtain lncinerator burning agricultural waste just down from the Goodland Bridge. Think about the impacts to our waterways from Mountains of decomposing plant material carried to our canals from the annual sheet flow that covers Picayune Strand and Collier Seminole? We wonder where the source of Nitrogen and Phosphorous that is destroying our waters? Look no further. Think about industrial concrete crushing just down the road, then imagine if the asbestos lined water pipes of years past end up there. Deuteronomy 31:6 "Be strong and courageous. Do not be afraid orterrified because of them, for the Lono your God goes with you; he will never leave you nor forsake you." This would be bad for so many in all levels. Please do not allow this to happen. Elaine Felipe 239-97 0-0621 Till Next Time Elaine 1 9.A.3.e Packet Pg. 788 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Cc: Subject: jlysiak@aol.com Sunday, October 25, 2020 9:35 AM FinnTimothy FialaDonna Material recycling plant opinion EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Dear Principal Planner Finn and Collier County Commissioners, Please allow this email to express my vehement opposition to the proposed material recycling plant in the area of US 41 adjoining collier Seminole State Park as Riggs Road. The facility, proposed by Richdale Recycling, would negatively impact the quality of air and water in our area, to say nothing about how wildlife living in the area could be impacted. ln fact, it could be devastating. This is such a bad idea on so many fronts, I could not help but seek the support of all of you in making sure this never comes to fruition. Jeff Lysiak 15 year resident of Collier County 251 Loon Lane, Naples 1 9.A.3.e Packet Pg. 789 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: EDWARD TOLAN D <tedt282nd@comcast.net> Sunday, October 25,2020 10:28 AM FinnTimothy; FialaDonna; SolisAndy; McDanielBill; Burt.Sanders@colliercountyfl.gov; Taylorpenny Petition PL 20190002105 EXTERNAL EMAiL: This email is from an external source. Confirm this is a trusted sender and use e*reme caution when opening attachments or clicking links. Dear Elected Officials, I am a home owner and resident of eastern collier county. I am 100% against the proposed recycle plant. This facility has the potential to cause irreversible damage to our fragile eco system. Not to mention our clean air and pristine water ways. No matter what the company proposes for safe guards its not enough. You all know as residents that during Hurricane sand rainy season we get un godly amounts of rain . The ground would be saturated and the run off would likely do great damage to out water ways and air quality. This part of Naples would become a toxic site never to be reclaimed for usual use. I hope you vote with the residence of Naples to defeat this proposal. Thank You Edward Toland 37 42 T reasure Cove Circle Naples Fl 34114 1 9.A.3.e Packet Pg. 790 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTim From: Sent: To: Subject: docrudin <docrudin@g mail.com > Sunday, October 25, 2020 10:46 AM FinnTimothy; FialaDonna; SolisAndy; SaundersBurU TaylorPenny; McDanielBill Richdale Recycling on Rte 41 EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Thank you in advance for considering the following: East Collier county has been growing. More residents moving in and more housing developments being built. Fiddler's Creek continues to grow, Taylor Morrison adding another development next door, Publix building a new retail center on route41. All ofthesearestepsforenhancingandgrowingtheareaandenrichingCollierCounty. Then come Richdale Recycling who wants to haul concrete and agricultural trash into this area, crushing and burning the waste down the block from all this advancement. As a physician, I have to say that adding the smoke and particles to the air, as well as the inevitable water polution, will destroy the health of the elderly with Iung and cardiovascular disease. Their investment and trust in Colller County should be foremost in any development planning. I cannot imaging why anyone would entertain a waste center, of any type, near a growing residential area. We all know waste has to go somewhere but the proper health conscious decision is to move it away from any residential areas and let them build it far enough away that the air and possible water pollution will not reach the Beneral population. Sent from my Verizon, Samsung Galaxy smartphone 1 Please do NOT approve a waste center, of any type, on Route 41 in East Naples. Thank you once again Dr. Andrew Rudin 9.A.3.e Packet Pg. 791 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Cc: Subject: Diane Fisher <dfisher1080@g mail.com > Sunday, October 25, 2020 12:47 PM FinnTimothy FialaDonna; SolisAndy; SaundersBurt; TaylorPenny; McDanielBill Richdale Recycling Facility Project-Petition PL 20190002105 EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Mr. Timothy Finn-Principal Planner for the Richdale Recycling Facility Project Petition PL 20190002'105 Dear Mr. Finn, My husband and I are year-round residents at the Port of the lslands. We retired here 18 months ago and truly enjoy life in the everglades. We are distressed to hear about plans to create a privately owned material recycling plant close to our home and we want to register our strong opposition to implementation of the Richdale Recycling project. The negative environmental impact of such a facility is clear. ln addition to pollution of waterways and State Lands, odors from the facility will negatively impact those of us who have chosen to live and vacation in and around the area. Please do not allow this project to move foMard. Diane Fisher 206 Newport Dr. Unit 804 Naples, FL 341 14 1 9.A.3.e Packet Pg. 792 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: Linda Kirkpatrick < lindajkirkpatrick58@gmail.com> Sunday, October 25, 2020 1:19 PM FinnTimothy Proposed recycling plant for US 41-adjoining Collier Seminole Park EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Mr. Finn, I am writing you this short email to oppose this site for a recycling plant. Without getting into all the adverse effects that this plant would have on our community, air, waterways, soil (environment) and the like we would like to be put on record that we are vehemently againstthis. Please take note and pass along this information to all involved. Thank you, Dr. Timothy and Linda Kirkpatrick Port of the lslands 1 9.A.3.e Packet Pg. 793 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimot From: Sent: To: Subject: Bob Roth < rwr720@hotmail.com > Sunday, October 25, 2020 2:30 PM FinnTimothy Richdale Recycling EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Dear Mr. Finn, I am a seasonal resident of Marco lsland and only recently became aware of the Richdale proposal at Route 41 and Riggs Road. Please do not consider me a NIMBY since I am far from that, after having a 42 year career as a licensed consulting civil engineer in site development design. l've worked on private sector development projects throughout much of the US as well as in Mexico. My concern is with the site for the Richdale project, regardless of zoning, in that it is close to and directly upstream of Addison Bay and the Marco River. The waters around Marco and Collier County have already been seriously impacted by suburban and rural stormwater runoff, with some being impaired. Yet to my knowledge there are no TMDL's that have been established. I imaBine the Richdale site plan includes a full array of BMP's intended to mitigate environmental impacts. But even the DEP mandatory level of stormwater treatment is for only 85% pollutant removal. ln another locale or at a site elsewhere in Collier that may be appropriate. But not at a site precariously above Addison Bay. I recognize that with the almost explosive level of construction presently occurring in Collier County that there probably is a siSnificant need for a use such as the Richdale proposes. I am not against such an activity. ljust believe Richdale's is at the wrong site. l'm sure there's another central site with good access elsewhere to be found, and hopefully that's the reasonable alternative to the proposal you need in order to recommend against the application when it comes before the County Commissioners on November 5. Bob Roth Sent from my iPad 1 9.A.3.e Packet Pg. 794 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) Fi From: Sent: To: Subject: john agnello <jagnelloT@msn.com > Sunday, October 25, 2020 3:22 pM FinnTimothy No recycle center EXTERNAL EMAIL: Sent from my Verizon, Samsung Galaxy smartphone 1 source. Confirm this is a trusted sender and use extreme cautionemail is from an external attachments or 9.A.3.e Packet Pg. 795 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTi From: Sent: To: Subject: john agnello <jagnelloT@msn.com > Sunday, October 25, 2020 3:24 PM FinnTimothy No recycling center on 41 EXTERNAL EMAIL: Sent from my Verizon, Samsung Galaxy smartphone 1 email is from an externalsource. Confirm this is a trusted sender and use extreme caution attachments or 9.A.3.e Packet Pg. 796 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: paul cannon < paucan6005@hotmail.com > Sunday, October 25, 2020 4:56 PM FinnTimothy Goodland incinerator plant EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Sir! I strongly protest this incinerator plant proposed circa the goodland bridge on San Marco road. As a resident ofthe Port of the lslands, the discharge and air pollution will impact us directly. We have enough problems with the red tide and runoff pollution from the interior thru the canals and faka Union. Please don't let this happen Thank you Paul Cannon Port of the lslands Sent from my iPhone 1 9.A.3.e Packet Pg. 797 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: EXTERNAL EMA L: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Nancy Vandermeer Begin forwarded message: From: Nancy Vandermeer <NV218@aol.com> Date: October 25, 2020 at 4:59:48 PM EDT To: "donna.fiala@colliercou ntyfl.gov" <donna.fiala@colliercountyfl.gov>, "bill.mcdaniel@colliercountyfl.gov" <bill.mcdaniel@colliercountyfl.gov>, "andy.solis@colliercountyfl.govr'<andy.solis@colliercountyfl.goD, "burt.sanders@colliercou ntyfl.gov,' <burt.sanders@colliercountyfl.gov>, "penny.taylor@colliercountyfl.gov" <penny.taylor@colliercountyfl.gov>, "timothy.finn@collliercountyfl.gov" <timothy.finn@collliercou ntyfl.gov> Subiect: Oppose Pt 20190002105 Reply-To: Nancy Vandermeer <nv218@aol.com> I om writing to eoch of you to let you know os o Collier County resident in Fiddler's Creek, I om opposed to the privotely owned moteriol rccycling plont proposol on US 41. An Air Curtoin Incinenotor focility burning wosfe down the rood will hurt our guolity of life ond our property volues. I do not think this project should hove evenbeen considened. f obsolutely oppose PL 20190002105. NANCY VANDERMEER 9267 Museo Circle Unil 104 Noples FL 34114 NANCY VANDERMEER <nv218@aol.com > Sunday, October 25, 2020 5:07 PM FinnTimothy Fwd: Oppose PL 20190002105 Deor Commissioners ond Mr. Finn, 1 9.A.3.e Packet Pg. 798 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Cc: Subject: Jennifer Drake, RE/MAX <jen.drake@juno.com > Sunday, October 25, 2020 5:24 ?M FinnTimothy FialaDonna; SolisAndy; SaundersBurt; TaylorPenny; McDanielBill Proposed Richdale Recycling-Riggs Rd. Conditional Use EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. I am writing on behalf of our family as well as the other residents of Riggs Rd. and neighboring Royal Palm Golf Estates, with whom I have had direct conversations and who will be submittinB petitions signed by other residents to your department in advance of the Nov. 5, 2020 meeting. We have owned our property at 11551 Riggs Rd. since 2007 and in 2014, decided to clear, landscape and improve to build a brand new home on the property. We now have a significant investment in our home here and have been looking forward to the appealing new development and beautification projects that have been slowly expanding to our corner of East Naples for quite a few years now. They are finally here, with DR Horton now building out Royal Palm Golf Estates across Rt. 41 from us and the gorgeous new Esplanade community only a mile or so up the road. As I'm sure you are aware, this area is the first noticeable development as people drive north and west into Naples along Rt.41. We already have the eyesore of the abandoned, dilapidated gas station at the corner of Lake Park Rd. To imagine this flanked by this recycling, concrete-grinding "dump" is distressing at best. our investment and the hard work put into our property as well as all of the other residents who have done the same, especially in recent years, will be severely impacted should this get approved. I implore you to take the following into account when this matter comes before you. There are so many negative impacts beyond property values. These include: 1. Safety: a.) The 20 ft. wide road way is the minimum for localtraffic and in no way is adequate to support the 100 yard tractor trailers that the petition mentions. Furthermore, there is a sharp, mostly blind curve that is dangerous and difficult to navigate with another oncoming vehicle. Large dump trucks and dumpster haulers are already a problem, not only on the road and curve, but even turning into and out of the narrow entrance to the street. With relatively deep drainage ditches on either side, there is no place to go when faced with these trucks. The entrance to Richdale Recycling is very close to this curve. b.) Also part ofthe safety concern, there are residents who ride horses down Riggs Rd. to neighboring open lands as well as residents who wait at the end of the street for thelr children getting on and off the school bus that only stops out on Rt.41. This would be impossible with the increased truck traffic. c.) Should a large tractor trailer or similar miss the entrance to the Richdale property, there is no place to turn around except on private property or backing up the entire way to 41. 2. Richdale Recycling has owners currently in this type of business, most notably Yahl Street Recycling and Yahl Street Holdings at 5801 Yahl St. Naples. There are numerous complaints and violations at both the RiSgs Rd. location (for unpermitted use) and the Yahl St. location. How can we (or you) expect any different from the same operators at Riggs Rd.? Dear Mr. Finn and County Commissioners, 1 9.A.3.e Packet Pg. 799 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) 3. There is industrial or heavy commercial property available nearby and no reason to change the Agricultu ral/Residential area. 4. The existing roadway is sub-standard for the proposed use. The driveway access and it's Sight Distance problem is bad now and will only get worse. 5. The site already has admitted contamination and yet the Applicant wants the Conditional Use approved first and proposes to address the contamination during the Site Plan stage, after public comment. They haven't addressed it for years, why would they after approval? 5. The Applicant states they will clean up the road when necessary and have a street sweeper, however it has been an ongoing issue for years, especially during rainy season, that the road is covered with dirt, mud, dust and sometimes chunks of rock. As evidenced by the Cemex plant up Rt.41, the dirt and concrete dust is carried out onto and going up Rt. 41. lt is constantly stuck to our tires and bottom of our vehicles when going through it daily. 7. The surrounding drainage ditches flow into nearby bays and environmentally sensitive waterways and mangrove areas. 8. The obvious concerns to the local neighborhood of severe degradation of property values, traffic, noise, odor, cleanliness, risk of fire, and air quality. I understand from reading some of the aforementloned Code complaints that DEP would be the ones overseeing air quality. What is their involvement in this application? ln closing, I hope that the Planning Board and ultimately our County Commissioners will stand by the residents of not only the Riggs Rd. neighborhood, but nearby ones, the adjacent farms growing food, as well as and our environment and realize that this proposal is r,compotitre with both the existing adiacent land uses as well as future land use and improvements to East Na ples. With thanks for your time and consideration, Jennifer and Gary Drake 11551 Riggs Rd. Na ples, FL 34114 239-82!-0283 2 9.A.3.e Packet Pg. 800 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) Collier Co. Planning Dept. Attn: Timothl'f,.{rn 2800 N. Horseshoe Dr. Naples, FL 34r.04 November L7,2O2O RE: Richdale Recycling Conditional Use 11685 Riggs Rd, Naples, 34tL4 Petition ltlo. Pl--20190002105 Conditional Use Zoning; Nov 5,2020 Dear I\4r Finn l'nn wniting this on behalf of the residents on Riggs Rd, et al; who are very concerned about the rezoning of Rlchdale Recycling scheduled for November 5,2020. The "Richdale" owners have 'tried several times in the past 5 years to change our zoning from Agricultural/ ftesiden'tiai A-RSh{UO to Manufacturing or lndustrial. Below would be the negative irnpacts ;,f er:f CCnf inUnity: 1 2. 3. Durnping Solid Waste and Concrete in a Residential area. Fire and Health concerns; Check w/ MW mulch in Ft. Myers. targ€ cunnp trucks on our narrow residential road with no turn-arounc! for them to get oiit, having to use private driveways to exit. Devaluatiun of property values since zoning is no longer agriculturaUredidentiai, but a pirb!!c dunrup of solid wastes and concrete mountains. Mlsuse of an Agricultural label to run a business. n 5" For those ef you who haven't been on the East Tamiami Trail for a while, this is the nr,;:es'i expansron of housing developments ever! Every development gives the "East Tratl" a ue,'!i opuient affluence that has taken years to expand. When several of the subdivisions are finished, the fagade for each entry will be finished professionally to market for buyers. lf Richdale would get their zoning, Riggs Rd. will resemble the public dump with rnountairrs of soliei waste and concrete. Richdale's property is on both frontage lots on Rlggs Rd, faclng L.lS 43., so is noticeable to people coming from Mianri or Naples. Riggs Rd is surrouncled hy State lanC: Ficayune Strand State Park, Collier Seminal State Park and the Ten ThousanC lsianc Natrcna! lVii.ji!t'e Refuge and for many years, the County wouldn't even spray for rnosquitoes in our area due to its sensitivity. Can you imagine a future of grlncling concrete in or,sr cornmunity with our wildlife, delicate vegetation and also the health of the people iiving irr this area. iulW Mulch in North Fort Myers has had several fires from their mulch piant anci mariy lawsults pending from the neighbors, so why would we be willing to allow a "porentlal problem" by aii;u''ing a Manufacturing business in our quiet agricultural neighborh;;cd. 9.A.3.e Packet Pg. 801 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) Publix and a commercial center have started building. Other nice commercial areas will follow, which is why we don't need "lndustrial" Zoning in an area that has just started the beautification of East Collier. The quiet residential area of Riggs Rd has 2 % - 4%. acre parcels; some with small tree farms, and some with just homes. Since "Richdale", formerly Anna green acres, has been tryint to change the zoning for several years, the residents are frantically trying to keep our street the same quiet community where we can watch trees grow, rather than have large "Pro"- Trucks barreling down the road with waste or concrete as they want to do. Whether they have the proper zoning or not, they have continued to do business at their property for the last few years, regardless of whether Collier County allows them or if they even pay sales tax. The last public hearing they wanted to Grind Concrete so it's just a matter of time if they get their 1't rezoning, that they try again for grinding concrete. We plea with you to strike down this rezoning and let us continue with the A-RSMUO zoning that we have without the fear of Richdale changing it. At the last meeting, we asked if they would just purchase "lndustrial" property in another area already zoned for what they want to do, but instead, they obviously bought another parcel on Riggs Rd. (They are probably already thinking of future expansion!) This is a serious impact on our community and we hope that you will consider the people who live here. Attached is a sheet with other Ritgs Rd residents who hope that this will be shared at the November 5th meeting with the public, so they know what we have been going through these past years. Please see our signed petition attached. /"*A@fi194,* Judy Appel Meagher Property Owner or; U101 Riggs Rd, Naples, Ft 34114 9.A.3.e Packet Pg. 802 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) +o I I1 Li'Il; 't*N \c- \ei tr \t F\\\S fLA 2 t)vc \r \ta :t,/t -tu fE tl+s d , ,4.i> /1) D ,fL ilt I a+z lZ"-'/2 t{- 6 Q\*t-OrA L {wt -7-}e I 4lt( L.,I NAI4L PROPERry OWNED /6 I I id)K tQc, 9.A.3.e Packet Pg. 803 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimot Flom: Sent: To: Subject: Bob Roth < rwr720@hotmail.com > Monday, October 26,2020 2:53 PM FinnTimothy Richdale Recycling EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or cllcking links. Dear Mr. Fin n, I am a seasonal resident of Marco lsland and only recently became aware ofthe Richland proposal at Route 41 and Riggs Road. Please don't consider me a NIMBY since I am far from that, after having a 42 year career as a licensed consulting civil engineer in site development design. l've worked on proiects throughout almost half of the US as well as Mexico. My concern with the subject site for the Richdale project, regardless of zoning, is that it ls directly upstream of Addison Bay and Marco River. The waters around Marco and Collier County have already been seriously impacted by suburban and rural stormwater runoff. I imagine the site plan includes a full array of BMP's intended to mitigate environmental impact. But even the mandatory level of treatment is only for 85% removal. ln another locale or at a site elsewhere in Collier that may be appropriate. But not at a site precariously above Addison Bay. I recognize that with the vibrant level of construction in these parts that there probably is a significant need in Collier County for a use such as the Richland proposes, and I am not against such an activity. Bob Roth Sent from my iPad 1 9.A.3.e Packet Pg. 804 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Cc: Subject: Nancy Smith < nksmithTT@msn.com > Monday, October 26, 20ZO 3:48 pM FinnTimothy Donna.Flala@colliercountyfl.gov My opposition to Petition PL 20190002105 EXTERNAL EMA L: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Hello Mr. Fin n, I am writing to ask you to please do all you can to stop the approval of the proposed Richdale Recycling center on 41 andRiggsRoad. lt would be a travesty to put it in that location. Many use this road to enter the Naples area. lt is not what we want tourist and locals (who vote and pay taxes) to have to see let alone put up with' The location is near waterways, forested areas, and many new and existing homes. The impact on our water, air, vegetation, and living creatures is immense. I grew up near a recycling center that expanded into crushing concrete. lt was awful! The noise pollution was constant. The air quality was severely impacted' Everything was constantly dusty, and the air felt gritty. The idea of having an air curtaln incinerator also on the site make me feel incredible downhearted. The impact to the area would be a disaster. please stop this from happening. Thankyou, Nancy Smith Fiddlers Creek 3078 Aviamar Circle Naples, FL 34114 1 9.A.3.e Packet Pg. 805 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) (o77 tno"LrL rcfz<fzu Collier Cou nty Planning Dept Attn: Mr. Timothy Finn 2800 N. Horseshoe Dr. Naples, FL 34104 october 25, 2020 RE: Richdale Recycling Conditional Use Request Petition PL-20190002105 Dear Mr. Finn and members of Collier County Board of Commissioners: I am writing on behalf of our family as well as the other residents of Riggs Rd. and neighboring Royal Palm GolfEstates. lhave had direct conversations with several of these residents who will be submitting petitions signed by other residents to your department in advance of the Nov. 5, 2020 meeting. We have owned our property at 11551 Riggs Rd. since 2007 and in 2014, decided to clear, landscape and improve to build a brand new home on the property. We now have a significant investment in our home here and have been looking forward to the appealing new development and beautification projects that have been slowly expanding to our corner of East Naples for quite a few years now. They are finally here, with DR Horton now building out Royal Palm Golf Estates across Rt. 4L from us and the gorgeous new Esplanade community only a mile or so up the road. As I'm sure you are aware, this area is the first noticeable development as people drive north and west into Naples along Rt. 41. We already have the eyesore ofthe abandoned, dilapidated gas station at the corner of Lake Park Rd. To imagine this flanked by this recycling, concrete-grinding "dump" is distressing at best. Our investment and the hard work put into our property as well as all of the other residents who have done the same, especially in recent years, will be severely impacted should this get approved. I implore you to take the following into account when this matter comes before you. There are so many negative impacts beyond property values. These include: 1. Safety: a.) The 20 ft. wide road way is the minimum for local traffic and in no way is adequate to support the 100 yard tractor trailers that the petition mentions. Furthermore, there is a sharp, mostly blind curve that is dangerous and difficult to navigate with another oncoming vehicle. Large dump trucks and dumpster haulers are already a problem, not only on the road and curve, but even turning into and out of the narrow entrance to the street. With relatively deep drainage ditches on eitherside, there is no place to go when faced with these trucks. The entrance to Richdale Recycling is very close to this curve. b.) Also part of the safety concern, there are residents who ride horses down Riggs Rd. to neighboring open lands as well as residents who wait at the end of the street for their children getting on and off the school bus that only stops out on Rt.4l.. This would be impossible with the increased truck traffic. c.) Should a large tractor trailer or similar miss the entrance to the Richdale property, there is no place to turn around except on private property or backing up the entire way to 41. 9.A.3.e Packet Pg. 806 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) 3. There is industrial or heavy commercial property available nearby and no reason to change the Ag ricu ltu ra l/Reside ntia I area. 4. The existing roadway ls sub-standard for the proposed use. The driveway access and it's Sight Distance problem is bad now and will only get worse. 5. The site already has admitted contamination and yet the Applicant wants the Conditional Use approved first and proposes to address the contamination during the Site Plan stage, after public comment. They haven't addressed it for years, why would they after approval? 5. The Applicant states they will clean up the road when necessary and have a street sweeper, however it has been an ongoing issue for years, especially during rainy season, that the road is covered with dirt, mud, dust and sometimes chunks of rock. As evidenced by the Cemex plant up Rt.41, the dirt and concrete dust is carried out onto and going up Rt. 41. lt is constantly stuck to our tires and bottom of our vehicles when going through it daily. 7. The surrounding drainage ditches flow into nearby bays and environmentally sensitive waterways and mangrove areas. 8. The obvious concerns to the local neighborhood of severe degradation of property values, traffic, noise, odor, cleanliness, risk of fire, and air quality. I understa nd from reading some of the aforementioned Code complaints that DEP would be the ones overseeing air quality. What is their involvement in this application? ln closing, I hope that the Planning Board and ultimately our County Commissioners will stand by the residents of not only the Riggs Rd. neighborhood, but nearby ones, the adjacent farms growing food, as well as and our environment. Please realize that this proposal is incompotible with both the existing adjacent land uses as well as future land use and improvements to East Naples. With thanks for your time and consideration, \) -t ennifer and Gary Dra ke 11551 Riggs Rd. Na ples, FL 34114 239-82L-O283 2. Richdale Recycling has owners currently in this type of business, most notably Yahl Street Recycling and Yahl Street Holdings at 5801 YahlSt. Naples. There are numerous complaints and violations at both the Riggs Rd. location (for unpermitted use) and the Yahl St. location. How can we (or you) expect any different from the same operators at Riggs Rd.? 9.A.3.e Packet Pg. 807 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) october 23, 2020 Mr. Timothy Finn Collier County Planning Department 2800 N. Horseshoe Drive Naples, FL 34104 Dear Sir On behalf of the residents of Royal Palm Golf Estates, Tamiami Trail East, Naples 34114, we submit the attached Petition in opposition of Richdale Recycling to have their property on Riggs Road, Naples, re- zoned from Agricultural/Residential to Manufacturing/lndustrial usage. lf this application is approved, it will have a huge negative lmpact on our property values, as well as to the health, safety and peaceful enjoyment of our property. The proposed dumping of Solid Waste, tlres, mulch and concrete in a residential area will negatively impact everyone living directly across from Riggs Road off Route 41. we are also concerned over the possibility of fires such as the mulch fire which occurred in similar facilities in Ft. Myers. We are also concerned ofthe heavy truck traffic in this area. Riggs Road is a small rural road with a sharp blind curve which is very dangerous to drive on now, and will be increasingly dangerous, to drivers and pedestrians should this application be approved. Many times either walking or driving on Riggs Road, I have been nearly run off the side of the road from truck traffic. Our Community is currently being expanded with many new homes. This proposed change in zoning could make prospective new home buyers purchase elsewhere which will hurt our property values. Therefore, in light of the above, we, the residents of Royal Palm Golf Estates respectfully request that this application be denied. Thank you, Sincerely Christine Koren, 18 Royal Hammock Blvd. Naples, Royal Palm Golf Estates, Naples, FL 341t4 cerr flhone 13bo) 280 -ffi3 r Re: Richdale Recycling Zone Change 11685 Riggs Road, Naples, 34114 Petition No. PL 20190002105 9.A.3.e Packet Pg. 808 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) 118 DP L n r{-$/ 8aor. irorlvi" E^ G ud-t-g%1 Coure- t?"a'l 8o L(N\A JT 18535froY*l rL{Arruno $o * 1 F"o) ( o (-o s) M6s I rt \Wnuk twm)h I o/b D.o4 C -rtu trri" C vr3l \lForst v e D-z- -r(e+?o t //1 tv 3q3 14//c 5 a 5 PA itx I )t7o v P fiI C aco tssa a LJ rar5-tt (oqlo < *rBtrRT R\ J,y 6t ?eft Tton fiGn t t'L'1- lrto' Ft aot? ooo a-tDS BlqHDnLr (Ec)cr r n7 zon< t\?:-l<--t:::. 96rrc.r.r{ureZ gEsloe v7n a t- To rbA-nt @<'TurnG/tnlasln' ,8tvA ilorno.A &u Av 9.A.3.e Packet Pg. 809 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) 3I N. na tErtq Z H*^*,o , r!, -.bn,..\ /PF /- /vl q ,^N,/4 c' K -lct-rc4teoL vbq t-l c 1Io r €{53 R,6. I'$ u) il l ,( il 9.A.3.e Packet Pg. 810 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) Jr"ss /0234 tt/6 Fa c 4z Ual e44 no>,tu da-,nlt//oq 't' a ! 9c t t 'P,o /b-t<. IV u, u'^l[ ff vl t b,7 r I &<-Sea/a/o 2Z Kt/aro t. L --to \)I il 9.A.3.e Packet Pg. 811 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) 4j lgatz (.*k"- (9'o, \ o& -lttq er L /6q lTwo(hri /( f uut6 tBt l-V r?ut c ,/6(z S" /fWr-r.-.--.eOo 4 000 ce,/A./ct'/u2r, Ii Z (tt v *n. ztl ly M CK6r-C 0 I 9.A.3.e Packet Pg. 812 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) -J-in- \ &us re- lfo LA a ,4' 9.A.3.e Packet Pg. 813 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTi Sent: To: Cc: From:Mike Abercrombie < mikes162@icloud.com > Tuesday, October 27, 2020 11i25 AM FinnTimothy FialaDonna; SolisAndy; Burt.Saunders@colliercounty.gov; TaylorPenny; McDanielBill Richdale Recycling EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. We are opposed to the proposed location off US 41 for Richdale Recycling. Surely there are more appropriate locations for an industrial type operation like this with all the noise, smell, smoke and potential environmental issues. Mike and Joa nna Abercrombie Subject: 1 9.A.3.e Packet Pg. 814 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy Flom: Sent: To: Subject: steve t < shthanos@gmail.com > Tuesday, October 27, ?020 1:31 PM FinnTimothy We strictly oppose trash burning and agricultural waste next to our Marco lsland EXTERNAL EMAILi This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. We oppose the Air Curtain Incinerator burning agricultural waste just down from the Goodland Bridge. It impacts our waterways from Mountains ofdecomposing plant materialcarried to our canals from the annual sheet flow that covers Picayune Strand and Collier Seminole? It would greatly add to the source ofNitrogen and Phosphorous that is destroying our waters. Think about industrial concrete crushing iust down the road, then imagine ifthe asbestos lined water pipes ofyears past end up there. 1 9.A.3.e Packet Pg. 815 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: steve t <shthanos@g mail.com > Tuesday, October 27, 2020 1:34 PM FialaDonna; SolisAndy; SaundersBurt; TaylorPenny; McDanielBill; FinnTimothy We oppose the Air Curtain Incinerator burning agricultural wastejust down from the Goodland Bridge. EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. It impacts our waterways from Mountains ofdecomposing plant material carried to our canals from the annual sheet flow that covers PicaFne Strand and Collier Seminole? Itwould greatly add to the source ofNitrogen and Phosphorous that is deshoying ourwaters. Think about industrial concrete crushing just down the road, then imagine ifthe asbestos Iined water pipes ofyears past end up there. 1 9.A.3.e Packet Pg. 816 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Cc: Subject: Edmund Hartnett < ephartnett@aol.com> Tuesday, October 27, 2020 1:59 PM FinnTimothy FialaDonna; SolisAndy; SaundersBurt; TaylorPenny; McDanielBill Opposition to the proposed new recycling plant EXTERNAL EMAIL; This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Mr. Finn, I do not normally write letters to public officials but this issue requires me to make an exception. Our home is at 3990 Deer Crossing Court in Fiddlers Creek in Naples. l'm writing to you and the other members of the Planning Board to voice my concerns and my opposition to the proposed privately owned recycling plant on US 41 near Collier Seminole State Park. While I don't pretend to be an environmental expert, I firmly believe that this type of facility will have a negative impact on our air and water quality. Not to mention the fact that these plants usually spew foul smelling odors for miles depending on the wind direction. The processing of crushed concrete, agricultural products and other possibly toxic materials is a messy and smelly business. Frankly, we don't need it near our homes, schools and waterways. Especially for a private firm they will be hauling this stuff into our area from miles away. We don't need trucks carrying crushed concrete and other possibly toxic materials on the roadways in our neighborhood. And I'm sure this project will cause harm to the animals, fish and plant life in the surrounding area. l, along with many of my neighbors, urge you NOT to approve this project. Bad air quality, toxic ground water, foul smells, damage to plants and wildlife and potential illnesses for current and future residents (especially children) are not worth whatever financial gains the County may derive from this company via taxes. Thank you for your consideration Edmund Hartnett Edmund Hartnett NYPD Deputy Chief (retired) Former Police Commissioner Yonkers NY 1 9.A.3.e Packet Pg. 817 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) Collier Co. Plonnirg Dept. Attn: Timothy Sinn 280O N Horseshoe Drive Nqples, Fl 34104 October ,20,ZQZQ RE: Richdole Recycling Conditionol Use 11685 Ri99s Rood, Noplas. Fl 34114 Pelition l.lo. PL-20190OO2105 Conditionol Use Zoning: Mv 5,202O Deqr iAr. Sinn: f orn writing rhis letter lo express ny strong opposition to the rezoning from on Agriculiurol / Residentiol A-RSI UO to o ,ilonufocluring or Industrial Zow, ol the Richdole Recycling located on 11685 Riggs Rood Mples 34114. Firsl of oll, cs o resident ond properi/ orner on Riggs Rmd. ft corne os quite o shock. Thst we hove never been mtified by orryone fron lhe Collier County 6rcrth l amgement Deportment ond hod to heor of this proposol by word of mouth from our neighbors on Riggs Rood. tly primory concern is the pollution this rould creqte. 1) Misc Pollutim from the mochines ond trucks to be used for roste ond concrete. This is o guite deod-end street. Our slreel bocks up to the Links 6olf Course on one side and 5ix Ls Farm Rood on the other. 2) EnyiFonncntol Pollutior. Riggs Rood is sumounded by State lond: Picoyurc Strond Stcle Pork, Collier Seminql Stole Pork, ond the Ten Thousond Islond lrlotionol Wildlife Refuge. How con this even be considered for this locotion? 3) Air Pollutior. from tllulching / Dumpirg of debris to the crushirg of concrcte., thot muld crcqte dust thqt hos been proven to be Corcimgenic ond lethql to all living things. You heor on the news qll the tirne hoy the WtlA tlulch in Ft. l yers is constont[ bottliry fires. This crea hos beoutiful lorge housirts developm€nts. l.le* lorge businesses ore moving to this oreo, every dcy. Why would onyone toke o charrce by ollo*irB this areo to be rezoned ond cousing domoge lo o g?ot*irg orert? Finolly, I rnoved to Noples becouse of its noture be.ty, uell- plonrcd zoning, and resVut lor lhe environmenl. ft is very importont for ALL residence for it to be kept lhal woy. I urge you to derry the proposed rezoning in tha hope thot they would discontine their goolof turning this into on industriol oreo qnd from recent meetings ond discussions with my neighbors. I kno* my opinions ore shored by mory. 0*'1r* -,\o-' Ccto\'"o Noto \ \SB\Q^13s P"c-A No1to.,trt 3qt\q Yours very Truly, 9.A.3.e Packet Pg. 818 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) October 29,2020 To: County Commissioners Subject: Richdale Recycling Petition - PL 20190002105 Commissioners: Is there a plan for public information to be available on this project before approval, covering the following items: Is there a business plan for the project? Does Collier County Govemment find a need for this project? Has an Environmental Impact Study been presented to Collier County? Fredric S. Jakes 146 Peach Court, Marco Island 1 2 3 Respectfully, 9.A.3.e Packet Pg. 819 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: Liz Reitz < liz_reitz@yahoo.com > Thursday, October 29, 2020 3:01 PM FinnTimothy Horticulture Recycling Plant EXTERNAL EMAIL; This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Mr Timothy Finn Principal Planner Collier County-Growth Management Department Dear Mr. Finn, As the owner of two properties on Sunnygrove Avenue and Tomato Road in the 6L's area of Naples, I vehemently oppose any change to the current zoning at Riggs Road and Route 41. The proposed enterprise is incompatible with the growing residential nature of this area. In addition, having another heavily commercial business at this location will make a dangerous traffic situation even worse. As you know, 4l is just two lanes in this area along with a very precarious "suicide" tuming lane. With the addition of the new homes being built by DR Horton at Royal Palm and at the old Gargiulo tomato farm further up the road, traffic will only become more dangerous. This part of 41 is simply not built for more heavy truck traffic. In addition to health and safety of our resident, this proposed business is potentially very dangerous for our water system. Run off from the site will easily make it's way to the Marco Island waterways spelling disaster for our fish and abundant wildlife. It is also important to note that Auto Ranch, Lake Park and 6L's is home to many of Collier County's most economically disadvantaged residents, many of whom do not have a voice when it comes to civic matters such as this. It seems another heavy industry being forced on these residents is completely unfair, and yet another way the County is taking advantage of those who are poor. Our zoning is agriculture for a reason. We want to keep our environment as clean and beautiful as we can, while assuring a peaceful place to live for all of our citizens. Sincerely, 1 9.A.3.e Packet Pg. 820 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) LizReitz Marco Island & Naples FL 781.91s.45 l5 2 9.A.3.e Packet Pg. 821 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: Liz Reitz < liz_reitz@yahoo.com > Thursday, October 29, 2020 3:02 PM FinnTimothy Horticulture Reryle Plant at Riggs Road EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicklng links. Mr Timothy Finn Principal Planner Collier County-Growth Management Department As a longtime resident of Royal Hammock Boulevard in the 6L's area of Naples, I vehemently oppose any change to the current zoning at Riggs Road and Route 41. The proposed enterprise is incompatible with the growing residential nature of this area. In addition, having another heavily commercial business at this location will make a dangerous traffic situation even worse. As you know, 41 is just two lanes in this area along with a very precarious "suicide" turning lane. With the addition of the new homes being built by DR Horton at Royal Palm and at the old Gargiulo tomato farm further up the road, traffic will only become more dangerous. In addition to health and safety of our resident, this proposed business is potentially very dangerous for our water system. Run off from the site will easily make it's way to the Marco Island waterways spelling disaster for our fish and abundant wildlife. It is also important to note that Auto Ranch, Lake Park and 6L's is home to many of Collier County's most economically disadvantaged residents, many who do not have a voice when it comes to civic matters such as this. Our zoning is agriculture for a reason. We want to keep our environment as clean and beautiful as we can, while assuring a peaceful place to live for all of our citizens. Sincerely, Mrs. Patricia Lloyd Dear Mr. Finn, 1 9.A.3.e Packet Pg. 822 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) 18595 Royal Hammock Boulevard Naples FL 2 9.A.3.e Packet Pg. 823 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: sanjoe2258@aol.com Thursday, October 29, 2020 5:59 pM FialaDonna; SaundersBurt; TaylorPenny; McDanielBill; FinnTimothy Richdale Recycling Conditional Use/ Petition # 20190002105/ Mulching Facility EXTERNAT EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. From Sandy Germain 18013 Greenwood Dr. Naples,Fl Royal Palm Golf Estates Santeach@aol.com 706-273-6221 Re: Mulching Facility Petition I am writing to you in opposition to the proposed expansion of the Richdale Mulching Facility located on Riggs Rd/Rt 41 . This facility is located directly across 41 from Royal Palm Golf Estates. Richdale is proposing to expand its capacity and to be able to be a concrete crusher and asphalt burner. Both of these activities pose an environmental threat as well as a medical threat to residents. lt also will lower property values. We all witnessed the horrendous problems created by the mulching facility fires in Ft. Myers over the past few years. Richdale has a history of code violations. -This facility is located in a residential and agricultural area. lt sides directly next to Lipman Farms and Research Facility -lt is located 2 miles from Manatee Elementary School and Manatee Middle School -lt is 1 mile from Collier Seminole State Park and nearby 10,000 lslands Preserve and Big Cypress -Eagle Lakes Golf Course is directly across 41. lt is a public course and attracts thousands of tourists -The Links of Naples Golf Course is 1/4 mile west. lt is also a public course and attracts thousands of tourists -Approximately 1500 new homes are being built in the new Esplanade community, Manatee Cove, and Royal Palm GE communities -Riggs Rd is a residential neighborhood as is the Auto Ranch Rd neighborhood, across 41. -Unlike most of 4'1 which is 6 lanes wide, this sectron of 4'l is only 2 lanes wide. This facility and the added truck traffic poses a tremendous safety issue. There is not a weslbound right turning lane. -This road is a major entryway to Naples from the East. This is the reason Donna Fiala chose 951/41 intersection to display the public art La Donna. This facility is not a good impression for visitors. This location is not lhe appropriate place for this facility. Please take these into consideration and deny the petition. Thank you, Sandy Germain 1 9.A.3.e Packet Pg. 824 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Cc: Subject: EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Mr. Fin n, We recently learned about the privately owned material recycling plant that is proposed for US41 adjoining Collier Seminole State Park. We have been coming to Marco lsland for over six years and are now Florida residents. We reside in Vintage Bay on San Marco Road which we chose because of the amazing location overlooking the bay. We chose Marco because of its proximity to the wonderful nature opportunities close to the island. We frequent allthe hiking trails in the Everglades and participate in several activities hosted by Collier Seminole State Park. The wildlife is abundant in this area and we believe it will be negatively impacted by the building of this recycling plant. The short- and long-term effects to the air and water q ua lity from this plant will be devastating! There are already concerns about the quality of Florida water and this recycling plant will further harm this valuable resource. We urge you to please vote against this proposed recycling plant! lf you value the natural resources in this area, we believe you will not allow this plant to be built in the proposed area. Thank you for your consideration ! Frank & Debra DeAngelo fdeangels@hotmail.com 440-657-0912 1 Debra Frank DeAngelo < fdeangels@hotmail.com > Friday, October 30, 2020 8:45 AM FinnTimothy donnafiala@colliercountyfl.gov; SolisAndy; SaundersBurt; Taylorpenny; McDanielBill Proposed Material Recycling Plant 9.A.3.e Packet Pg. 825 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) October 29, 2020 Mr. Timothy Finn Collier County, FL RE: Opposition to Variance for Proposed Communication Tower Adversely lmpacting property located at 380 Frangipani Avenue, Naples, FI Dear Mr. Finn This letter summarizes my vehement opposition to an unneeded and dangerous communication tower suddenly being proposed adjacent to land that I have co owned since 1971. 1. This unsightly tower, if approved, will without question substantially reduce the income from a currently existing and rapidly expanding Airbnb and Florida Statutes Chapter 570.85 agritourism project on my land which is directly adjacent to the proposed tower. Revenue reductions are estimated to be S40,000 to 550,000 annually, which would probably force us out of business. My qualifications for estimating the extreme detrimental impact on our business is based on my extensive experience in the hospitality business which included nearly 20 years as Sr Vice President Development for Doubletree Hotels, Embassy Suites Hotels and Homewood Suites Hotels where I is was responsible for the growth and development of these well known and successful brands. I also was Sr. Vice President of Real Estate for Hilton Hotels responsible for their owned hotels valued at nearly $7 Billion and was formerly a CpA in the State of Florida. 2. The tower violates the letter and spirit of the Rural Fringe overlay designed to protect natural areas such as ours and to encourage the development of innovative small villages or centers. 3. New technology, including cluster satellites and 5G is either available, or soon will be, making these towers obsolete and a blight for no reason. Evidence that local emergency units or personnel require this tower is sorely lacking. 4. An even taller older tower already stands about 3 miles to the southeast which may well provide the usage sought. 5. Having a second tower, planned for within 2000 feet of the proposed tower would, if built, essentially kill our existing and planned business. 6. A tower collapse during a hurricane or otherwise could cause serious and even fatal damage, because of the proximity to residential dwellings. The applicant's own proposal states that the tower is only designed to withstand up to 150 MPH winds. Winds higher than this have already occurred and seem to be increasing due to climate change. 7. The tower landowners are not the ones seeking to build, but rather lessees who had no prior "need" to build HERE; whatever hardship they may claim for a variance is clearly self-imposed. 9.A.3.e Packet Pg. 826 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) 8. There are numerous land tracts around, including government owned land, available without disturbing our quiet, serene neighborhood. The proposed tower is unsightly and completely out of character for the neighborhood. 9. Violation of existing uses including existing easements for cattle and Code violations ((ec.5.05.09(7Xb)) are ignored. 10. This very tall and intrusive tower is well positioned to provide visual and other means of surveillance, which only a decade ago or so would have been highly opposed, but today must be considered as possible governance overreach. 11. White strobe lights required by code would be constantly flashing throughout the night disturbing previous serenity. This visual impairment is not found in "normal" neighborhoods. 12. Migrating and other birds, fauna and protected species may well be adversely affected. Mosquito control in our neighborhood would either vanish or require ground spraying since low flying planes could not come near our property. 13. There was little or no notification to our neighborhood or a real opportunity to be heard. I sincerely appreciate your attention to this important matter and the time you take to serve all Collier residents. Sincerely, ilt David A Sherf 8550 N Canta Bello Paradise Valley, AZ 85253 q 9.A.3.e Packet Pg. 827 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Gloria Uhl < gluhl@comcast.net> Saturday, October 31, 2020 1:07 PM FinnTimothy PlantSubject: EXTERNAL EMAIL: Please Tim no concrete plants near the Everglades or the back entrance to Marco lsland not a healthy idea don't let it happen Sent from Gloria iPhone 1 email is from an external source. Confirm this is a trusted sender and use extreme caution attachments or cl 9.A.3.e Packet Pg. 828 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: Joe White <jwhite@pakriteinc.com> Saturday, October 31, 2020 2:.41 PM FinnTimothy Concrete plant EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Mr. Finn, As a longtime resident of Marco lsland I would like to voice my opposition to the proposed recycling plant proposed for US41 / san Marco Road. This would be a detriment to this area for many reasons. Sincerely, Joe White Pakrite lncorporated 5050 Carey Drive Valley View, Ohio 44125 Office: 215-524-5012 Cell: 276-402-6572 E Mail: Jwhite@pa riteinc.com Web: http://www.pakriteinc.com 1 9.A.3.e Packet Pg. 829 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: €c: Subject: Donna Kittle <donnakittleonmarco@gmail.com> Sunday, Novembet 1,2020 3:22 PM FinnTimothy FialaDonna; SolisAndy; SaundersBurt; penny.saunders@colliercountyfl.gov; McDanielBill Objection To the Material Recycling Plant on US 41 by Collier Seminole State ParklRiggs Rd. Naples, FL EXTERNAL EMAILi This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Dear Tim, Donna, Andy, Burt, Penny and Bill, We are sending this e-mail OBJECTING to your Proposed Material Recycling Plant ln Naples, FL on Rte. 41 adjoining Seminole State Park and Riggs Rd. We have owned on Marco lsland, FL for over 30 years and consider that area of Collier County one of the Best Locations for Air and Water Quality in the USA. An lncinerator at this Proposed Site would be A DETRIMENT to the Health, Environment, Natural Resources (both Land and Wate4, Lifestyle, and Property lnvestment that we Value as full time residents on Marco lsland, FL for not only My Husband and I but also our Children and Grand Children and generations to come. There is plenty of land far away from residential areas and natural waterways to erect this proposed Material Recycling Plant. Why would you jeopardize the Well-Being of Residents and Tourists, not to mention the wildlife and plant life in this Prime Area Of Collier County, FL? Please present this OBJECTION to the Planning Board at the Nov. 5, 2020 hearing. We are tax payers AND CONCERNED CITIZENS of Collier County, FL who deserve to be 'listened to'! Sincerely, Donna Kittle and Bruce Kittle 269 Vintage Bay Drive Unit 27 Marco lsland, FL 34145 1 9.A.3.e Packet Pg. 830 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimot From: Sent: To: Subject: Leah Harker < leahharker@email.com > Monday, November 2, 2020 2:08 PM FinnTimothy; donnafiala@colliercountyfl.gov; SolisAndy; SaundersBurt; Taylorpenny; McDanielBill Proposed Material Recycling Plant EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Hello Mr. Finn, We recently learned about the privately owned material recycling plant that is proposed for US41 adjoining Collier Seminole State Park. we have been coming to Marco Island for over sixteen years and have lived on Marco island full time for over four years and are Florida residents. We reside in Vintage Bay off of San Marco Road which we chose because of the amazing location overlooking the bay. We chose Marco Island because of its proximity to the wonderful nature opportunites close to the island. The wildlife is abundant in this area and we believe it will be negatively impacted by the building of this recycling plant. The short and long term effects to the air and water quality from this plant will be devastating! There are already concerns about the quality of Florida water and this recycling plant will further harm this valuable resource. We urge you to please vote against this proposed recycling plant! If you value the natural resources in this area, we believe you will not allow this plant to be built in the proposed area. Thank you for your consideration, Frederick A & Leah A Harker Leah and Al Harker 201 Vintage Bay Drive B-31 Marco Island, Florida 34145 574-808-9005 leahharker@email.com 1 9.A.3.e Packet Pg. 831 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: Rob < retrsr@aol.com > Tuesday, November 3, 2020 8:38 PM FinnTimothy Fwd: Riggs Rd. Recycling Plant EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Subiect: Riggs Rd, Recycling Plant Good Evening Mister Finn, l'm writing to express my concern about a proposed recycling plant that might be built on Riggs Rd and US41. As a resident of the area since 2000 I have seen positive changes in East Naples recently on 41 east and west of Collier Blvd. New stores, new roads, schools and single family homes in beautiful new communities. More and more people are moving here every day and just miSht pass us by rather than buy a home near an industrial area with polluting potential of the air we breathe and the water we drink. Thank you for listening and let's keep moving forward in a positive direction for the residents. Rob and Maureen Roberts 14409 Neptune Ave. Naples FL. 34114 PH#23957 7051,2 1 9.A.3.e Packet Pg. 832 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) November 4, 2020 To: Timothy Finn, Donna Fiala, Andy Solis, Burt Saunders, Penny Taylor, Bill McDaniel From: Martha lnglis Spence, Harry B. Spence Resardi ng: Pro posed Recycling Plant by RichDale Recycling I am a native Floridian whose family has owned property in Goodland for the past 50 years. I am currently living in the area fulltime. Over the past ten years I have witnessed the encroachment of multiple developments on East 41 which have adversely affected the natural environment. Developers have systematically removed allthe native trees and brush from hundreds of acres driving native wildlife from their habitats and forever changing the ecosystem of this area. As these developers have created their "fake" Florida developments they have also altered the natural flow of water in this area. Recently it can be noticed that the new Esplanade development has essentially created a new canal in front of their property. The only state park in this area is being threatened by these disruptions and if it is not stopped will not be sustainable as a recreational area for long. The Big Cypress Preserve is adjacent to this area and hopefully will be the major protection against further expansion of developments on East 41. Of note there are still some agricultural areas along East 4L where farmers and farm workers have also been negatively impacted by development. Recently I have become aware of the proposed Recycling plant to be built at the intersection of Riggs Road and Highway 41 East in Collier County. Richdale recycling is a for profit business that would process crushed concrete and agricultural products for much of Collier county. This is unbelievable that anyone who is a lover of Florida could not see the impact this would have in our area. Just look at the areas north of us where the runoff of agriculture byproducts has ruined the rivers and waterways. When agriculture products are "recycled" where will the byproducts be deposited? Will the waterways adjacent to the areas be flooded with fertilizer byproducts and other contaminants toxic to the fish and wildlife? Will the fumes from the crushing and destruction of concrete coat the plants and trees in the area? Will the humans in the area inhale these micro particles containing who knows what? And what exactly is in concrete? Will other products used with concrete manufacture seep into the concrete to be recycled - glass, plastic, marble, coal combustion byproducts ... I realize that recycled concrete can sometimes be reused and can be safe but "the cement industry is one of the main producers of carbon dioxide, a potent greenhouse gas. Concrete causes damage to the most fertile layer of the earth, the topsoil." Recyling of concrete and agriculture products may be a good idea and a necessity but not in the fragile environment we are trying to protect in what remains of "real" Florida. lt sounds like this type of business needs to be operating in a remote area where the environmental threat would not be so profound. Other types of waste are actually transported to areas which have been identified as having low impact on the environment, wildlife and humans. We urge you to vote NO to the proposal to build this recycling plant in Collier County. We need to investigate other options to recycle our waste with minimal impact on the environment. Martha lnglis Spence - 502 Coconut Avenue Goodland, Florida 34140 Harry B. Spence - 502 Coconut Avenue Goodland, Floria 34140 9.A.3.e Packet Pg. 833 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: soundorthosolutions@yahoo.com Wednesday, November 4, 2020 1:05 PM FinnTimothy recycle plant. EXTE R NAL EMA L: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Dear Mr. Finn, I am only a winter resident on Marco, however it doesn't take a genius to figure out that the development at the intersection of4l and San Marco rd. is not good. I'm sure that you are tired ofhearing this but I thought that the following taken fiom social Media sums it up pretty much. "lmagine an Air Curtain lncinerator burning agricultural waste just down from the Goodland Bridge. Think about the impacts to our waterways from mountains of decomposing plant material carried to our canals from the annual sheet flow that covers Picayune Strand and Collier Seminole? We wonder where the source of Nitrogen and Phosphorous that is destroying our waters? Look no further. Think about industrial concrete crushing just down the road, then imagine if the asbestos-lined water pipes of years past end up there. This is such a bad idea on so many fronts, I could not help but seek the support of all of you in making sure this never comes to fruition." I ask that you please consider another location away from waterways that affect all of us surrounding this project. Sincerely, J. Scott Fitzgerald 1 9.A.3.e Packet Pg. 834 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: Patricia Wickrowski < pwickrowski@gmail.com > Wednesday, November4,2020 l:l I PM FinnTimothy Recycling plant proposal EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Mr. Finn, I am writing to voice my opposition to the material recycling plant proposed on US 41 adjacent to Collier State park on Riggs Road. This proposal will have a negative impact on Goodland, Marco lsland Academy, the surrounding condominiums and homes in that area as well as visitors to the state park. Why would you subject our children, waterways and air quality in this area? Surely there is another area away from where people live, children go to school and visitors come to explore our fine state park. What of our environment that we work constantly to be safe and clean? Please reconsider your proposal. No one wants this in their back yard. Patricia R. Wickrowski 337 Vintage Bay Drive Marco lsland, FL 34145 Sent from my iPad 1 9.A.3.e Packet Pg. 835 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: Bill Ro.he <dbroche3T@gmaii.com> Wednesday, November 4,2020 2:22 PM FinnTimothy Recycling Plant EXTERNAL EMA t This email i5 from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. November 4, 2020 To all officials involved in the vote concerning the recycling plant, l, Bill Roche, and my wife, Doris, who reside full-time at 269 Vintage Bay Drive, are definitely and strongly opposed to the building of the material recycling plant proposed on U.S. 41, adjacent to Collier State Park. We urge you to vote against this proposal. Sincerely yours, Bill and Doris Roche Sent from !!eil for Windows 10 1 9.A.3.e Packet Pg. 836 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: Nolberto Gillespie < bigsky1221@yahoo.com > Wednesday, November 4, 2020 4:28 PM FinnTimothy Proposed Recycling Plant EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking llnks. This is to let you know that we are against the opening of a waste recycling plant near where we live in the Vintage Bay condominium complex near Goodland. We feel that the air quality, the fragile estuary, the rivers and land preserved by our state park as well as the wildlife supported by this habitat and the overall well being of the pristine natural environment in our area will be negatively impacted by the operation of this plant. Please take steps to ensure that the plans for the recycling center do not move forward. Thank you, Concerned Citizens, Nolberto Gillespie and Karen Yuskaitis Sent from my iPhone 1 To all who can affect the outcome of the upcoming proposal concerning the recycling plant: 9.A.3.e Packet Pg. 837 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: aniciT4 <anici74@yahoo.com > Wednesday, November 4, 2020 6:31 PM FinnTimothy Opposition to the Proposed material recycling plant EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Dear sir, I own a condominium at 201 Vintage Bay Drive, unitTb. Marco lsland. I am writing to voice my opposition to the proposed material recycling plant on US41 adjacent to Collier State Park, which you are to consider at your meeting. My property is at the southeast end of Marco lsland and I feel that airborne emissions from the proposed plant would negatively impact the air quality in my home. ln addition the sediment in the water will disturb the delicate ecosystem of our protected mangrove habitat. Please help preserve the quality of our life here on Marco lsland by denying permission for the proposed plant. Sincerely Carl and Angela Pulford Sent from my iPad 1 9.A.3.e Packet Pg. 838 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) To: From: Sent: Warren Uhl <warren.uhl@gmail.com> Wednesday, November 4, 2020 7:41 PM FinnTimothy FialaDonna; SolisAndy; SaundersBurU TaylorPenny; McDanielBill rick@ricklocastro.com RE: Development @ 41 & San Marco Cc: Subject: EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Collier county, I want to voice my support for the recyclin8 facility discussed below by "chicken little". As the business is only as viable as the need for the services exists, I see it as transitory. Long term as that may be. Prevailing winds what they are Marco citizenry will we unaffected by the sighting. Eagle Lakes, yikesl Have no fear.... Warren Uhl Marco lsla nd Hello Vintage Bay neighbors This letter was on a Marco Island FaceBook page. You might like to write to the Principal Planner (Mr. Timothy Finn) voicing your opposition to the material recycling plant proposed on US4l adjacent to Collier State Park. You may also want to copy the county commissioners listed. This proposal will have a negative impact on the air and water quality in the area and more specifically on our condos. 1 FinnTimothy Kathie Madigan Volhr Corporation 1000 No. Collier Blvd. Unit #9 Marco Island, FL 34145 Phone (239) 389 - 3600 Fax (239) 394 - 4110 9.A.3.e Packet Pg. 839 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) The project will go before the Planning Board on November 5, so please send something as your letters/emails will be shared at that meeting. Dear Friends and Neighbors- I write this post to you in the hopes you will join me in a fight against what I feel would be a travesty to East Naples and Marco lsland on numerous fronts. A privately owned material recycling plant has been proposed for US 41, adjoining Collier Seminole State Park as Riggs Road. The facility, proposed by Richdale Recycling, would process crushed concrete and agriculture products for much of Collier County and operate as a privately owned for profit entity. Needless to say, the impacts of this project will be felt well beyond the other end of San Marco Road... lmagine an Air Curtain lncinerator burning agricultural waste just down from the Goodland Bridge. Think about the impacts to our waterways from mountains of decomposing plant material carried to our canals from the annual sheet flow that covers Picayune Strand and Collier Seminole? We wonder where the source of Nitrogen and Phosphorous that is destroying our waters? Look no further. Think about industrial concrete crushing just down the road, then imagine if the asbestos-lined water pipes of years past end up there. This is such a bad idea on so many fronts, I could not help but seek the support of all of you in making sure this never comes to fruition. The project will go before the Planning Board for Collier County on November 5th. Petition PL 20190002105 You can join via Zoom and even register to speak during public comment. Also, please consider taking the time to write to the Principal Planner on the project, Mr. Timothy Finn to voice your opposition to the project. Any public feedback letters will be forwarded to the Planning Commission. Also, feel free to copy our county commissioners! Andy.Solis@colliercountyfl . gov 2 timothv.finn@colliercountyfl.oov Don na. Fiala@colliercountyfl. qov Burt.Saunders@colliercountyfl.qov Pen nv.Tavlor@colliercountvfl .qov Bil l. McDaniel@col liercountyfl.qov 9.A.3.e Packet Pg. 840 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) Sent from my iPhone 3 9.A.3.e Packet Pg. 841 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: Betsy Wohltman < prek4me@yahoo.com > Wednesday, November 4, 2020 7:48 PM FinnTimothy; FialaDonna; SolisAndy; SaundersBurt; Taylorpenny; McDanielBill Marco lsland's waters need to be protected EXTERNAL EMAIL This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Petition PL 20190002105 will do irrevocable damage to the beautiful Marco lsland waters. WHY in Heaven's name would you even consider creating this danger for the citizens of Marco lsland??? Wasn't the RED TIDE enough damage to our waters, our tourist trade income, and our sports fishing problems? You still haven't fixed the problems from Lake O or the damage to the San Marco Road/Goodlands foliage damage. "Come on, Guys" and Gals. Really? You have the nerve to seriously consider this action?? Thank you for your prompt attention to my request to vote against this project. Betsy Wohltman 1 9.A.3.e Packet Pg. 842 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: Susan BARKER < susan@marcoreef.com > Thursday, November 5, 2020 6:48 AM FinnTimothy proposed material recycling plant EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when openinB attachments or clicking links. Dear Mr. Finn We recently learned about the privately owned material recycling plant that is proposed for US41 adjoining Collier Seminole State Park. We have lived in Vintage Bay on San Marco Road for many years and saddened to hear about the proposal of the recycling plant. We chose Marco because of its proximity to the wonderful nature opportunities close to the island. We frequent allthe hiking trails in the Everglades and participate in several activities hosted by Collier Seminole State Park. The wildlife is abundant in this area and we believe it will be negatively impacted by the building of this recycling plant. The short- and long-term effects to the air and water quality from this pla nt will be devastatingl Thereare already concerns about the quality of Florida water and this recycling plant will further harm this valuable resource. We urge you to please vote against this proposed recycling plant! lf you value the natural resources in this area, we believe you will not allow this plant to be built in the proposed area. Thank you for your consideration ! Susan and Mike Barker 1 9.A.3.e Packet Pg. 843 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimothy From: Sent: To: Subject: Nolberto Gillespie < bigsky1221@yahoo.com > Thursday, November 5, 2020 9:17 AM FinnTimothy Fwd: Proposed waste recycling plant EXTERNAL EMAIL: This email is from an external source. confirm this is a trusted sender and use extreme ciution when opening attachments or clicking links. Sent from my iPhone Begin forwarded message: From: Nolberto Gillespie <bigsky1221@yahoo.com> Date: November 5, 2020 at 8:50:40 AM EST To: FialaDonna <Donna.Fiala@colliercountyfl.gov> Cc: HodgsonKari <Kari.Hodgson@colliercountyfl.gov> Subiect: Re: Proposed waste recycling plant Thank you for your response. To clarify, yes,l am referring to the plant proposed by Ridgedale recycling that would be located off of US 41 near collier Seminole Park, Riggs Road. My understanding is that it was up for discussion today by the Collier county planning board. Please note that we stand in opposition to this plant opening in our vicinity. Thank you, Nolberto Gillespie and Karen Yuskaitis Sent from my iPhone On Nov 4, 2020, at 9:29 PM, FialaDonna <Donna. Fiala@colliercou ntyfl.BoV> wrote: WE are not even close to a location yet. We are investigating all possibilities. I have copied our solid waste director so she will know of your concern, and l'm sure she will reply to you directly. We went on a tour of 2 recycle plants in Collier County, and learned so much. You might want to take a ride out to Marco lsland to see one for your self. lt's less than an acre, and does not accept any garbage at all. They also do not accept horticultural waste except on Marco lsland, and then it is only a bare minimum. We took another lady out there, and she was very surprised. I am guessing she thought as you did, that it was more of a garbage dump than a clean, drop off center for fluorescent bulbs, batteries, empty paint cans, oil, grease cans, and electronics. I'm sure Kari will respond to you tomorrow. 1 Donna Fiala 9.A.3.e Packet Pg. 844 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) Donna Fiala Collier County Commissioner, District 1 3299 TamiamiTrail East, Suite #303 Naples, FL 34112 P: (239) 2s2-8601 F: (239) 252-5s78 I am not home accepting the things I cannot change, I am out changing the things I can not accept. From: Nolberto Gillespie <bigsky1221@yahoo.com> Sent: Wednesday, November 4, 2O2O 4:29 PM To: FialaDonna Subject: Proposed waste recycling plant EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. To all who can affect the outcome of the upcoming proposal concerning the recycling plant: This is to let you know that we are against the opening of a waste recycling plant near where we live in the Vintage Bay condominium complex near Goodland. We feel that the air quality, the fragile estuary, the rivers and land preserved by our state park as well as the wildlife supported by this habitat and the overall well being of the pristine natural environment in our area will be negatively impacted by the operation of this plant. Please take steps to ensure that the plans for the recycling center do not move forwa rd. Thank you, Concerned Citizens, Nolberto Gillespie and Karen Yuskaitis Sent from my iPhone Under Florida Law, e-mail addresses are public records. lf you do not want your e-mail address released in response to a public records request, do not send electronic mail to this entity. lnstead, contact this office by telephone or in writing. 2 9.A.3.e Packet Pg. 845 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) FinnTimoth From: Sent: To: Cc: Subject: susan caglioti <suecag lioti@gmail.com > Friday, November 6, 2020 12:43 PM Fin nTimothy TaylorPenny; SaundersBurt; McDanielBill; SolisAndy Riggs Road mulching facility EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. We live in the Royal Palm Golf Estates and we have many many concerns/objections regarding the proposed Riggs Road mulching facility. The list of problems with having such a facility in close proximity to a neighborhood are many. 1. Mulching facilities, incinerators, no matter how advanced, release harmful pollutants posing risks to human health. They pollute air, water and soil. ln addition to the incineration pollutants, the piles of debris alone can release harmfulgases into the air and give off potent odors that no one should have to breathe in from their backyards. 2. There will be noise pollution, not only from the plant's activities but from the large trucks coming and going from this facility. 3. The traffic will be adversely affected as well by these vehicles. 4. Such plants also raise the risk of spontaneous fires. 5. Aside from the above health and safety issues, this facility will have a negative impact on the value of our homes. ln short, this plant should not be allowed to operate so close to homes producing such unhealthy, unsafe and financial losses for the many many residents who live in the nearby neighborhoods. Thank you, Susan Caglioti and John Erario Please don't allow the Riggs Road facility to be approved. lt will definitely hurt the quality of our lives. The worry of being exposed to disease causing pollutants among other safety concerns 24 hours a day where one lives is frightening. 1 9.A.3.e Packet Pg. 846 Attachment: Attachment D - Opposition Letters (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 847Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 848Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 849Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 850Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 851Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 852Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 853Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 854Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 855Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 856Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 857Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 858Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 859Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 860Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.f Packet Pg. 861 Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling 9.A.3.f Packet Pg. 862 Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling 9.A.3.fPacket Pg. 863Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 864Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 865Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 866Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 867Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 868Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 869Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 870Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 871Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 872Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 873Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 874Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 875Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 876Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 877Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 878Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 879Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 880Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 881Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 882Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 883Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 884Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 885Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 886Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 887Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 888Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 889Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 890Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 891Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.f Packet Pg. 892 Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling 9.A.3.f Packet Pg. 893 Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling 9.A.3.fPacket Pg. 894Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.f Packet Pg. 895 Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling 9.A.3.fPacket Pg. 896Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 897Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 898Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 899Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.f Packet Pg. 900 Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling 9.A.3.fPacket Pg. 901Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 902Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 903Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.f Packet Pg. 904 Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling 9.A.3.fPacket Pg. 905Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.f Packet Pg. 906 Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling 9.A.3.f Packet Pg. 907 Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling 9.A.3.fPacket Pg. 908Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 909Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 910Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 911Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 912Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 913Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 914Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 915Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 916Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 917Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.f Packet Pg. 918 Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling 9.A.3.fPacket Pg. 919Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 920Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 921Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 922Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 923Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 924Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 925Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 926Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.f Packet Pg. 927 Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling 9.A.3.f Packet Pg. 928 Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling 9.A.3.fPacket Pg. 929Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 930Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 931Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.fPacket Pg. 932Attachment: Attachment E - Application-Backup Materials (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.gPacket Pg. 933Attachment: Attachment F - Property Hearing Signs (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.g Packet Pg. 934 Attachment: Attachment F - Property Hearing Signs (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.g Packet Pg. 935 Attachment: Attachment F - Property Hearing Signs (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.h Packet Pg. 936 Attachment: Attachment G - Hybrid Meeting Waiver (13087 : PL20190002105 Richdale Recycling (CU)) 9.A.3.i Packet Pg. 937 Attachment: Attachment H - Revised Property Hearing Signs (13087 : PL20190002105 Richdale Recycling 9.A.3.i Packet Pg. 938 Attachment: Attachment H - Revised Property Hearing Signs (13087 : PL20190002105 Richdale Recycling 9.A.3.i Packet Pg. 939 Attachment: Attachment H - Revised Property Hearing Signs (13087 : PL20190002105 Richdale Recycling 11/19/2020 COLLIER COUNTY Collier County Planning Commission Item Number: 9.A.4 Item Summary: **Note: This item was continued from the November 5, 2020 CCPC meeting.*** PL20190000808 CU - A Resolution of the Board of Zoning Appeals of Collier County, Florida amending Resolution No. 03-332, which established a conditional use for earthmining, to expand the conditional use for earthmining pursuant to Section 2.03.01.A.1.c.1 of the Collier County Land Development Code by adding 231.73± acres and revising the conditions of approval for the property located in the Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO), for a total of 450.7± acres. The property is located on the west side of SR 29 North, south of SR 82 in the Immokalee Planning Area in Sections 18 And 19, Township 46 South Range 29 East, Collier County, Florida. [Coordinator: Timothy Finn, AICP, Principal Planner] Meeting Date: 11/19/2020 Prepared by: Title: – Zoning Name: Tim Finn 11/05/2020 10:52 AM Submitted by: Title: Manager - Planning – Zoning Name: Ray Bellows 11/05/2020 10:52 AM Approved By: Review: Planning Commission Diane Lynch Review item Completed 11/06/2020 12:23 PM Growth Management Operations & Regulatory Management Donna Guitard Review Item Completed 11/09/2020 11:23 AM Zoning Ray Bellows Review Item Completed 11/09/2020 3:04 PM Growth Management Department James C French Review Item Completed 11/09/2020 5:59 PM Zoning Ray Bellows Review Item Completed 11/10/2020 4:16 PM Planning Commission Edwin Fryer Meeting Pending 11/19/2020 9:00 AM 9.A.4 Packet Pg. 940 CU-PL20190000808, EDWARDS GROVE ROAD MINE Revised Date: November 5, 2020 Page 1 of 11 STAFF REPORT TO: COLLIER COUNTY PLANNING COMMISSION FROM: ZONING DIVISION – ZONING SERVICES SECTION GROWTH MANAGEMENT DEPARTMENT HEARING DATE: NOVEMBER 19, 2020 SUBJECT: CU-PL20190000808; EDWARDS GROVE ROAD MINE ______________________________________________________________________________ PROPERTY OWNER/APPLICANT/AGENT: Owners: Nick Stewart, Manager Southwestern Properties, LLC 2875 Jupiter Park Dr, Suite 1100 Jupiter, FL 33458 James Paul Tippen Bay Properties, LLLP 5701 Ft. Denaud Road Labelle, FL 33975 Agents: Jessica Harrelson, AICP Richard D. Yovanovich, Esq. Davidson Engineering, Inc. Coleman, Yovanovich & 4365 Radio Road, Suite 201 Koester, P.A. Naples, FL 34104 4001 Tamiami Trail North, Suite 300 Naples, FL 34103 REQUESTED ACTION: To have the Collier County Planning Commission (CCPC) consider an application amending Resolution No. 03-332, which established a conditional use for earthmining, to expand the conditional use for earthmining pursuant to Section 2.03.01.A.1.c.1 of the Collier County Land Development Code by adding 231.73± acres and revising the conditions of approval for the property located in the Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO), for a total of 450.7± acres. 9.A.4.a Packet Pg. 941 Attachment: Staff Report - Edwards Grove Road Mine (13089 : PL20190000808 Edwards Grove Road Mine (CU)) CU-PL20190000808, EDWARDS GROVE ROAD MINE Revised Date: November 5, 2020 Page 2 of 11 GEOGRAPHIC LOCATION: The subject property is located on the west side of SR 29 North, south of SR 82 in the Immokalee Planning Area in Sections 18 And 19, Township 46 South Range 29 East, Collier County, Florida. (See location map on the following page) PURPOSE/DESCRIPTION OF PROJECT: The subject property consists of ± 450.7 acres, under multiple ownership who provided authorization via affidavit. The purpose of this Conditional Use (CU) application is to expand the existing mine conditional use to include property adjacent to the west. The intent of this Conditional Use request is to allow for the proposed expansion of an existing commercial excavation operation, as provided for in the Conditional Use provisions within the A-MHO- RSLAO District. The existing commercial excavation site currently operates as permitted by Resolution 03-332. Intentionally blank 9.A.4.a Packet Pg. 942 Attachment: Staff Report - Edwards Grove Road Mine (13089 : PL20190000808 Edwards Grove Road Mine (CU)) CU-PL20190000808, EDWARDS GROVE ROAD MINE Revised Date: November 5, 2020 Page 3 of 11 9.A.4.aPacket Pg. 943Attachment: Staff Report - Edwards Grove Road Mine (13089 : PL20190000808 Edwards Grove Road Mine CU-PL20190000808, EDWARDS GROVE ROAD MINE Revised Date: November 5, 2020 Page 4 of 11 9.A.4.aPacket Pg. 944Attachment: Staff Report - Edwards Grove Road Mine (13089 : PL20190000808 Edwards Grove Road Mine CU-PL20190000808, EDWARDS GROVE ROAD MINE Revised Date: November 5, 2020 Page 5 of 11 SURROUNDING LAND USE AND ZONING: This section of the staff report identifies the land uses and zoning classifications for properties surrounding the boundaries of the subject property, which is undeveloped and zoned Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO): North: Developed agricultural, with a current zoning designation of Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO) East: Developed mining excavation (Stewart Mining), with a current zoning designation of Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO) then further east is developed sparse residential/undeveloped land with a current zoning designation of Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO) South: Developed agricultural, with a current zoning designation of Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO) West: Lamm Rd (local road), then developed as agricultural, with a current zoning designation of Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO) Aerial (Davidson Engineering) 9.A.4.a Packet Pg. 945 Attachment: Staff Report - Edwards Grove Road Mine (13089 : PL20190000808 Edwards Grove Road Mine (CU)) CU-PL20190000808, EDWARDS GROVE ROAD MINE Revised Date: November 5, 2020 Page 6 of 11 GROWTH MANAGEMENT PLAN (GMP) CONSISTENCY: Comprehensive Planning staff has reviewed this request and offered the following comments: Future Land Use Element (FLUE): The subject property is designated Agricultural/Rural and within the Rural Lands Stewardship Area Overlay (RLSAO) as shown on the Future Land Use Map (FLUM) and in the Future Land Use Element (FLUE) of the Growth Management Plan (GMP). On the Stewardship Overlay Map, part of the FLUM series, the site is designated “Open.” Currently, the proposed additional acreage is mostly citrus groves and zoned A, Rural Agricultural Zoning District, within a Mobile Home Overlay (MHO), and within Rural Lands Stewardship Area Overlay (RLSAO). The “A” zoning district allows a conditional use for an extraction or earth mining use (CU #1), as listed in the Land Development Code (LDC) Chapter 2.03.01 A.1.c.1. This CU is an expansion encompassing ±218.97-acres of an existing earth mining operation for a total of approximately 450.7 acres. The FLUE states, in relevant part: “The Agricultural/Rural Land Use Designation is for those areas that are remote from the existing development pattern, lack public facilities and services, are environmentally sensitive or are in agricultural production. Urbanization is not promoted; therefore, most allowable land uses are of low intensity in an effort to maintain and promote the rural character of these lands.” The proposed earthmining, oil extraction, and related processing is listed as an allowable use in this designation in the FLUE. Based on the above analysis, staff finds the subject petition consistent with the Future Land Use Element of the Growth Management Plan. (See Attachment B) Transportation Element: The project is consistent with Policy 5.1 of the Transportation Element of the Growth Management Plan, which states, “The County Commission shall review all rezone petitions, SRA designation applications, conditional use petitions, and proposed amendments to the Future Land Use Element (FLUE) affecting the overall countywide density or intensity of permissible development, with consideration of their impact on the overall County transportation system, and shall not approve any petition or application that would directly access a deficient roadway segment as identified in the current AUIR or if it impacts an adjacent roadway segment that is deficient as identified in the current AUIR, or which significantly impacts a roadway segment or adjacent roadway segment that is currently operating and/or is projected to operate below an adopted Level of Service Standard within the five-year AUIR planning period unless specific mitigating stipulations are also approved. A petition or application has significant impacts if the traffic impact statement reveal s that any of the following occur: a. For links (roadway segments) directly accessed by the project where project traffic is equal to or exceeds 2% of the adopted LOS standard service volume; b. For links adjacent to links directly accessed by the project where project traffic is equal to or exceeds 2% of the adopted LOS standard service volume; and c. For all other links the project traffic is considered to be significant up to the point where it is equal to or exceeds 3% of the adopted LOS standard service volume. 9.A.4.a Packet Pg. 946 Attachment: Staff Report - Edwards Grove Road Mine (13089 : PL20190000808 Edwards Grove Road Mine (CU)) CU-PL20190000808, EDWARDS GROVE ROAD MINE Revised Date: November 5, 2020 Page 7 of 11 Mitigating stipulations shall be based upon a mitigation plan prepared by the applicant and submitted as part of the traffic impact statement that addresses the project’s significant impacts on all roadways.” According to the TIS provided with this petition dated December 3, 2019, the proposed Mining Operation will generate a projected total of +/- 49 PM peak hour, 2-way trips (consistent with the existing approved Conditional Use) on the adjacent roadway State Road 29 and State Road 82. According to the current 2019 AUIR, the road segment (link 86.0/County Road 29) State Road 29 to State Road 82 operates at a LOS of “D” with a remaining capacity of 214 trips (peak capacity service volume is 900). Additionally, the State Road 82 (link 88.0) State Road 29 to the Lee County Line, operates at a LOS of “E” with a remaining capacity of 1 trip (peak capacity service volume is 800). Staff notes that State Road 82, link 88.0, is a funded road improvement (fiscal year 2020) which upon completion is anticipated to increase capacity on this link. State statutes, specifically 163.3180, directs development to proceed when improvements are funded within the planning period. Therefore, the subject Conditional Use can be found consistent with Policy 5.1 of the Transportation Element of the Growth Management Plan, and as noted above the Traffic Impact Statement (TIS) indicates that the adjacent roadway network has sufficient capacity to accommodate this project within the 5-year planning period. Transportation Review: Transportation Division staff has reviewed the petition request, the CU document and Master Plan for right-of-way and access issues and is recommending approval. Stormwater Review: The proposed conditional use expansion request is not anticipated to create drainage problems or adverse impacts to surrounding properties in the area. Stormwater best management practices, treatment, and storage will be addressed through the environmental resource permitting process with the Florida Department of Environmental Protection (F.D.E.P.). Additionally, the same Best Management Practices, Erosion Control Measures, and Pollution Prevention Plan associated with the current permitted operation will continue to be used for the proposed expansion. The proposed mining will be subject to Chapter 62-330 Environmental Resource Permitting and mandatory reclamation requirements of F.D.E.P. Chapter 62C -39, Florida Administrative Code. Landscape Review: The Buffers labeled on the Master Concept Plan are consistent with the LDC. Environmental Review: Environmental Services staff has reviewed the conditional use petition to address environmental concerns. The property has been historically cleared for agricultural use and maintained clear of native vegetation. The Master Plan does not show a preserve, since no minimum preservation is required. The environmental data indicates the proposed project is in an area that has the potential to contain a variety of protected animal species. The listed species survey revealed three gopher tortoise (Gopherus polyphemus) burrows were observed on site. The burrows are located along the perimeter of the property (two burrows along the west and one burrow along the south). A gopher tortoise relocation permit will need to be obtained from the Florida Wildlife Conservation 9.A.4.a Packet Pg. 947 Attachment: Staff Report - Edwards Grove Road Mine (13089 : PL20190000808 Edwards Grove Road Mine (CU)) CU-PL20190000808, EDWARDS GROVE ROAD MINE Revised Date: November 5, 2020 Page 8 of 11 Commission (FWCC) prior to approval of the first development order. The subject property is located within core foraging ranges for three Wood stork (Mycteria americana) colonies. However, consultation with the US Fish and Wildlife Service (FWS) for mitigation is unlikely since the drainage ditches found onsite are not maintained and don’t appear to contain wood stork foraging habitat. The Environmental Data indicates the subject property falls within FWS Secondary Florida Panther (Felis concolor coryi) habitat. There were no observations of panther onsite and the telemetry data indicates Florida panther are not abundant within the boundary of the proposed project. The property does not contain habitats preferred by the Florida panther; therefore, consultation with FWS to obtain panther mitigation is unlikely. This project does not require Environmental Advisory Council (EAC) review, as this project did not meet the EAC scope of land development project reviews as identified in Section 2-1193 of the Collier County Codes of Laws and Ordinances. Environmental Planning staff recommends approval of the proposed petition. Conservation & Coastal Management Element (CCME): Environmental review staff has found this project to be consistent with the Conservation & Coastal Management Element (CCME). The project site is 450.70 acres and includes an existing mine operation and orange grove. STAFF ANALYSIS: When considering a Conditional Use petition, the CCPC must make findings that 1) approval of the Conditional Use will not adversely affect the public interest and will not adversely affect other property of uses in the same district of neighborhood; 2) all specific requirements for the individual Conditional Use will be met; and 3) satisfactory provisions have been made concerning the following matters, where applicable: 1. Section 2.03.01.A.1.c.1, of the LDC, permits conditional uses in the Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO). The requested use for an earthmining facility is allowed as conditional uses in the Agricultural (A) zoning district within the Mobile Home Overlay (MHO) and the Rural Lands Stewardship Area Overlay (RLSAO), subject to the standards and procedures established in section 10.08.00, conditional uses procedures, of the LDC. 2. Consistency with the Land Development Code (LDC) and the Growth Management Plan (GMP). This request is consistent with the GMP and, with the conditions proposed by staff, this project will be in compliance with the applicable provisions of the Land Development Code (LDC). 9.A.4.a Packet Pg. 948 Attachment: Staff Report - Edwards Grove Road Mine (13089 : PL20190000808 Edwards Grove Road Mine (CU)) CU-PL20190000808, EDWARDS GROVE ROAD MINE Revised Date: November 5, 2020 Page 9 of 11 3. Ingress and egress to the property and proposed structures thereon, with particular reference to automotive and pedestrian safety and convenience, traffic flow and control, and access in case of fire or catastrophe. Ingress and egress to the subject property will be limited to a single access point on Edwards Grove Road as shown on the master site plan. The TIS submitted by the applicant indicates that the adjacent roadway network has sufficient capacity (as noted above consistent with Florida State Statues) to accommodate this project within the 5-year planning period. The roadway infrastructure (as noted above consistent with Florida State Statues) has adequate capacity to serve the proposed project at this time, i.e., GMP consistent at the time of rezoning as evaluated as part of the GMP Transportation Element consistency review. The project’s development must also comply with all other applicable concurrency management regulations and operational improvements when development approvals are sought at time of Site Development Plan (SDP) review. 4. The effect the Conditional Use would have on neighboring properties in relation to noise, glare, economic, or odor effects. Considering the location and the existing commercial excavation operation, that is currently operating to the eastern parcel (as identified on the Conceptual Site Plan) no additional noise, glare, economic impact, or odor is anticipated. Additionally, with no residential land uses in near proximity to the proposed Conditional Use, no adverse impacts to the human population are anticipated. The proposed Conditional Use seeks only to expand the existing mining operation. 5. Compatibility with adjacent properties and other property in the district. If the proposed Conditions of Approval are adopted, the proposed earthmining facility can be found compatible with adjacent properties and other properties in the immediate area. Based on the above findings, this conditional use should, with stipulations as outlined in this staff report be recommended for approval. It is important to note that the conditions of approval from the existing Conditional Use adopted via Resolution 03-332 will be modified, per the following as described in Attachment C – Existing Conditions, Res 03-332. NEIGHBORHOOD INFORMATION MEETING (NIM): The applicant conducted a duly noticed and advertised NIM on July 23, 2020, at the Immokalee Sports Complex, located at 505 Escambia St., Immokalee, FL 34142. The meeting commenced at approximately 5:30 p.m. and ended at 5:45 p.m. The applicant’s agent explained the request for the conditional use. Jessica Harrelson, the agent, conducted the meeting with introductions of the consultant team and staff, and an overview of the proposed earthmining expansion application. Ms. Harrelson gave a PowerPoint presentation with review of the total site area, 9.A.4.a Packet Pg. 949 Attachment: Staff Report - Edwards Grove Road Mine (13089 : PL20190000808 Edwards Grove Road Mine (CU)) CU-PL20190000808, EDWARDS GROVE ROAD MINE Revised Date: November 5, 2020 Page 10 of 11 location, and zoning. She gave a detailed overview of the master concept plan with regard to development area, access and circulation, perimeter landscape buffers, and right-of-way reservation. She also explained the proposed conditions of approval. The meeting was opened to attendees; however, no questions were asked. No commitments were made. A copy of the Zoom attendees, NIM summary, and PowerPoint presentation, are included in the Backup Materials in Attachment D. COUNTY ATTORNEY OFFICE REVIEW: The County Attorney’s Office reviewed the staff report on 11-4-20. RECOMMENDATION: Staff recommends that the Collier County Planning Commission (CCPC) approve Petition CU- PL20190000808, subject to the following conditions: 1. Edwards Road Grove Road Mine Conditional Use shall be limited to what is depicted on the “Master Concept Plan, revised 11/03/2020,” prepared by Davidson Engineering. 2. The petitioner shall obtain a South Florida Water Management District Agricultural Surface Water Management Permit or permit modification for this site, if applicable. 3. The site shall be cleared of all exotic vegetation and maintained exotic-free in perpetuity. 4. Material hauling activities are permitted from 5:00 a.m. to 5:00 p.m., Monday through Saturday, and 24 hours a day Monday through Sunday for excavation and processing activities. 5. The excavation shall be contained by a berm constructed to the height of the 100-year flood elevation. Unless the berm contains adequate clay content to slow the flow of water (as determined by the Collier County Transportation Engineering Division), the berm shall contain a membrane impervious to water. 6. The site shall be limited to a maximum of 49 pm peak hour, two‐way trips based on the use codes in the ITE Manual on trip generation rates in effect at time of application for SDP/SDPA or subdivision plat approval, or based on an alternate methodology accepted by staff at time of application for SDP/SDPA in accordance with the County’s Traffic Impact Statement (TIS) guidelines in Resolution No. 2006‐299, as it may be amended. 7. Evidence of U.S. Fish and Wildlife Service (FWS) and Florida Fish and Wildlife Conservation Commission (FWC) accepted mitigation for impacts to panthers, woodstorks, Florida black bear and other listed species will be required prior to excavation permit approval, if applicable. 9.A.4.a Packet Pg. 950 Attachment: Staff Report - Edwards Grove Road Mine (13089 : PL20190000808 Edwards Grove Road Mine (CU)) CU-PL20190000808, EDWARDS GROVE ROAD MINE Revised Date: November 5, 2020 Page 11 of 11 8. A littoral shelf planting area to commence during the reclamation phase of the project shall be shown on the excavation permit for this petition and shall meet the current standards of the Land Development Code at time of submittal of the Commercial Excavation Permit. 9. Prior to any vehicular use of the additional 231.73± acres, the owner shall post two (2) signs along the on-site entry drive, clearly visible to vehicles entering and leaving the site, providing information regarding potential panther presence and notifying drivers of the need to use caution. Sign wording, placement, and size will be reviewed and approved by the Collier County Environmental Staff during review of the Commercial Excavation Application or other local development order, whichever is the first to allow vehicular use of the 231.73± acres. 10. All other applicable state or federal permits must be obtained before commencement of the development. 11. Pursuant to Section 125.022(5) F.S., issuance of a development permit by a County does not in any way create any rights on the part of the applicant to obtain a permit from a state or federal agency and does not create any liability on the part of the county for issuance of the permit if the applicant fails to obtain requisite approvals or fulfill the obligations imposed by a state or federal agency or undertakes actions that result in a violation of state or federal law. 12. The westernmost 200 feet of the parcel shall be reserved for road right-of-way, for the purpose of the future Little League Road extension. Within 90 days of receipt of written notification by Collier County Transportation that the property is needed, the owner will convey the requested property to the County, for fair market value on the date of the conveyance. 13. The petitioner shall be responsible for maintenance of Edwards Grove Road, from State Road 82 to the subject 450.7± acre property line, for the duration of the mining operation. Edwards Grove Road shall be paved a minimum of 22 feet in width and a depth of 1.5 inches of asphalt or asphalt millings. Attachments: A) Proposed Resolution B) FLUE Consistency Review C) Existing Conditions of Approval via RES 03-332 D) Application/Backup Materials E) Hybrid Waiver – Southwestern Properties LLC F) Hybrid Waiver – Tippen Bay Properties, LLLP 9.A.4.a Packet Pg. 951 Attachment: Staff Report - Edwards Grove Road Mine (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.b Packet Pg. 952 Attachment: Attachment A - Proposed Resolution (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.b Packet Pg. 953 Attachment: Attachment A - Proposed Resolution (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.b Packet Pg. 954 Attachment: Attachment A - Proposed Resolution (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.b Packet Pg. 955 Attachment: Attachment A - Proposed Resolution (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.bPacket Pg. 956Attachment: Attachment A - Proposed Resolution (13089 : PL20190000808 Edwards Grove Road Mine 9.A.4.b Packet Pg. 957 Attachment: Attachment A - Proposed Resolution (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.b Packet Pg. 958 Attachment: Attachment A - Proposed Resolution (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Zoning Division ● 2800 North Horseshoe Drive ● Naples, FL 34104 ● 239-252-2400 Page 1 of 3 Growth Management Department Zoning Division, Comprehensive Planning Section Memorandum To: Tim Finn, AICP, Principal Planner, Zoning Services Section From: Sue Faulkner, Principal Planner, Comprehensive Planning Section Date: July 23, 2020 Subject: Future Land Use Element Consistency Review PETITION NUMBER: PL20190000808 – REV:3 PETITION NAME: Edwards Grove Road Mine CU REQUEST: To obtain a Conditional Use (CU) for a ±450.7-acre site, consisting of two separately owned parcels. The request is to expand the existing commercial excavation operation (Stewart Materials) to include property adjacent to the west (extending to the east side of Lamm Road). The applicant is submitting “Proposed Conditions of Approval” to replace the former conditions that were included in Resolution #03-332. This project is related to a former application (PL20170003512) Stewart Mining CU that was withdrawn. Submittal 2 revised the Conditions of Approval to add the reservation of 200 feet of the westernmost part of the parcel but asked for further evaluation by Collier County Transportation. Submittal 3 revised the Master Plan to show 200’ ROW reservation for Little League Road extension and removed the 50’ ROW reservation. LOCATION: The current operating site of Stewart Mining lies approximately ½ mile north of the urbanized area of Immokalee, abutting the west side of Edwards Grove Road, with the proposed expansion site located east of Lamm Road (adjacent to the western property boundary of Stewart Mining), approximately 1.3 miles south of SR 82 and approximately 1 mile west of SR 29, in Section 18 and 19, Township 46 South, Range 29 East (Immokalee). COMPREHENSIVE PLANNING COMMENTS: The subject property is designated Agricultural/Rural and within the Rural Lands Stewardship Area Overlay (RLSAO) as shown on the Future Land Use Map (FLUM) and in the Future Land Use Element (FLUE) of the Growth Management Plan (GMP). On the Stewardship Overlay Map, part of the FLUM series, the site is designated “Open.” Currently the proposed additional acreage is mostly citrus groves and zoned A, Rural Agricultural Zoning District, within a Mobile Home Overlay (MHO), and within Rural Lands Stewardship Area Overlay (RLSAO). The “A” zoning district allows a conditional use for an extraction or earth mining use (CU #1), as listed in the Land Development Code (LDC) Chapter 2.03.01 A.1.c.1. This CU is an expansion encompassing ±218.97-acres of an existing earth mining operation for a total of approximately 450.7 acres. 9.A.4.c Packet Pg. 959 Attachment: Attachment B - FLUE Consistency Review (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Zoning Division ● 2800 North Horseshoe Drive ● Naples, FL 34104 ● 239-252-2400 Page 2 of 3 The FLUE states, in relevant part: “The Agricultural/Rural Land Use Designation is for those areas that are remote from the existing development pattern, lack public facilities and services, are environmentally sensitive or are in agricultural production. Urbanization is not promoted; therefore, most allowable land uses are of low intensity in an effort to maintain and promote the rural character of these lands.” The proposed earthmining, oil extraction and related processing is listed as an allowable use in this designation in the FLUE. In the FLUE, it also states that the goal of the Rural Lands Stewardship Area Overlay is to address the long- term needs of residents and property owners within the Immokalee Area Study boundary of the Collier County Rural and Agricultural Area Assessment by protecting agricultural activities, preventing the premature conversion of agricultural land to non-agricultural uses, directing incompatible uses away from wetlands and upland habitat, enabling the conversion of rural land to other uses in appropriate locations, discouraging urban sprawl, and encouraging development that implements creative land use planning techniques.” RLSA Policies 1.4 and 1.5 provide that properties in the RLSA may develop per the “Baseline Standards” (uses allowed by the underlying “A” zoning and Agricultural/Rural FLUM designation) which allow earth mining by conditional use. The “Proposed Conditions of Approval” - Attachment D included the following changes: • #3 permits material hauling activities between 5 am and 5 pm Monday through Saturday. Current approval for excavation activities permitted from 6:30 am and 7 pm Monday through Saturday. • #4 - now states the berm will be determined by Collier County Transportation Engineering Division; it used to say Collier County Engineering Services Department. • #5 adds maximum total daily trip generation as 49 peak-hour two-way trips • #6 adds evidence of accepted mitigation for impacts to wildlife • #7 adds littoral shelf planting area to commence during the reclamation phase of the project • #8 adds 2 signs warning drivers entering property of potential panthers • #9 must obtain all federal and state permits prior to commencement of development • #10 states county permits do not remove liability for state and federal permits Certain applicable Future Land Use Element (FLUE) policies are shown below in italics followed by staff analysis in bold text. FLUE Policy 5.6 (shown below in italics) followed by staff analysis in [bracketed bold text]. New developments shall be compatible with, and complementary to, the surrounding land uses, as set forth in the Land Development Code (Ordinance 04-41, adopted June 22, 2004 and effective October 18, 2004, as amended). [Comprehensive Planning staff leaves this determination to Zoning staff as part of their review of the petition.] Policy 7.1: The County shall encourage developers and property owners to connect their properties to fronting collector and arterial roads, except where no such connection can be made without violating intersection spacing requirements of the Land Development Code. [The subject property does not front on a collector or arterial roadway.] Policy 7.2: The County shall encourage internal accesses or loop roads in an effort to hel p reduce vehicle congestion on nearby collector and arterial roads and minimize the need for traffic signals. [The site is proposed as an expansion of a single development project. Due to the nature of the proposed use, this policy is not applicable. A loop road along the perimeter of the entire project site is shown in the Trip Generation Analysis.] 9.A.4.c Packet Pg. 960 Attachment: Attachment B - FLUE Consistency Review (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Zoning Division ● 2800 North Horseshoe Drive ● Naples, FL 34104 ● 239-252-2400 Page 3 of 3 Policy 7.3: All new and existing developments shall be encouraged to connect their local streets and/or interconnection points with adjoining neighborhoods or other developments regardless of land use type. The interconnection of local streets between developments is also addressed in Policy 9.3 of the Transportation Element. [The applicant’s “Narrative & Evaluation Criteria” – Attachment “C” states, “Interconnections to the property to the east are proposed, to achieve the unified form of development.” Given the nature of the proposed use as well as its location, staff believes interconnections to adjacent lands – other than the one to the east, to the existing CU site - may not be appropriate or beneficial.] Policy 7.4: The County shall encourage new developments to provide walkable communities with a blend of densities, common open spaces, civic facilities and a range of housing prices and types. [Mostly not applicable, given that this is a proposal for a mining and excavation operation – not a residential development. Attachment “C” states, “As this is a commercial excavation operation, the site will not be open to the public. Sidewalks/pathways will be provided only as necessary for employees within the site and as required by the LDC.”] CONCLUSION Based on the above analysis, staff finds the subject petition consistent with the Future Land Use Element of the Growth Management Plan. PETITION ON CITYVIEW cc: Anita Jenkins, AICP, Community Planning Manager, Zoning Division Raymond V. Bellows, Manager, Zoning Division, Zoning Services Section CU-PL20190000808 Edwards Grove Road R3.docx 9.A.4.c Packet Pg. 961 Attachment: Attachment B - FLUE Consistency Review (13089 : PL20190000808 Edwards Grove Road Mine (CU)) i CU AR CONDITIONS The Petitioner shall obtain a South Florida Water Management District Agricultural Surface Water Management Permit or permit modification for this site if applicable The site shall be cleared of all exotic vegetation and maintained exotic free in perpetuity The petitioner shall pave the access road from State Road to the subject property line prior to commencement of earthmining operations The pavement shall bea minimum of feet in width and a depth of inches of asphalt or asphalt millings The petitioner shall be responsible for maintenance of the access road for the duration of the operation Turn lanes on SR westbound left in eastbound right in shall be provided prior to commencement of earthrnining operations Excavation activities are permitted from AM until PM Monday through Saturday The excavation shall becontained by a berm constructed to the height of the year flood elevation Unless the berm contains adequate clay content to slow the flow of water as determined by the Collicr County Engineering Services Department the berm shall contain a membrane impervious to water A landscaped berm feet in height shall be constructed adjacent to parcels zoned residential within months of the adjacent parcel being rezoned The easternmost feet of the parcel shall be reserved for right of way and shall bedeeded to Collier County at no cost to Collier County within days of receipt of notification by the Collier County Transportation Services Department that the property is needed for the purpose of providing a right of way connection from Westclox Road to State Road EXHIBIT D This has been retained in the updated Conditions (Condition #2) This Condition has been retained and udpated to address operational needs of the site. (Condition #4) Access road was paved & an updated version of this has been retained in the new Conditions (Condition #13) This work has been complete and is not neded in the updated Conditions of Approval. This has been retained in the updated Conditions (Condition #3) This is not longer required. Through coordination with CC Transportation a ROW Reservation for the westermost 200' of the parcel has been added as Condition #12 and is shown on the updated Conceptual Plan. This Condition has been retained. (Condition #5) This is not needed in the updated Conditions of Approval (no adjacent residentially zoned properties/uses) 9.A.4.d Packet Pg. 962 Attachment: Attachment C - Existing Conditions of Approval via RES 03-332 (13089 : PL20190000808 Edwards Grove Road Mine (CU)) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 1 of 12 APPLICATION FOR PUBLIC HEARING FOR: CONDITIONAL USE LDC Section 10.08.00 & Code of Laws section 2-83 – 2-90 Chapter 3 C.1 of the Administrative Code PETITION NO (PL) PROJECT NAME DATE PROCESSED A CONDITIONAL USE TO BE HEARD BY THE PLANNING COMMISSION AND BOARD OF ZONING APPEALS A MINOR CONDITIONAL USE TO BE HEARD BY THE OFFICE OF THE HEARING EXAMINER APPLICANT CONTACT INFORMATION Name of Property Owner(s): ______________________________________________________ Name of Applicant if different than owner: __________________________________________ Address: ____________________________City: _____________ State: ________ ZIP: _______ Telephone: ____________________ Cell: ____________________ Fax: ___________________ E-Mail Address: ________________________________________________________________ Name of Agent(s): _____________________________________________________________ Firm: _________________________________________________________________________ Address: ____________________________City: _____________ State: ________ ZIP: _______ Telephone: ____________________ Cell: _____________________ Fax: __________________ E-Mail Address: ________________________________________________________________ BE AWARE THAT COLLIER COUNTY HAS LOBBYIST REGULATIONS. GUIDE YOURSELF ACCORDINGLY AND ENSURE THAT YOU ARE IN COMPLIANCE WITH THESE REGULATIONS. To be completed by staff Southwestern Properties, LLC and Tippen Bay Properties, LLLP Rudd Jones, P.E., Director of Development 2875 Jupiter Park Dr, Suite 1100 Jupiter FL 33458 561-972-4517 rudd@stewartmaterials.com Jessica Harrelson, AICP & Richard Yovanovich, Esq. Davidson Engineering, Inc. & Coleman, Yovanovich & Koester, P.A. 4365 Radio Road, Suite 201 Naples FL 34104 239-434-6060/239-435-3535 jessica@davidsonengineering.com, ryovanovich@cyklawfirm.com 9.A.4.e Packet Pg. 963 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 2 of 12 ASSOCIATIONS Required: List all registered Home Owner Association(s) that could be affected by this petition. Provide additional sheets if necessary. Information can be found on the Board of County Commissioner’s website at http://www.colliergov.net/Index.aspx?page=774. Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ PROPERTY INFORMATION On separate page, provide a detailed legal description of the property covered by the application: x If the request involves changes to more than one zoning district, the applicant shall include separate legal description for property involved in each district; x The applicant shall submit 4 copies of a recent survey (completed within the last six months, maximum 1" to 400' scale), if required to do so at the pre-application meeting; and x The applicant is responsible for supplying the correct legal description. If questions arise concerning the legal description, an engineer's certification or sealed survey may be required. Property I.D. Number: ____________________________ Plat Book: _______ Page #: _______ Section/Township/Range: _______ /_______ /_______ Subdivision: __________________________________________Lot: ________ Block: ________ Metes & Bounds Description: _____________________________________________________ Size of Property: _____ft. X ______ ft. = _______ Total Sq. Ft. Acres: _____________ Address/ General Location of Subject Property: ______________________________________________________________________________ ______________________________________________________________________________ See Attachment "A" Immokalee Civic Association 502 E. New Market Rd Immokalee FL 34142 00065520004 & 00065680009 18 & 19 46 29 see attached survey and attachment "B" ±450.7 acres 2301 and 2315 Edwards Grove Road, Immokalee, FL 34142 9.A.4.e Packet Pg. 964 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 3 of 12 ADJACENT ZONING AND LAND USE Zoning Land Use N S E W If the owner of the subject property owns contiguous property please provide a detailed legal description of the entire contiguous property: (If space is inadequate, attach on a separate page) Section/Township/Range: / / Lot: Block: Subdivision: __________________________________________ Plat Book: Page #: Property I.D. Number: ____________________________ Metes & Bounds Description: ________________________________________________ CONDITIONAL USE REQUEST DETAIL Type of Conditional Use: This application is requesting a conditional use as allowed, pursuant to LDC section 2.03.00, of the _______________________ zoning district for _______________________ (type of use). Present Use of the Property: __________________________________________ A-MHO-RLSAO Existing Ag Land and Citrus Operation A-MHO-RLSAO Existing Ag Land and Citrus Operation ROW/A-MHO-RLSAO Edwards Grove Rd/Undeveloped Farmland ROW/A-MHO-RLSAO Lamm Road/Existing Ag Land and Citrus Operation A-MHO-RSLAO Commercial Excavation Citrus Grove & Existing Commercial Excavation 9.A.4.e Packet Pg. 965 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 4 of 12 EVALUATION CRITERIA Pursuant to LDC section 10.08.00 and Chapter 3 C.1 of the Administrative Code, staff’s recommendation to the reviewing body shall be based upon a finding that the granting of the conditional use will not adversely affect the public interest and that the specific requirements governing the individual conditional use, if any, have been met. Further, satisfactory provision and arrangement have been made concerning the following matters, where applicable. On a separate page, provide a narrative statement describing a request for a conditional use and a detailed response to the criteria listed below. Specify how and why the request is consistent with each of the criteria. a. Describe how the project is consistent with the Collier County Land Development Code and Growth Management Plan. Include information on how the request is consistent with the applicable section or portions of the Future Land Use Element. b. Describe the existing or planned means of ingress and egress to the property and proposed structure thereon with particular reference to automotive and pedestrian safety and convenience, traffic flow and control, and access in case of fire or catastrophe. c. Describe the effect the conditional use will have on neighboring properties in relation to noise, glare, economic impact, and odor. d. Describe the site’s and the proposed use’s compatibility with adjacent properties and other properties in the district. e. Please provide any additional information which you may feel is relevant to this request. Deed Restrictions: The County is legally precluded from enforcing deed restrictions; however, many communities have adopted such restrictions. You may wish to contact the civic or property owners association in the area for which this use is being requested in order to ascertain whether or not the request is affected by existing deed restrictions. Previous land use petitions on the subject property: To your knowledge, has a public hearing been held on this property within the last year? If so, what was the nature of that hearing? _____________________________________________________________________________________ _____________________________________________________________________________________ Official Interpretations or Zoning Verifications: To your knowledge, has there been an official interpretation or zoning verification rendered on this property within the last year? No Yes (If yes please provide copies.) See Attachment "C" No 9.A.4.e Packet Pg. 966 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 5 of 12 STATEMENT OF UTILITY PROVISIONS FOR CONDITIONAL USE REQUEST APPLICANT INFORMATION Name of Applicant(s): ___________________________________________________________ Address: ______________________________City: ___________ State: ________ ZIP: _______ Telephone: ____________________ Cell: _____________________ Fax: __________________ E-Mail Address: ________________________________________________________________ Address of Subject Property (If available): ___________________________________________ City: ________________ State: __________ ZIP: ___________ LEGAL DESCRIPTION Section/Township/Range: / / Lot: Block: Subdivision: _______________________________________________ Plat Book: Page #: Property I.D. Number: _________________________________ Metes & Bounds Description: _____________________________________________________ TYPE OF SEWAGE DISPOSAL TO BE PROVIDED Check applicable system: a. County Utility System b. City Utility System c. Franchised Utility System Provide Name: ____________________ d. Package Treatment Plant (GPD Capacity): ___________________ e. Septic System TYPE OF WATER SERVICE TO BE PROVIDED a. County Utility System b. City Utility System c. Franchised Utility System PROVIDE NAME_______________ d. Private System (Well) Total Population to be served: ____________________________________________________ Peak and Average Daily Demands: A. Water-Peak: _______ Average Daily: ________ B. Sewer-Peak: _______ Average Daily: ________ Southwestern Properties, LLC & Tippen Bay Properties, LLLP 2875 Jupiter Park Dr, Suite 1100 Jupiter FL 33458 561-972-4517 rudd@stewartmaterials.com 2315 Edwards Grove Road Immokalee FL 34142 18/19 46 29 00065520004 & 00065680009 see attached survey X X N/A 9.A.4.e Packet Pg. 967 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 6 of 12 If proposing to be connected to Collier County Regional Water System, please provide the date service is expected to be required: ____________________________________________ Narrative statement: Provide a brief and concise narrative statement and schematic drawing of sewage treatment process to be used as well as a specific statement regarding the method of affluent and sludge disposal. If percolation ponds are to be used, then percolation data and soil involved shall be provided from tests prepared and certified by a professional engineer. ______________________________________________________________________________ ______________________________________________________________________________ ______________________________________________________________________________ ______________________________________________________________________________ County Utility Dedication Statement: If the project is located within the service boundaries of Collier County’s utility service system, a notarized statement shall be provided agreeing to dedicate the water distribution and sewage collection facilities within the project area to the Collier County Utilities. This shall occur upon completion of the construction of these facilities in accordance with all applicable County ordinances in effect at that time. This statement shall also include an agreement that the applicable system development charges and connection fees will be paid to the County Utilities Division prior to the issuance of building permits by the County. If applicable, the statement shall contain an agreement to dedicate the appropriate utility easements for serving the water and sewer systems. ______________________________________________________________________________ ______________________________________________________________________________ ______________________________________________________________________________ ______________________________________________________________________________ Statement of Availability Capacity from other Providers: Unless waived or otherwise provided for at the pre-application meeting, if the project is to receive sewer or potable water services from any provider other than the County, a statement from that provider indicating adequate capacity to serve the project shall be provided. N/A N/A N/A 9.A.4.e Packet Pg. 968 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 7 of 12 RECORDING OF DEVELOPER COMMITMENTS Within 30 days of adoption of the Ordinance, the owner or developer at their expense shall record in the Public Records of Collier County a Memorandum of Understanding of Developer Commitments or Notice of Developer Commitments that contains the legal description of the property that is the subject of the land use petition and contains each and every commitment of the owner or developer specified in the Ordinance. The Memorandum or Notice shall be in form acceptable to the County and shall comply with the recording requirements of F.S. §695. A recorded copy of the Memorandum or Notice shall be provided to the assigned Principal Planner, Zoning Services Department, within 15 days of recording of said Memorandum or Notice. Chapter 8 of the Administrative Code requires that the applicant must remove their public hearing advertising sign(s) after final action is taken by the Board of County Commissioners. Based on the Board's final action on this item, please remove all public hearing advertising sign(s) immediately. 9.A.4.e Packet Pg. 969 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 8 of 12 Pre-Application Meeting and Final Submittal Requirement Checklist for: A Conditional Use to be heard by the Planning Commission and Board of Zoning Appeals A Minor Conditional Use to be heard by the Office of the Hearing Examiner Chapter 3 C.1. of the Administrative Code The following Submittal Requirement Checklist is to be utilized during the Pre-Application Meeting, and at time of application submittal. At time of submittal, the checklist is to be completed and submitted with the application packet. Please provide the submittal items in the exact order listed below, with cover sheets attached to each section. Incomplete submittals will not be accepted. Requirements for Review # Of Copies Required Not Required Completed Application (download current form from County website) 1 Cover letter briefly explaining the project 1 Pre-Application Notes 1 Affidavit of Authorization, signed and notarized 1 Completed Addressing Checklist 1 Property Ownership Disclosure Form 1 Warranty Deed(s) 1 Boundary Survey 1 Conceptual Site Plan 24” X 36” plus (one 8 ½ X 11 copy) Plans showing proposed location for utilities, if required Plans for screening and buffering the use with reference as to type, dimensions, and character, if required Plans showing the proposed landscaping and provisions for trees protected by County regulations, if required Plans showing the proposed signs and lighting, including type, dimensions, and character, if required Architectural Rendering of Proposed Structure(s), if applicable 1 Current aerial photographs (available from Property Appraiser) with project boundary and, if vegetated, FLUCFCS Codes with legend included on aerial. 1 Statement of utility provisions (with all required attachments & sketches) 1 Environmental Data Requirements, pursuant to LDC section 3.08.00 1 Environmental Data Requirements collated into a single Environmental Impact Statement (EIS) at time of public hearings. Coordinate with project planner at time of public hearing. Listed Species Survey; less than 12 months old. Include copies of previous surveys. 1 Traffic Impact Study (TIS) or waiver 1 Historical and Archeological Survey, or waiver 1 Electronic copy of all documents and plans * Please advise: The Office of the Hearing Examiner requires all materials to be submitted electronically in PDF format. 1 * If located in the Bayshore/Gateway Triangle Redevelopment Area, include an additional set of each submittal requirement ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ 9.A.4.e Packet Pg. 970 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 9 of 12 ADDITIONAL REQUIREMENTS FOR THE PUBLIC HEARING PROCESS: x Following the completion of the review process by County review staff, the applicant shall submit all materials electronically to the designated project manager. x Please contact the project manager to confirm the number of additional copies required. Planners: Indicate if the petition needs to be routed to the following additional reviewers: Bayshore/Gateway Triangle Redevelopment: Executive Director Emergency Management: Dan Summers; and/or EMS: Artie Bay Conservancy of SWFL: Nichole Johnson GMD Graphics City of Naples: Robin Singer, Planning Director Utilities Engineering: Eric Fey Parks and Recreation: Barry Williams Immokalee Water/Sewer District: Other: School District (Residential Components): Amy Lockheart Communication Towers: Mosquito Control Collier County Airport Authority Naples Airport Authority Commercial Mining: Impact Fees 9.A.4.e Packet Pg. 971 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 10 of 12 FEE REQUIREMENTS All checks payable to: Board of County Commissioners Pre-Application Meeting: $500.00 (to be credited towards the application fee if the application is filed within 9 months of pre-application meeting) Conditional Use Application Fee: $4,000.00 o When filed with Rezone Petition: $1,500.00 o Additional fee for 5th and subsequent reviews: 20% of original fee Comprehensive Planning Consistency Review: $300.00 Environmental Data Requirements-EIS Packet (submittal determined at pre-application meeting): $2,500.00 Listed or Protected Species survey review fee (when an EIS is not required): $1,000.00 Transportation Fee, if required: o Methodology Review Fee: $500.00 o Minor Study Review Fee: $750.00 o Major Study Review Fee: $1,500.00 Estimated Legal Advertising Fee for the Hearing Examiner or CCPC: $1,125.00 Estimated Legal Advertising Fee for the BZA, if required: $500.00 Fire Code Plans Review Fees are collected at the time of application submission and those fees are set forth by the Authority having jurisdiction. The Land Development Code requires Neighborhood Notification mailers for Applications headed to hearing, and this fee is collected prior to hearing. As the authorized agent/applicant for this petition, I attest that all of the information indicated on this checklist is included in this submittal package. I understand that failure to include all necessary submittal information may result in the delay of processing this petition. All checks payable to: Board of County Commissioners. The completed application, all required submittal materials, and fees shall be submitted to: Growth Management Department ATTN: Business Center 2800 North Horseshoe Drive Naples, FL 34104 ____________________________________________ ____________ Agent/Owner Signature Date ____________________________________________ Agent/Owner Name (please print) Jessica Harrelson, AICP 12/19/2019 9.A.4.e Packet Pg. 972 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 11 of 12 Public Participation Requirements LDC Section 10.03.06 B. or C. Chapter 8 of the Administrative Code Notice for Minor Conditional Use Petitions Neighborhood Information Meeting (NIM) Requirements: Applicant must conduct a NIM at least 15 days prior to the Hearing Examiner’s receipt of the staff report and application materials in accordance with the applicable sections of the Administrative Code. The NIM shall be advertised and a mailed written notice shall be given to the property owners in the notification area at least 15 days prior to the NIM meeting. Mailed Notice: Written notice shall be sent to property owners in the notification area at least 15 days before the advertised Hearing Examiner hearing. Newspaper Advertisements: The legal advertisement shall be published at least 15 days before the advertised Hearing Examiner hearing in a newspaper of general circulation. The advertisement shall include at a minimum: x Date, time, and location of the hearing; x Description of the proposed land uses; and x 2 in. x 3 in. map of the project location. Sign: A sign shall be posted at least 15 days before the advertised Hearing Examiner hearing date. Public Hearing for Minor Conditional Use Petitions Hearing Examiner: The Hearing Examiner shall hold at least 1 advertised public hearing. See Chapter 9 of the Administrative Code for the Office of the Hearing Examiner procedures. Notice for Conditional Use Petitions Neighborhood Information Meeting (NIM) Requirements: Applicant must conduct a NIM at least 15 days prior to the advertised public hearing. The NIM shall be advertised and a mailed written notice shall be given to the property owners in the notification area at least 15 days prior to the NIM meeting. 9.A.4.e Packet Pg. 973 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 12 of 12 Mailed Notice: Written notice shall be sent to property owners in the notification area at least 15 days before the advertised public hearing. Newspaper Advertisements: The legal advertisement shall be published at least 15 days before the advertised public hearing in a newspaper of general circulation. The advertisement shall include at a minimum: x Date, time, and location of the hearing; x Description of the proposed land uses; and x 2 in. x 3 in. map of the project location. Sign: A sign shall be posted at least 15 days before the advertised public hearing date. Public Hearing for Conditional Use Petitions Environmental Advisory Committee (EAC): The EAC shall hold at least 1 advertised public hearing, if required. Collier County Planning Commission (CCPC): The CCPC shall hold at least 1 public hearing. Board of Zoning Appeals (BZA): The BZA shall hold at least 1 advertised public hearing. 9.A.4.e Packet Pg. 974 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Stewart Mining CU – PL20190000808 Attachment “A” – Legal Description March 24, 2020 www.davidsonengineering.com LEGAL DESCRIPTION ATTACHMENT “A” A TRACT OF LAND LOCATED IN THE SOUTHEAST QUARTER OF SECTION 18 AND THE NORTHEAST QUARTER OF SECTION 19, TOWNSHIP 46 SOUTH, RANGE 29 EAST, COLLIER COUNTY, FLORIDA, BEING DESCRIBED AS FOLLOWS: BEGINNING AT THE NORTHEAST CORNER OF SAID SECTION 19, RUN S 00°38'42" E ALONG THE EAST LINE OF SAID SECTION FOR A DISTANCE OF 2692.02 FEET TO A CONCRETE MONUMENT BEING THE EAST QUARTER CORNER OF SAID SECTION 19; THENCE ALONG THE EAST-WEST QUARTER LINE OF SAID SECTION 19 S 89°27'00" W 2341.08 FEET TO THE WESTERLY LINE OF THOSE LANDS RECORDED IN O.R. BOOK 3330, PAGE 3215 AND THE EASTERLY LINE OF THOSE LANDS RECORDED IN O.R. BOOK 5350, PAGE 1271, ALL OF THE PUBLIC RECORDS OF COLLIER COUNTY, FLORIDA; THENCE ALONG SAID LINE N 00°35'34" W 1352.26 FEET; THENCE S 89°04'22" WEST 84.00 FEET; THENCE N 00°55'38" W 2658.69 FEET TO A POINT ON THE EAST-WEST QUARTER LINE OF THE SOUTHEAST QUARTER OF SAID SECTION 18; THENCE N 88°47'54" E ALONG SAID LINE FOR A DISTANCE OF 2437.77 FEET TO A CONCRETE MONUMENT BEING THE EAST QUARTER CORNER OF SAID SOUTHEAST 1/4; THENCE S 00°36'52" E ALONG THE EAST LINE OF SAID SECTION 18 FOR A DISTANCE OF 1346.05 FEET TO THE POINT OF BEGINNING. LESS AND EXCEPT THE EASTERLY THIRTY (30) FEET THEREOF. THE ABOVE DESCRIBES AN AREA OF APPROXIMATELY 218.97 ACRES OF LAND. AND A TRACT OF LAND LOCATED IN THE SOUTHWEST ONE-QUARTER (SW ¼) OF SECTION 18, TOWNSHIP 46 SOUTH, RANGE 29 EAST AND A PART OF THE NORTH ONE-HALF (N ½) OF SECTION 19, TOWNSHIP 46 SOUTH, RANGE 29 EAST, COLLIER COUNTY, FLORIDA, BEING MORE PARTICULARLY DESCRIBED AS FOLLOWS: BEGINNING AT THE SOUTHWEST CORNER OF SAID SECTION 18 RUN N 00°25’14” W FOR A DISTANCE OF 1,331.53 FEET TO THE NORTHWEST CORNER OF THE SOUTHWEST ONE-QUARTER (SW ¼) OF THE SOUTHWEST ONE-QUARTER (SW ¼) OF SAID SECTION 18; THENCE ALONG THE NORTH LINE OF SAID QUARTER-QUARTER LINE N 88°51'13" E 2,481.73 FEET; THENCE LEAVING SAID LINE S 00°55'38" E 2,658.69 FEET; THENCE N 89°04'22" E 84.00 FEET; 9.A.4.e Packet Pg. 975 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Stewart Mining CU – PL20190000808 Attachment “A” – Legal Description March 24, 2020 www.davidsonengineering.com THENCE S 00°35'34" E 1,352.26 FEET TO AN INTERSECTION WITH THE EAST-WEST QUARTER LINE OF SAID SECTION 19; THENCE ALONG SAID QUARTER LINE S 89°27'14" W 2,589.72 FEET TO THE WEST ONE-QUARTER CORNER OF SAID SECTION 19; THENCE ALONG THE WEST LINE OF SAID SECTION 19 N 00°29'38" W 2,652.80 FEET TO THE POINT OF BEGINNING. THE ABOVE DESCRIBES AN AREA OF APPROXIMATELY 231.73 ACRES FEET OF LAND. BEARINGS ARE RELATIVE TO NORTH AMERICAN DATUM (NAD) 1983, FLORIDA EAST ZONE. 9.A.4.e Packet Pg. 976 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Stewart Mining CU – PL20190000808 Attachment “B” – Disclosure of Interest December 20, 2019 www.davidsonengineering.com ATTACHMENT “B” DISCLOSURE OF INTEREST Southwestern Properties, LLC: Brown Ranch, LLC, a Florida limited liability company (formerly known as Brown Ranch, Inc.) - 33 1/3% o Edgar A. Brown, II – 3% - Manager o Edgar A. Brown and Barbara L. Brown, husband and wife – 91% jointly o Alexis Brown Peeper, formerly known as Sandra Alexis Brown – 3% o Benjamin A. Brown, II – 3% Beale Holdings, Inc., a Florida corporation – 33 1/3% o Joseph E. Beale Jr. – President Nick T. Stewart – 33 1/3% And Tippen Bay Properties, LLLP: J.R. Paul Properties, Inc. o Bryan W. Paul – President o James C Paul – Vice President 9.A.4.e Packet Pg. 977 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Stewart Mining CU – PL20190000808 Attachment “C” – Evaluation Criteria December 20, 2019 www.davidsonengineering.com NARRATIVE & EVALUATION CRITERIA ATTACHMENT “C” The intent of this Conditional Use request is to allow for the proposed expansion of an existing commercial excavation operation, as provided for in the Conditional Use provisions within the A-MHO-RSLAO District. The existing commercial excavation site currently operates as permitted by Resolution 03-332. This request also seeks to repeal and replace Resolution 03-332. Further, the purpose of this petition is to expand the existing excavation area. The current excavation will be completed, and its littoral shelf planting area(s) will be consistent with the currently approved excavation. The lake area being added will comply with the new littoral planting requirements in the LDC. The subject development consists of two separately owned parcels, together consisting of 450.70-acres. The parcels will remain under separate ownership. a. Describe how the project is consistent with the Collier County Land Development Code and Growth Management Plan. Include information on how the request is consistent with the applicable section or portions of the Future Land Use Element. Response: The A-MHO-RSLAO District allows commercial excavations as a Conditional Use. The application and proposed Conceptual Site Plan identifies all the required elements for a conditional use, as required by the LDC and thereby, the Future Land Use Element. b. Describe the existing or planned means of ingress and egress to the property and proposed structure thereon with particular reference to automotive and pedestrian safety and convenience, traffic flow and control, and access in case of fire or catastrophe. Response: The expansion site will be developed as a unified excavation with the existing commercial excavation site (eastern parcel identified on the Conceptual Site Plan). The existing ingress/egress point on Edwards Grove Road will remain, accessing the existing commercial excavation operation, and will continue to be utilized for the joint operation that this Conditional Use proposes. The expansion of the existing excavation operation will not generate additional trips to the site, as additional trucks or employees are not proposed. c. Describe the effect the conditional use will have on neighboring properties in relation to noise, glare, economic impact, and odor. Response: Considering the location and the existing commercial excavation operation, that is currently operating to the eastern parcel (as identified on the Conceptual Site Plan) no additional noise, glare, economic impact, or odor is anticipated. Additionally, with no residential land uses in near proximity to the proposed Conditional Use, no adverse impacts to the human population are anticipated. The proposed Conditional Use seeks only to expand the existing mining operation. 9.A.4.e Packet Pg. 978 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Stewart Mining CU – PL20190000808 Attachment “C” – Evaluation Criteria December 20, 2019 www.davidsonengineering.com d. Describe the site’s and the proposed use’s compatibility with adjacent properties and other properties in the district. Response: As noted previously, the proposed Conditional Use is to expand the existing commercial excavation operation, located on the eastern parcel identified on the Conceptual Site Plan. The subject development is surrounded by similar conditions and land uses. Therefore, the subject property and the proposed Conditional Use are considered compatible with the surrounding uses. e. Please provide any additional information which you may feel is relevant to this request. Response: Upon the successful completion of the Conditional Use application, the proposed excavation expansion will be found consistent and permitted per the requirements of the LDC and its design and development standards. Future Land Use Element Provisions Policy 5.4: New developments shall be compatible with, and complementary to, the surrounding land uses, as set forth in the Land Development Code (Ordinance 04-41, adopted June 22, 2004 and effective October 18, 2004, as amended). The A-MHO-RSLAO District allows commercial excavations. The application and Conceptual Site Plan identifies the required elements for a Conditional Use, as required by the LDC and Future Land Use Element Provisions. Policy 7.1 The County shall encourage developers and property owners to connect their properties to fronting collector and arterial roads, except where no such connection can be made without violating intersection spacing requirements of the Land Development Code. The expansion site will be developed as a unified excavation with the existing commercial excavation site. The existing ingress/egress point, located along Edwards Grove Road, will remain for and used for direct access to both properties. Additionally, internal access/circulation will be provided throughout the excavation operation as needed. Policy 7.2 The County shall encourage internal accesses or loop roads in an effort to help reduce vehicle congestion on nearby collector and arterial roads and minimize the need for traffic signals. The applicant has planned for the provision of internal circulation provided within the proposed Lake Excavation Area of the Conceptual Site Plan. Construction drawings for the companion Commercial Excavation Permit will identify these circulation routes in detail. 9.A.4.e Packet Pg. 979 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Stewart Mining CU – PL20190000808 Attachment “C” – Evaluation Criteria December 20, 2019 www.davidsonengineering.com Policy 7.3 All new and existing developments shall be encouraged to connect their local streets and their interconnection points with adjoining neighborhoods or other developments regardless of land use type. Interconnections to the property to the east are proposed, to achieve the unified excavation. Policy 7.4 The County shall encourage new developments to provide walkable communities with a blend of densities, common open spaces, civic facilities and a range of housing prices and types. As this is a commercial excavation operation, the site will not be open to the public. Sidewalks/pathways will be provided only as necessary for employees within the site and as required by the LDC. 9.A.4.e Packet Pg. 980 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) LESS AND EXCEPT THE EAST 30 FEET QUIT CLAIM DEED (O.R. BOOK 156, PAGE 375) EASEMENT FOR CANALS AND DRAINAGE (O.R. BOOK 1141, PAGE 2089) EASEMENT FOR CANALS AND DRAINAGE (O.R. BOOK 1141, PAGE 2089) EASEMENT FOR CANALS AND DRAINAGE (O.R. BOOK 1141, PAGE 2089) EASEMENT FOR CANALS AND DRAINAGE (O.R. BOOK 1141, PAGE 2089) 50' UTILITY EASEMENT (O.R. BOOK 3909, PAGE 2831) 50' UTILITY EASEMENT (O.R. BOOK 3974, PAGE 1369) 30' WIDE PRIMARY ACCESS EASEMENT FOR ROAD (O.R. BOOK 1141, PAGE 2093)EDWARDS GROVE ROAD5,780 FEET± TO S.R. 82LAMM ROAD7,327 FEET± TO S.R. 8210' TYPE A LANDSCAPE BUFFER 50' EXCAVATION SETBACK 20' TYPE D LANDSCAPE BUFFER 10' TYPE A LANDSCAPE BUFFER ZONING: A-MHO-RLSAO LAND USE: EXISTING AG LAND AND CITRUS OPERATION ZONING: A-MHO-RLSAO LAND USE: EXISTING AG LAND AND CITRUS OPERATION ZONING: A-MHO-RLSAO LAND USE: EXISTING AG LAND AND CITRUS OPERATION ZONING: A-MHO-RLSAO LAND USE: EXISTING AG LAND AND CITRUS OPERATION 50' EXCAVATION SETBACK 10' TYPE A LANDSCAPE BUFFER 10' TYPE A LANDSCAPE BUFFER 50' EXCAVATION SETBACK ZONING: A-MHO-RLSAO LAND USE: EXISTING AG LAND/FARMLAND ZONING: A-MHO-RLSAO LAND USE: UNDEVELOPED AND EXISTING AG LAND/FARMLAND 50' EXCAVATION SETBACK EXISTING PROPERTY LINE LAKE EXCAVATION LIMITS ZONING: A-MHO-RLSAO LAND USE: EXISTING AG LAND AND CITRUS OPERATION EXISTING SCALE HOUSE EXISTING PROCESSING PLANT EXISTING EMPLOYEE PARKING AREA PROPOSED LAKE EXCAVATION / DEVELOPMENT AREA ± 422.50 ACRES EXISTING REFUSE AREA CONSTRUCTION VEHICLE CIRCULATION CONSTRUCTION VEHICLE CIRCULATION CONSTRUCTION VEHICLE CIRCULATION EXISTING SITE ACCESS POINT 200' RIGHT OF WAY RESERVATION N CURRENT ZONING:A-MHO-RSLAO / CONDITIONAL USE (RESOLUTION 03-332) PROPOSED ZONING:A-MHO-RSLAO / CONDITIONAL USE (CU) CURRENT LAND USE:AGRICULTURAL / COMMERCIAL EXCAVATION FUTURE LAND USE:AGRICULTURAL / RURAL MIXED USE DISTRICT / RLSA PLANNING NOTES: ROW RESERVATION & EASEMENTS PERIMETER BUFFERS ± 4.93 AC. ± 421.58 AC. LAND USE SUMMARY ACRES % OF SITE ± 1.09% ± 93.54%DEVELOPMENT / EXCAVATION AREA 1.THIS CONDITIONAL USE AND CONCEPTUAL SITE PLAN REPRESENTS THE EXISTING LIMITS AND PROPOSED EXPANSION OF THE EXISTING COMMERCIAL EXCAVATION OPERATION. 2.PER SEC. 22-112 WHERE AN EXCAVATION CROSSES COMMON PARCEL OR PROPERTY LINES, THE SETBACK REQUIREMENTS ARE EXEMPT AT THE CONTIGUOUS PROPERTY LINES. 3.PER THE FLUCCS PREPARED AS PART OF THIS APPLICATION, NO NATIVE PRESERVATION IS REQUIRED. 4.A LITTORAL SHELF PLANTING AREA TO COMMENCE DURING THE RECLAMATION PHASE OF THE PROJECT SHALL BE SHOWN ON THE EXCAVATION PERMIT FOR THIS PETITION AND SHALL MEET THE CURRENT STANDARDS OF THE LAND DEVELOPMENT CODE AT TIME OF SUBMITTAL OF THE COMMERCIAL EXCAVATION PERMIT. GENERAL NOTES: =EXCAVATION AREA =PROPERTY BOUNDARY 4365 Radio Road, Suite 201 Naples, Florida 34104 P: 239.434.6060 Company Cert. of Authorization No. 00009496 MASTER CONCEPT PLAN SHEET NO: REVISIONS DATEREV.DESCRIPTION USE CU APPLICATION SUBMITTAL11/21/2019 CC RAI COMMENTS02/07/2020 CC RAI COMMENTS05/04/2020 ± 24.19 AC.± 5.37% TOTAL SITE AREA 100%± 450.70 AC. CC RAI COMMENTS07/22/2020 9.A.4.e Packet Pg. 981 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Stewart Mining CU – PL20190000808 Attachment “D” – Conditions of Approval September 23, 2020 www.davidsonengineering.com PROPOSED CONDITIONS OF APPROVAL ATTACHMENT “D” 1. The petitioner shall obtain a South Florida Water Management District Agricultural Surface Water Management Permit or permit modification for this site, if applicable. 2. The site shall be cleared of all exotic vegetation and maintained exotic-free in perpetuity. 3. Material hauling activities are permitted from 5:00 a.m. to 5:00 p.m., Monday through Saturday. 4. The excavation shall be contained by a berm constructed to the height of the 100-year flood elevation. Unless the berm contains adequate clay content to slow the flow of water (as determined by the Collier County Transportation Engineering Division), the berm shall contain a membrane impervious to water. 5. The site shall be limited to a maximum of 49 pm peak hour, two-way trips based on the use codes in the ITE Manual on trip generation rates in effect at time of application for SDP/SDPA or subdivision plat approval, or based on an alternate methodology accepted by staff at time of application for SDP/SDPA in accordance with the County’s Traffic Impact Statement (TIS) guidelines in Resolution No. 2006-299, as it may be amended. 6. Evidence of U.S. Fish and Wildlife Service (FWS) and Florida Fish and Wildlife Conservation Commission (FWC) accepted mitigation for impacts to panthers, woodstorks, Florida black bear and other listed species will be required prior to excavation permit approval, if applicable. 7. A littoral shelf planting area to commence during the reclamation phase of the project shall be shown on the excavation permit for this petition and shall meet the current standards of the Land Development Code at time of submittal of the Commercial Excavation Permit. 8. Prior to any vehicular use of the site, the owner shall post two (2) signs along the entry drive, clearly visible to vehicles entering and leaving the site, providing information regarding potential panther presence and notifying drivers of the need to use caution. Sign wording, placement and size will be subject to review and approval by the Collier County Environmental Staff. The owner shall submit, and receive approval, of the proposed signage in conjunction with the Commercial Excavation Application or other local development order as may be required, which may allow vehicular use of the site. 9. All other applicable state or federal permits must be obtained before commencement of the development. 10. Pursuant to Section 125.022(5) F.S., issuance of a development permit by a County does not in any way create any rights on the part of the applicant to obtain a permit from a state or federal agency and does not create any liability on the part of the county for issuance of the permit if the applicant 9.A.4.e Packet Pg. 982 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Stewart Mining CU – PL20190000808 Attachment “D” – Conditions of Approval September 23, 2020 www.davidsonengineering.com fails to obtain requisite approvals or fulfill the obligations imposed by a state or federal agency or undertakes actions that result in a violation of state or federal law. 11. The westernmost 200 feet of the parcel shall be reserved for right-of-way, for the purpose of the future Little League Road extension. 12. The petitioner shall be responsible for maintenance of Edwards Grove Road, from State Road 82 to the subject property line, for the duration of the mining operation. Edwards Grove Road shall be paved a minimum of 22 feet in width and a depth of 1.5 inches of asphalt or asphalt millings. 9.A.4.e Packet Pg. 983 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 4365 Radio Road • Suite 201 • Naples, FL 34104 • P: 239.434.6060 • www.davidsonengineering.com D esigning E xcellence Civil Engineering • Planning • Permitting Trip Generation Analysis Conditional Use Application #PL20190000808 Stewart Mining Collier County, FL PREPARED BY: Davidson Engineering, Inc. 4365 Radio Road, Suite 201 Naples, Florida 34104 Methodology Fee = $500 Small Scale Study = $0 December 3, 2019 _________________________________________________ Carl Thrushman, P.E. License No. 86499 Company ID No. 9496 9.A.4.e Packet Pg. 984 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Table of Contents Introduction and Methodology ..................................................................................................................................2 Existing Trip Generation .............................................................................................................................................3 Proposed Trip Generation ..........................................................................................................................................3 Net New Trip Generation ...........................................................................................................................................4 Net New Trip Distribution and Assignment ................................................................................................................4 Net New Concurrency Analysis ..................................................................................................................................5 Net New Significance Test ..........................................................................................................................................6 Proposed Operational and Turn-Lane Analysis ..........................................................................................................7 Conclusion ..................................................................................................................................................................9 Appendix A: Traffic Analysis Summary prepared for the Conditional Use application CU-2002-AR-3537 Appendix B: Methodology Meeting Notes 9.A.4.e Packet Pg. 985 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 2 Introduction and Methodology Stewart Mining is an existing 218.97-acre rock quarry site located at 2315 Edwards Grove Road, Immokalee, Collier County. More specifically, the site is located in the southwest quadrant of SR-82 and SR-29; approximately one mile south of SR-29. The existing quarry is proposing to expand their rock/sand supply by adding the 231.73-acre parcel to the immediate west. The new site is currently zoned Agriculture and used as a produce farm. Refer to Figure 1 below for the project location. The SIC associated with this project is 1442- Mining construction sand and gravel. This document entails a “Small Scale Study” T.I.S. The overall analysis is based on the previously approved Traffic Analysis Summary (Appendix A) prepared for the previously approved Conditional Use application CU-2002-AR-3537. The site’s operational parameters have been updated herein. Also, per coordination with County zoning staff, the methodology notes from PL20170003512 are to be carried forward to this C.U. application- PL20190000808. The existing and proposed rock quarry will continue to use the single existing access point on SR-82. Concurrency will be analyzed for both SR-82 and SR-29 in the peak hour, peak direction to ensure the net new trips will not create an adverse effect on the adjacent roadways. The total proposed trips will be evaluated for operational and turn-lane analysis. Figure 1: Project Location Exist. Site Prop. Expansion Access Intersection 9.A.4.ePacket Pg. 986Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road 3 Existing Trip Generation The existing vested trips for the quarry were previously reviewed and approved by Collier County under CU-2002-AR-3537. The original calculations are provided in Appendix A. Existing Trip Generation: Truck Traffic (Average Daily) = 207 two-way trips Truck Traffic (Peak Hour) = 23 two-way trips [12 enter; 12 exit] Employee Traffic (Average Daily) = 10 two-way trips Employee Traffic (AM Peak Hour) = 5 enter; 0 exit Employee Traffic (PM Peak Hour) = 0 enter; 5 exit Proposed Trip Generation The unique functionality of the development reveals that only truck traffic enters and exits the site at a 1:1 ratio during site specific hauling hours; whereas, employee traffic only enters the site during the A.M. and only exits the site during the P.M. It is important to note that only the site-specific “P.M. peak hours” overlap with the County’s established peak hours of 4-6 p.m. The site’s peak hours are based on business records/sales tickets. The proposed trips will be analyzed for operational and turn-lane maneuvers. Proposed Site Parameters: Estimated Excavated Volume Per Year = 1,630,000 cy Truck Volume = 16 cy Number of Employees = 15 Hauling Hours = 6 a.m. to 6 p.m. per day for 250 days per year Site Specific Peak Hours = 9-11 a.m. and 3-5 p.m. Proposed Trip Generation: Truck Traffic (Average Daily) = 1,630,000 cy / 250 days per year / 16 cy per truck = 408 two-way trips per day Truck Traffic (Peak Hour) = 34 two-way trips per hour [17 enter; 17 exit] Employee Traffic (Average Daily) = 30 two-way trips per day Employee Traffic (AM Peak Hour) = 15 enter; 0 exit Employee Traffic (PM Peak Hour) = 0 enter; 15 exit 9.A.4.ePacket Pg. 987Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road 4 Net New Trip Generation The net new trips will be analyzed for concurrency since the existing trips were previously vested for concurrency with the approval of C.U. PL20190000808. Net New Trip Generation: Total Traffic (Average Daily) = 438 proposed trips – 207 existing trips = 231 trips per day Truck Traffic (Peak Hour) = 11 two-way trips [6 enter; 6 exit] Employee Traffic (Average Daily) = 20 two-way trips Employee Traffic (AM Peak Hour) = 10 enter; 0 exit Employee Traffic (PM Peak Hour) = 0 enter; 10 exit Net New Trip Distribution and Assignment Traffic distribution and assignment is based on a recent site evaluation of traffic circulation. The table below and figure on the following page show the net new peak hour traffic distribution analyzed for concurrency and roadway significance test. Table 1: Net New Peak Hour Traffic Distribution Peak Hour, One-way Trips (Enter) Peak Hour, One-way Trips (Exit) Net New Peak Hour, Two-way Trips Total* 60% South on SR-82 40% North on SR-29 Total* 60% North on SR-82 40% South on SR-29 AM Peak Hour 21 16 10 6 11 7 4 PM Peak Hour 21 11 7 4 16 10 6 *Truck traffic enters and exits the site at a 1:1 ratio during working hours; whereas, employee traffic only enters the site during the a.m. and only exits the site during the p.m. (11 truck two-way trips + 10 employee one-way trips = 21 vph). 9.A.4.ePacket Pg. 988Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road 5 Figure 2: Net New Peak Hour Traffic Distribution Net New Concurrency Analysis Per Collier County’s TIS guidelines, conditional use applications are required to calculate the traffic growth rate from the current 2019 AUIR data plus background growth to the 5-year horizon. Table 2, on the follow page, reveals this calculation for both Links 86.0 and 88.0. The peak direction for both links, per 2019 AUIR, is south. According to Collier County’s 2019 AUIR, SR-82 is expected to be deficient in the year 2023. SR-29 (40%) AM Enter (North): 6 AM Exit (South): 4 PM Enter (North): 4 PM Exit (South): 6 SR-82 (60%) AM Enter (South): 10 AM Exit (North): 7 PM Enter (South): 7 PM Exit (North): 10 9.A.4.ePacket Pg. 989Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road 6 Table 2: 5-year Horizon Projected Growth Rate (Based on Collier County Historical AUIR Data) Link From To Peak Hour, Peak Direction (South) Volume Actual Growth Rate Min. Growth Rate¹ 2024 Pk Hr, Pk Dir Growth Vol. 2014 2015 2016 2017 2018 2019 86.0 (SR-29) CR-29A North SR-82 510 560 620 620 630 620 4.1 2.0 829 88.0 (SR-82) Lee County Line SR-29 570 690 710 650 740 750 5.9 2.0 1,003 1 The growth rate is based on the greater of 2.0% or Actual Calculated Growth Rate, as required by Collier County's TIS Guidelines. Table 3 reveals that Link 86.0 (SR-29) remains within capacity to the 5-year horizon plus site generated trips. It also reveals that Link 88.0 (SR-82) is not within capacity, regardless of site generated trips. However, the 2019 AUIR indicates state funds have been issued for widening the roadway during the fiscal year 2020 which will increase the service capacity. Table 3: Net New Peak Hour, Peak Direction LOS Link Analysis Link From To Peak Hour, Peak Direction (South) Traffic Service Volume* Within Capacity? 2024 Growth Volume Project Traffic (Southbound) 2024 Volume (Project + Growth Volume) 86.0 (SR-29) CR-29A North SR-82 829 6 835 850 Yes 88.0 (SR-82) Lee County Line SR-29 1,003 10 1,013 850 No *Link 88.0 widening project during fiscal year 2020. Net New Significance Test As shown in Table 4 the adjacent concurrency links are not found to be significantly impacted during the by the net new trips during the peak hour. The net new trips generated by the development will have a maximum of only 1.18% impact on SR-82 (southbound). 9.A.4.ePacket Pg. 990Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road 7 Table 4: Net New Peak Hour, Peak Direction Significance Test Link From To Lanes Existing LOS 2019 Service Volume Network Peak Direction Net New Peak Hour Trips % Impact SR-29 CR-29A North SR-82 2-Undivided C 850 South 6 0.70 SR-82 Lee County Line SR-29 2-Undivided C 850 South 10 1.18 Proposed Operational and Turn-Lane Analysis As previously mentioned, the expansion development will access the site via the existing Edwards Grove Road connection to SR-82. There are two existing turn-lanes on SR-82: northbound and southbound. Both turn-lanes are ±450 linear feet with an additional 50-foot taper. Per the previously established distribution split, the total proposed trips anticipated to utilize the existing turn-lanes are presented in Table 5 below and Figure 3 on the following page. Proposed Trip Generation: Truck Traffic (AM Peak Hour) = 17 enter; 17 exit Truck Traffic (PM Peak Hour) = 17 enter; 17 exit Employee Traffic (AM Peak Hour) = 15 enter; 0 exit Employee Traffic (PM Peak Hour) = 0 enter; 15 exit Table 5: Operational Analysis at Existing Turn-Lanes Proposed Peak Hour, One-way Trips (Enter) Total 60% South on SR-82 40% North on SR-29 AM Peak Hour 32 19 13 PM Peak Hour 17 10 7 9.A.4.ePacket Pg. 991Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road 8 Figure 3: Operational Analysis at Existing Turn-Lanes The surrounding lands are also zoned Agriculture and used as produce farms, so it is assumed the potential operational movements generated by surrounding developments are minimal. Therefore, the existing turn-lanes will continue to meet/exceed the minimum requirements for turn-lane construction per Collier County Administrative Code AC-11-4 and FDOT guidelines. No right-of-way improvements are required or proposed at this time. SR-29 (40%) AM Enter: 13 trips PM Enter: 7 trips SR-82 (60%) AM Enter: 19 trips PM Enter: 10 trips 9.A.4.ePacket Pg. 992Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road 9 Conclusion The existing quarry is proposing to expand their rock/sand supply by adding the 231.73-acre parcel to the immediate west. The development will continue to use the single existing access point on SR-82. The proposed expansion will not create any adverse effects on the surrounding roadways. The existing turn-lanes on SR-82 at the project location exceed the minimum length requirements for the proposed trips. The project’s total proposed peak hour, two-way, trips will be held to a maximum trip cap of 49 vph. 9.A.4.ePacket Pg. 993Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road 10 Appendix A Traffic Analysis Summary prepared for the Conditional Use application CU-2002-AR-3537 9.A.4.ePacket Pg. 994Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Stewart Earth Mining Traffic Analysis Summary December 20, 2002 Revised-May 10, 2003 Introduction Stewart Earth Mining is a proposed commercial excavation of a 203 acre lake located approximately 1.25 miles southwest of the intersection of S.R. 29 and S.R. 82 Northwest of Immokalee. The trucks entering and leaving the proposed excavation will use an existing agricultural road which currently serves the site (the site is an existing citrus grove). The existing road intersects with S.R. 82 approximately 1 mile north of the site. Approximately 80% of the truck traffic hauling from the fill pit will travel west on S.R. 82 and the other 20% will travel east on S.R. 82 to S.R. 29 and go south. This assignment was determined by observation of truck trips at the driveway of a fill pit located in Hendry County approximately 5 miles west of the subject driveway. Trip Generation Conditions Estimated Excavated Volume Per Year = 930,000 C.Y. Truck Volume = 18 C.Y. Hours of Operation = 9 hours per day for 250 days per year Generation: Truck Traffic 930,000 C.Y./ 250 Day per Year / 9 Hours per Day / 18 C.Y. Yards per Truck Peak Hour = 23 Two-Way Trips Per Hour ADF = 207 Two-Way Trips Per Day Employee and service Peak hour one way trips 7 to 8 am and 4 to 5 pm 5 One Way Trips Per Peak Hour Total Trips Peak Hour 22 AM Peak Hour Trips Entering 17 AM Peak Hour Trips Exiting 17 PM Peak Hour Trips Exiting 22 PM Peak Hour Trips Exiting ADF 217 Two Way Trips Per Day Conclusion Because of the nature of the proposed truck traffic we expect turn lanes to be required. The cost for constructing these turn lanes will be provided by the owner. 9.A.4.e Packet Pg. 995 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 11 Appendix B Methodology Meeting Notes 9.A.4.ePacket Pg. 996Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road 4365 Radio Road ∙ Suite 201 ∙ Naples, FL 34104 ∙ P: (239) 434.6060 ∙ F: (239) 434‐6084 1990 Main Street ∙ Suite 750 ∙ Sarasota, FL 34236 ∙ P: (941) 309‐5180 Civil Engineering • Planning • Permitting www.davidsonengineering.com Methodology Notes Review Stewart Mining Collier County, FL Condition Use Application #PL20170003512 PREPARED BY: Davidson Engineering, Inc. 4365 Radio Road, Suite 201 Naples, Florida 34104 January 5, 2018 9.A.4.e Packet Pg. 997 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) STEWART MINING METHODOLOGY NOTES Date: 1-5-2018 Location: Via email People Attending: 1) Stephen Baluch, PE; CC Transportation Engineering Review 239-252-2361 2) Krystle Weems, Engineer, Davidson Engineering 239-434-6060 Study Preparer: Preparer’s Name and Title: Krystle Weems, Engineer Organization: Davidson Engineering, Inc Address & Telephone Number: 4365 Radio Road, Suite 201, Naples, Florida 34104 Reviewer(s): Reviewer’s Name & Title: Stephen Baluch, PE; CC Transportation Engineering Review Collier County Transportation Planning Department Applicant: Applicant’s Name: Tippen Bay Properties, LLLP Address: PO Box 2357, LaBelle, Florida Proposed Development: Name: Stewart Mining Location: 2315 Edwards Grove Road, Immokalee (See location map next page) Land Use Type: Mining quarry/commercial excavation ITE Code #: N/A; Traffic generation based on previously prepared TIS (Exhibit A) and CU-2002-AR-3537 Conditions (Exhibit B) for truck and employee traffic assumptions. Description: Existing ±203-acre mining quarry to be expanded by ±231.8 acres to increase excavation material supply. No additional truck trips/employees/or working hours are proposed. Zoning Existing: A-MHO-RLSAO Study Type: Small Scale TIS Minor TIS Major TIS Study Area: Concurrency Analysis: 2017 AUIR Link 86.0 - SR-29 (CR-29A North to SR-82) and Link 88.0 – SR-82 (Lee County Line to SR-29) Operational Roadways: SR-82 and Edwards Grove Road feature existing ±500’ left and right turn lanes on SR-82 Horizon Year(s): 2018 Analysis Time Period(s): Weekday, AM, and PM traffic 9.A.4.e Packet Pg. 998 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Source of Trip Generation Rates: N/A; Traffic generation based on previously prepared TIS and CU-2002-AR-3537 Conditions for truck and employee traffic assumptions. Horizon Year Roadway Network Improvements: No improvements listed for 2018-2019 on SR-82 near the project intersection. Methodology & Assumptions: Site-trip generation: Total Two-way Weekday = 217 trips (Truck: 207; Employee: 10) See attached Appendix A for original traffic calculations. Two-way AM = 39 trips (Enter: 22; Exit: 17) See attached Appendix A for original traffic calculations. Two-way PM = 39 trips (Enter: 17; Exit: 22) See attached Appendix A for original traffic calculations. Trip distribution method: 80% west on SR-82 and 20% East on SR-82 continuing South on SR-29. Traffic growth rate: 2017 AUIR + Background Growth to 5-year Horizon. Turn-Lane Analysis: There are existing ±500’ left and right turn lanes at the intersection of SR-82 and Edwards Grove Road. Exist. Site Prop. Expansion 9.A.4.e Packet Pg. 999 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Special Features: (from preliminary study or prior experience) None. 20%East/South AM In‐ 4 trips AM Out‐ 3 trips PM In‐ 3 trips PM Out‐ 4 trips 80% West AM In‐ 18 trips AM Out‐ 14 trips PM In‐ 14 trips PM Out‐18 trips 9.A.4.e Packet Pg. 1000 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Stewart Earth Mining Traffic Analysis Summary December 20, 2002 Revised-May 10, 2003 Introduction Stewart Earth Mining is a proposed commercial excavation of a 203-acre lake located approximately 1.25 miles southwest of the intersection of S.R. 29 and S.R. 82 Northwest of Immokalee. The trucks entering and leaving the proposed excavation will use an existing agricultural road which currently serves the site (the site is an existing citrus grove). The existing road intersects with S.R. 82 approximately 1 mile north of the site. Approximately 80% of the truck traffic hauling from the fill pit will travel west on S.R. 82 and the other 20% will travel east on S.R. 82 to S.R. 29 and go south. This assignment was determined by observation of truck trips at the driveway of a fill pit located in Hendry County approximately 5 miles west of the subject driveway. Trip Generation Conditions Estimated Excavated Volume Per Year = 930,000 C.Y. Truck Volume = 18 C.Y. Hours of Operation = 9 hours per day for 250 days per year Generation: Truck Traffic 930,000 C.Y./ 250 Day per Year / 9 Hours per Day / 18 C.Y. Yards per Truck Peak Hour = 23 Two-Way Trips Per Hour ADF = 207 Two-Way Trips Per Day Employee and service Peak hour one-way trips 7 to 8 am and 4 to 5 pm 5 One Way Trips Per Peak Hour Total Trips Peak Hour 22 AM Peak Hour Trips Entering 17 AM Peak Hour Trips Exiting 17 PM Peak Hour Trips Exiting 22 PM Peak Hour Trips Exiting ADF 217 Two Way Trips Per Day Conclusion Because of the nature of the proposed truck traffic we expect turn lanes to be required. The cost for constructing these turn lanes will be provided by the owner. 9.A.4.e Packet Pg. 1001 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU))EXHIBIT A RESOLUTION NO A RESOLUTION PROVIDINGFOR THE ESTABLISHMENT OF CONDITIONAL USE I FOR EARTHMINING IN THE A MHO RURAL AGRICULTURAL ZONING DISTRICT WITH MOBILE HOME OVERLAY PURSUANT TO SECTION OF THE COLLIER COUNTY LAND DEVELOPMENT CODE FOR PROPERTY LOCATED IN SECTIONS AND TOWNSHIP SOUTH RANGE EAST COLLIER COUNTY FLORIDA WHEREAS the Legislature of the State of Florida in Chapter Laws of Florida and Chapter Florida Statutes has conferred on Collier County the power to establish coordinate and enforce zoning and such business regulations as are necessary for the protection of the public and WHEREAS the County pursuant thereto has adopted a Land Development Code Ordinance No which includes a Comprehensive Zoning Ordinance establishing regulations for the zoning ofparticular geographic divisions of the County among which isthe granting of Conditional Uses and WHEREAS the Collier County Planning Commission being the duly appointed and constituted planning board for the area hereby affected has held a public hearing after notice as in said regulations made and provided andhas considered the advisability of Conditional Use of Section of the Collier County Land Development Code for earthmining inan A MHO Rural Agricultural Zoning District with Mobile Home Overlay on the property hereinafter described and has found as amatter of fact Exhibit A that satisfactory provision and arrangement have been made concerning all applicable matters required by said regulations and inaccordance with Subsection of the Land Development Code tor the Collier County Planning Commission and WHEREAS all interested parties have been given opportunity to be heard bythis Board in a public meeting assembled and the Board having considered all matters presented NOW THEREFORE BE IT RESOLVED BY THE BOARD OF ZONING APPEALS OF COLLIER COUNTY FLORIDA that The petition filed by Jeff Davidson P E of Davidson Engineering Inc representing Stewart Mining Industries Inc with respect to the property hereinafter described as Exhibit B which is attached hereto and incorporated by reference herein 9.A.4.e Packet Pg. 1002 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU))EXHIBIT B ti be and the same is hereby approved for Conditional Use I ot Section of the Collier County Land Development Code in an A MHO Rural Agricultural Zoning District with Mobile Home Overlay for earthmining inaccordance with the Conceptual Master Plan Exhibit Cand subject to the following conditions Exhibit D which is attached hereto and incorporated by reference herein BEIT FURTHER RESOLVED that this Resolution berecorded in the minutes of this Board This Resolution adopted after motion second and super majority vote Done this Zn lday ofBOAR OF NING COLLIE UNTY BY TOM HENNING CHAIRM ATTEST jDWlyHT E BROCK CLERK Atti IS ChlfrIIIJI S sfan lyre ll Approveo asJo Form andLegalSufficiencyb I A tL rnMal orMStudent Assistant County Attorney CU AR FRIsp 9.A.4.e Packet Pg. 1003 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) i ru FINDINGS OF FACT BY COLLIER COUNTY PLANNING COMMISSION FOR A CONDITIONAL USE PETITION FOR CU AR The following facts are found Subsection of the Land Development Code authorizes the conditional use Granting the conditional use will not adversely affect the public interest and will notadversely affect other property or uses in the same districtorneighborhoodbecauseofAConsistencywiththeLandDevelopmentCodeandGrowthManagement Plan Yes f No B Ingress and egress toproperty and proposed structures thereon with particular reference toautomotive and pedestrian safety and convenience traffic flowandcontrolandaccessincaseoffireorcatastropheAdequateingressegressXYesNoCAffectsneighboringproperties inrelation to noiseglare economic or odor effects No affect or Affect mitigated by Affect cannot bemitigated D Compatibility with adjacent properties and other property in the district Compatible use within district Yes V No Based on the above findings this conditional use should with stipulations copy attached should not be recommended for approval DATE y CHArRMAN iCjCTEXHIBITAr 9.A.4.e Packet Pg. 1004 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) CU AR DESCRIPTION as provided by client A tract of land located In the Southeast quarter of Section Township South Range and the Northeast quarter Section Township South Range East Collier County FI further described os follows to wit Beginning at the Northeast corner of Section Township South Range East thence S degrees West Basis for bearing assumed along the East line of said Section a dlstc of feet to a concrete monument being the East quarter comer of SectIon thence degrees West along the South line of the Northeast quarter a distance of fthence North degrees West a distance of feet thence South degrees West a distance of feet thence North degrees West a distance of f to apoint on the East West quarter quarter line of th e outheast quarter of Section Towr South Range East thence North degrees East along sold quarter quarter IIn distance of feet to a concrete monument being the East quarter quarter corner of so Southeast thence South degrees West olong the East line of SectIon a dlst of feet to the Point of Beginning LESS AND EXCEPT from sold tract the East feet thereof EXHIBIT B 9.A.4.e Packet Pg. 1005 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) l zfrCAeltiii URAL ZlNNG h lllllllllllillllIIIIraIIIPIIIIPIIIIIII I I II IINI II I I I I rF I I I IIIIIIIIIIIigs I I i l i U C IIfli Jol I I I eo I JI IaHi I I II IilIJhlnjiiif lil e ItikStmIiliiiirJrjIliffIm J IIiifj JiIrJlrfJfIrbiHd tg nJi r i ro alJ f t fr II IrUJ gisCIaJ o Oni t iItirfiITj l ftIJ a iiz iii p JtiJJf g I r i I l l J r J lII i Ill t F IntI J I il r i I j l l II I F j ft j t I if i i fl I rt I il i t I I i jt I t i Q f rf r J t CI f I i l r t i i el iIS f i Iiiiiiilu 9.A.4.ePacket Pg. 1006Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road i CU AR CONDITIONS The Petitioner shall obtain a South Florida Water Management District Agricultural Surface Water Management Permit or permit modification for this site if applicable The site shall be cleared of all exotic vegetation and maintained exotic free in perpetuity The petitioner shall pave the access road from State Road to the subject property line prior to commencement of earthmining operations The pavement shall bea minimum of feet in width and a depth of inches of asphalt or asphalt millings The petitioner shall be responsible for maintenance of the access road for the duration of the operation Turn lanes on SR westbound left in eastbound right in shall be provided prior to commencement of earthrnining operations Excavation activities are permitted from AM until PM Monday through Saturday The excavation shall becontained by a berm constructed to the height of the year flood elevation Unless the berm contains adequate clay content to slow the flow of water as determined by the Collicr County Engineering Services Department the berm shall contain a membrane impervious to water A landscaped berm feet in height shall be constructed adjacent to parcels zoned residential within months of the adjacent parcel being rezoned The easternmost feet of the parcel shall be reserved for right of way and shall bedeeded to Collier County at no cost to Collier County within days of receipt of notification by the Collier County Transportation Services Department that the property is needed for the purpose of providing a right of way connection from Westclox Road to State Road EXHIBIT D 9.A.4.e Packet Pg. 1007 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1008 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU))EXHIBIT C 9.A.4.e Packet Pg. 1009 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1010 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1011 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1012 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1013 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1014 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1015 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1016 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1017 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1018 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1019 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1020 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1021 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1022 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1023 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1024 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1025 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1026 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1027 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1028 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1029 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1030 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1031 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.ePacket Pg. 1032Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road 9.A.4.ePacket Pg. 1033Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road ENVIRONMENTAL DATA REPORT EDWARDS GROVE ROAD SAND MINE, WEST EXPANSION CONDITIONAL USE APPLICATION #CU-PL20170003512 COLLIER COUNTY, FLORIDA Submitted to: COLLIER COUNTY Growth Management Department Development Review Division Development Services Building 2800 Horseshoe Drive N Naples, FL 34104 Prepared for: 2875 Jupiter Park Drive, Suite 1100 Jupiter, FL 33458 Prepared by: 3663 Lake Center Drive Mount Dora, FL 32757 November 2019 Updated March 2020 20193253.001A/02 | MOU19R103395 Rev 1 9.A.4.e Packet Pg. 1034 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 2 TABLE OF CONTENTS 1.0 INTRODUCTION 2.0 OVERALL PROJECT DESCRIPTION 3.0 PROJECT AREA CONDITIONS 3.1 Land Use and Cover Types 3.2 Native Vegetation 3.3 Wetlands and Other Surface Waters 3.4 Listed Species 3.4.1 Listed Plants 3.4.2 Listed Wildlife 4.0 RURAL LANDS STEWARDSHIP AREA 5.0 SOILS AND GROUNDWATER QUALITY LIST OF FIGURES Figure 1: Project Location Map Figure 2: Existing Land Use Map Figure 3: 1968 Aerial Image Figure 4: Wood Stork Colony Location Map Figure 5: USFWS Florida Panther Focus Area Map Figure 6: Florida Panther Telemetry Map Figure 7: Black Bear Range Map Figure 8: Listed Species Survey Map Figure 9: USFWS Caracara Nesting/Sightings Map LIST OF ATTACHMENTS Attachment 1: Bill Newlon’s Resume Attachment 2: Stormwater Management Calculations Attachment 3: FNAI Biodiversity Matrix Measures Attachment 4: Eastern Indigo Snake Standard Protection Attachment 5: Soils and Water Quality Sampling Results 9.A.4.e Packet Pg. 1035 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 3 1.0 INTRODUCTION The following environmental data was prepared to meet the requirements of Section 3.08.00 of the Collier County Land Development Code (LDC) in association with a proposed mining expansion at the Edwards Grove Road Sand Mine (the project). The information was requested on July 25, 2018 by the Collier County Development Review Division in association with Conditional Use (CU) application No. CU-PL20170003512. An environmental assessment was originally conducted by Kleinfelder on August 23, 2017 for the project. This field assessment was updated on March 3, 2020 in response to comments, dated February 14, 2020, received from Collier County Growth Management Department. The original environmental assessment report has been updated in accordance with the recent field activities as requested. The environmental data herein was prepared by Bill Newlon, a Senior Environmental Scientist with Kleinfelder. Pursuant to Section 3.08.00.A.2., the minimum academic credentials and experience required in association with the preparation of the environmental data submittal requirements include a Bachelor’s degree or higher in one of the biological sciences and at least two years of ecological or biological professional experience in the state of Florida. Mr. Newlon meets these requirements with Bachelor and Master of Science degrees in wildlife biology and over 18 years of experience with wetlands, listed species, native vegetation, and natural resource management in Florida. A resume for Mr. Newlon documenting these academic credentials and experience has been included with this report as Attachment 1. 2.0 OVERALL PROJECT DESCRIPTION The project involves a westward expansion of the existing 219.0 acre Edwards Grove Road Sand Mine and CU boundary, which will add 231.7 acres of land to the project area resulting in a total CU area of 450.7 acres (Figure 1). Of the 219.0 acres associated with the existing mine, 183.70 acres have previously been authorized for mining, and an additional 220.69 acres are being proposed for mining in association with the 231.7 acre expansion. The existing sand mine and proposed expansion area are located approximately 1.25 miles southwest of the intersection of State Road 29 and State Road 82, northwest of Immokalee, in Sections 18 and 19, Township 46 South, Range 29 East, Collier County, Florida (Figure 1). Environmental impacts associated with the project are expected to be minimal because the entire project consists of land which was historically converted to citrus grove, and which continues to be managed and maintained as an active citrus operation to the west and mined to the east. No wetlands, native plants or communities, or listed species of plants or wildlife will be impacted. Best Management Practices, Erosion Control Measures, and Pollution Prevention Plan are in effect for the existing permit area and will continue to 9.A.4.e Packet Pg. 1036 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 4 be used during mining and reclamation in the expansion area to provide safeguards to public health, safety and welfare, and protect undisturbed natural resources. Existing water use on the project site involves a network of ditches with risers and corrugated pipes used to manipulate water levels as needed for citrus production. Water use for the proposed expansion will be the same as at the existing mining area where use is associated with the transport and processing of sand materials. Water associated with transport is used as a medium to pump dredged sand material through above ground pipes to the existing plant facility for processing. Water associated with processing is used to wash and remove undesirable material from the sand. Water used for transport and processing is recirculated back to the mine pit. No dewatering occurs in association with the mining operation and all stormwater runoff is and will be retained within the mine pit. Much of the existing mining and expansion areas are mapped as being within the 100-year flood zone. Because mining creates additional flood storage, onsite or offsite flooding resulting from project related impacts to mapped flood zone areas (Zone AH) is not anticipated. The mine pit will have sufficient storage to retain the 25 year – 72 hour design storm both during and after mining. A copy of the stormwater management plan approved in association with Environmental Resource Permit (ERP) No. MMR_228414-005 which depicts flood zone mapping and demonstrates stormwater capacity is provided as Attachment 2. ERP No. MMR_228414-005 was approved by the FDEP and subsequently withdrawn by the permittee in association with a corporate business decision. The stormwater management plan has been reviewed and approved in association with the modified permit, and a request to reissue this permit was recently submitted to the FDEP. 3.0 PROJECT AREA CONDITIONS An environmental site assessment to determine land use and cover types, and the presence of or potential for native vegetation, wetlands, and listed species within the proposed 450.7 acre CU area (Figure 1), which includes the existing mining (219.0 acres) and proposed mining expansion (231.7 acres) areas was conducted by Kleinfelder on August 23, 2017. An updated assessment for the mining expansion area was conducted on March 3, 2020. The findings of these assessments are provided as follows. 3.1 Land Use and Cover Types Existing land use types within the CU area were mapped over aerial imagery (2016) utilizing the Florida Land Use, Cover and Forms Classification System (FLUCFCS, FDOT 1999) (Figure 2). The CU area is found in a rural setting and consists primarily of existing sand mining and citrus operations. Pursuant to a review of historic imagery from 1968 (Figure 3), the entire CU area had been converted to a citrus grove over 50 years ago. Activities in the existing mining area to the east were initiated in 2006. Adjoining land uses currently include agriculture in all directions. The land use and cover types were unchanged between the 2017 9.A.4.e Packet Pg. 1037 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 5 and 2020 environmental assessments. Four FLUCFCS land use types in total were identified in the CU area, as detailed below: 160 Extraction (219.0 acres, 48.6%) The 219.0 acre eastern half of the CU area has been permitted as a sand mine, almost all of which has been disturbed by mining related activities. Areas within this land use area generally consist of an active mine pit with a wet-dredging operation, processing and storage areas, haul roads, perimeter berms, transition areas which have been disturbed by pre-mining clearing and grading, and setbacks. 221 Citrus Groves (220.6 acres, 48.9%) The western half of the CU area where the mining expansion is proposed consists of an actively maintained citrus grove operation. Numerous features such as primitive roads and pump houses are associated with the grove. Grove areas are regularly maintained and cleared of colonizing vegetation. Vegetative cover within the citrus grove was dominated by planted orange trees (Citrus spp.). Ground cover consisted of a variety of ruderal species such as Bermuda grass (Cynodon dactylon), crowfootgrass (Dactyloctenium aegyptium), dogfennel (Eupatorium capillifolium), natalgrass (Melinis repens), common ragweed (Ambrosia artemisiifolia), wild balsam apple (Momordica charantia), guineagrass (Panicum maximum), and Caesar-weed (Urena lobata). A low number (<25) of young, solitary cabbage palm (Sabal palmetto) trees were observed, mostly along the western boundary. 513 Man-Made Ditches (10.2 acres, 2.3%) A network of ditches was observed throughout the citrus grove in the western half of the CU area. These ditches appear to be used for water management purposes in association with the citrus grove. Ditches varied in size from approximately 2 to 20 feet in width. Ditches between grove sections were approximately 5-10 feet wide and a perimeter ditch along the western boundary was approximately 15-20 feet wide. Numerous risers and corrugated pipes connected grove ditches onsite, but no offsite surface water connectivity was identified during the site investigation. Small ditches approximately 2 feet in width were also present in between individual rows which appeared to assist with drainage. These ditches, however, had no indicators of regular hydrology, and as such, were included as part of the citrus grove instead of being mapped out separately. A shrub layer of colonial species was present along ditch banks which included eastern false-willow (Baccharis halimifolia), southern willow (Salix 9.A.4.e Packet Pg. 1038 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 6 caroliniana), and Brazilian pepper (Schinus terebinthifolius). Ground cover along the ditch banks was dominated by lantana (Lantana camara), guineagrass, primrose willow (Ludwigia peruviana), and Caesar-weed while a dense, overgrown layer of primrose willow was observed within the ditch interiors. Little to no standing water was observed in the ditches at the time of the field investigation. 740 Disturbed Land (0.9 acres, 0.2%) A disturbed area of land was located within the north-central part of the site, and the northeastern portion of the expansion area. This area appeared to be a staging, storage, and parking area for the citrus operation. Vegetation where present consisted of ruderal ground cover species such as beggar-ticks (Bidens pilosa), Bermuda grass, yellow nutsedge (Cyperus esculentus), natalgrass, guineagrass, smutgrass (Sporobolus indicus), and Caesar-weed. 3.2 Native Vegetation Due to the long-standing history and extent of citrus production and mining within the CU area, no natural areas or communities with native vegetation were observed, nor are anticipated which would be impacted by the sand mining expansion. According to the Conservation and Coastal Management Element (CCME) Policy 1.1.1 (8), parcels that were legally cleared of native vegetation prior to January 1989 shall be exempt from the native vegetation preservation requirement. No native vegetative communities are presently located onsite, and none have been present since the land was converted to agriculture at least 50 years ago (Figure 3). Since legal clearing of native vegetation throughout the entire site occurred prior to January 1989, it is exempt from the native vegetation requirement and is compliant with the CCME. Additionally, according to Section 10.02.06 C.1.d of the LDC, the entire site is exempt from having to obtain an agricultural clearing permit since it consisted of a bona fide agricultural operation prior to the effective date of Ordinance No. 76-42; thus, it is also in compliance with the LDC. 3.3 Wetlands and Other Surface Waters No state or federal jurisdictional wetlands were identified within the CU area pursuant to criteria found in Ch. 62-340, F.A.C., the Corps of Engineers Wetland Delineation Manual (1987), and the Regional Supplement to the Corps of Engineers Wetland Delineation Manual for the Atlantic and Gulf Coastal Plain Region (Version 2.0). A total of 10.2 acres of excavated ditches are present which are state jurisdictional but not federal jurisdictional since no significant nexus to Waters of the United States (WOTUS) was identified. The 10.2 acres of ditches will be impacted by the project. Of the 10.2 acres of ditch impacts, 10.1 9.A.4.e Packet Pg. 1039 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 7 acres are upland-cut and do not require mitigation pursuant to 10.2.2.2 of the Statewide ERP (SWERP) Applicant’s Handbook, Volume I. The remaining 0.1 acres is located within a hydric mapping soil unit (Basinger fine sand), and thus, is considered wetland-cut. Because of the minimal area of wetland-cut impacts, limited hydrology, heavy presence of exotic species, and fact the entire project site was converted to citrus grove no later than 1968, these impacts were considered de minimis in association with previously approved ERP No. MMR_228414-005, and no mitigation was required. Reclamation efforts will yield naturalistic lacustrine shoreline conditions, which will provide a permanent water source and natural community to support a wide diversity of wildlife species in the post reclamation condition. 3.4 Listed Species A preliminary listed species survey was conducted on August 23, 2017 within the proposed 450.7 acre CU boundary for the occurrence and potential for occurrence of floral or faunal species listed or otherwise protected by the Florida Department of Agriculture and Consumer Services (FDACS), Florida Fish and Wildlife Conservation Commission (FWC), United States Fish and Wildlife Service (USFWS), and Collier County. An updated preliminary listed species survey was conducted within the expansion area on March 3, 2020. Transects showing areas assessed during the updated survey are shown on Figure 8. Because the permitted CU area consists mostly of a mine lake surrounded by active mining areas which are highly disturbed, this area was not included in the updated survey. In addition to the preliminary site surveys, available database reviews and mapping were used to ascertain any previous documentation or likelihood of occurrence of FDACS, FWC, USFWS, and County listed or otherwise protected species. Specifically, reviews of the Florida Natural Areas Inventory (FNAI) Biodiversity Matrix (Attachment 3), FWC Eagle Nest Locator, and FWC/USFWS listed species records were conducted. The results of the preliminary listed species surveys are as follows: 3.4.1 Listed Plants Pursuant to a query of FNAI’s Biodiversity Matrix (Attachment 3), no state and/or federally listed native plant species or plants identified as rare or less rare in Chapter 3.04.03 of the Collier County Land Development Codes have been documented or are likely within Matrix Units 46139, 46140, 46511, and 46512, which are the one-square mile assessment areas in which the project is located. Pursuant to a review of historic imagery from 1968 (Figure 3), the entirety of the project site has been disturbed for over 50 years. Due to the site wide and long term persistence of citrus and mining related disturbances, the presence of state and/or federally listed plant species or native species considered rare or less rare by Collier County are not anticipated, nor 9.A.4.e Packet Pg. 1040 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 8 were any observed; thus, impacts to protected native plant species are not anticipated. 3.4.2 Listed Wildlife Pursuant to the FNAI Biodiversity Matrix (Attachment 3), one listed native wildlife species, the Florida panther (Puma concolor coryi), has been documented within the one-square mile matrix units in which the CU area is located. Four additional listed or otherwise protected native wildlife species, the Audubon’s crested caracara (Polyborus plancus audubonii), wood stork (Mycteria americana), mangrove fox squirrel (Sciurus niger avicennia), and Florida black bear (Ursu americanus floridanus) are considered by FNAI as “likely” to occur within these matrix units. One listed species, the gopher tortoise (Gopherus Polyphemus) and one otherwise protected species, the American alligator (Alligator mississippiensis), were observed on-site during the preliminary site surveys. Based on site characteristics, land use, and known geographic distribution and habitat requirements, listed or otherwise protected species that could be found in the CU area or adjacent lands in addition to the gopher tortoise and American alligator include the Florida panther, crested caracara, Florida black bear, wood stork, and eastern indigo snake (Drymarchon couperi). The presence of the mangrove fox squirrel and Florida scrub jay (identified by FNAI as a potential element) were determined to be unlikely onsite due to habitat limitations. The mangrove fox squirrel requires a variety of forested habitats including hardwood hammocks for food and cover while the Florida scrub jay is often found in abandoned citrus groves, but not those that are actively maintained as is the case onsite. Additionally, a search of the FWC Eagle Nest Locator did not detect any bald eagle nests nearby where associated protective buffers would be located onsite; thus, no impacts to this species are anticipated. The following provides additional information on the two listed or otherwise protected faunal species that have been identified onsite. American alligator The American alligator is listed as “Threatened” due to similarity of appearance (to the American crocodile (Crocodylus acutus)) by the USFWS and Federally-designated Threatened due to similarity of appearance by the FWC. Two American alligators were observed onsite within the perimeter ditch located along the western boundary of the mining expansion. The American crocodile is a coastal species and thus, misidentification of an American crocodile as an American 9.A.4.e Packet Pg. 1041 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9 alligator on this inland site is highly unlikely. While there are regulations related to the intentional feeding, harm, take, possession, or sale of individual alligators, nests, or eggs without appropriate licensing and permits, no developmental permitting restrictions are typically associated with the American alligator. Gopher Tortoise Pursuant to a query of FNAI Biodiversity Matrix, the gopher tortoise is a potential element within Matrix Units 46139, 46140, 46511, and 46512 (Attachment 3), in which the project is located. The gopher tortoise is listed as “Threatened” by the FWC and permits are required to impact areas containing tortoises or their burrows. Suitable habitat includes dry, sandy upland land uses and cover types, such as sandhills, scrub, xeric oak hammock, dry pine flatwoods, pastures, and abandoned groves. Based on the widespread land use disturbances, routine maintenance of the grove, low elevations and corresponding high water table, the likelihood of tortoises utilizing the project site is considered low, and would most likely be limited to berms along the perimeter and larger ditches and unmaintained grove areas at times of the year when the water table is depressed. During the March 2020 updated preliminary listed species surveys, three potentially occupied gopher tortoise burrows were observed (Figure 8). Two burrows were observed in a perimeter berm towards the northwestern boundary and one was observed in an unmaintained edge of the citrus grove to the south. No burrows were observed within the regularly maintained interior of the grove. In advance of mining related activities within the expansion area, surveys will be conducted pursuant to the FWC Gopher Tortoise Permitting Guidelines. Any potentially occupied gopher tortoise burrows occurring within the limits of disturbance will be addressed via permitting and relocation, per the FWC Gopher Tortoise Guidelines. Additional protected commensal species associated with the gopher tortoise have a low to moderate potential to utilize the property. These species are known as gopher tortoise burrow commensals and include species such as the gopher frog (Rana capito), and Florida mouse (Podomys floridanus). No commensal species were observed during the field review. Permitting and relocation of these protected species is generally addressed concurrently in association with the gopher tortoise permitting. Based on site characteristics, land use, and known geographic distribution and habitat requirements, the following species, which 9.A.4.e Packet Pg. 1042 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 10 have not been identified onsite, have the potential to occur on the project. Eastern Indigo Snake Pursuant to a query of FNAI Biodiversity Matrix, the eastern indigo snake is a potential element within Matrix Units 46139, 46140, 46511, and 46512 (Attachment 3), in which the project is located. The eastern indigo snake is listed as a “Threatened” species by the FWC and USFWS. It ranges over large areas often in the hundreds of acres over which it utilizes a mosaic of upland and wetland habitats, from scrub and sandhill to wet prairies and mangrove swamps. It will use most of the available habitats within its home range, but prefers open, undeveloped areas. The burrows of gopher tortoises are often used for denning as thermal refugia from winter cold and desiccating sandhill environments. Three potentially occupied gopher tortoise burrows were observed within the portion of the CU boundary proposed for expansion. The likelihood of occurrence onsite is considered low to moderate based on the rural nature of the surrounding area and the presence of only three gopher tortoise burrows over the entire parcel. As such, the USFWS’s Standard Protection Measures for the Eastern Indigo Snake will be used during site preparation and project construction. This will include an outline of the measures being incorporated, educational pamphlets, and signage (Attachment 4). All potentially occupied gopher tortoise burrows identified during future surveys conducted in advance of mining will be permitted and excavated prior to the initiation of site disturbance in the vicinity of the burrow. Any eastern indigo snakes which are encountered will be allowed to vacate the area prior to additional work in the burrow vicinity. Additionally, other underground refugia where eastern indigo snakes could be buried, trapped, and/or injured by mining activities will be identified and either excavated or inspected prior to work in the area. These measures along with the use of the USFWS’s standard protection measures should help to minimize impacts to this species, and as such, adverse effects are not anticipated. Wood Stork Pursuant to a query of the FNAI Biodiversity Matrix, the wood stork is a likely element within matrix units 46139, 46140, 46511, and 46512 (Attachment 3), in which the project is located. The wood stork is listed as “Threatened” by both the FWC and USFWS. Wood storks typically nest in rookeries found in stands of medium to tall trees, 9.A.4.e Packet Pg. 1043 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 11 particularly cypress, which occur along the edges of, or which form islands in large water bodies. Ideal habitat consists of a variety of inundated forested wetlands, including cypress strands and domes, mixed hardwood swamps, and sloughs. Foraging occurs in shallow marshes or artificial impoundments with fluctuating pools of open water that trap and concentrate prey items when water levels recede. The bulk of wood stork foraging occurs within an area designated by the USFWS as the core foraging area (CFA). The CFA is measured as a radial distance from the rookery. Pursuant to USFWS guidelines, the size of the CFA varies regionally across Florida, with CFA’s of 18.6 miles for rookeries in south Florida in which the expansion area is located. A review of the USFWS Wood Stork Nesting Colonies database revealed that the expansion area is located within three CFAs of known rookeries (Figure 4). Pursuant to Figure 2, a total of 10.2 acres of ditches are found onsite which are being proposed for impact within these CFA’s. These impacts consist primarily of upland-cut ditches that appear to have limited hydroperiods which rarely hold enough water to support permanent populations of fish (which make up the bulk of their diets) or other aquatic prey. Additionally, these ditches do not appear to be regularly maintained and are filled with a densely overgrown shrub and brush layer. As such, they do not appear to contain suitable wood stork foraging habitat; thus, the project is not anticipated to adversely affect this species. No mitigation was required from the state for impacts to these ditches in ERP No. MMR_228414-005 and since there is no significant nexus to WOTUS, these ditches are considered non-jurisdictional to the U.S. Army Corps of Engineers. Florida Panther The Florida panther is listed as “Endangered” by the USFWS and FWC. Panthers require an extensive mosaic of native plant communities, which are contiguous and largely forested to meet their social, reproductive, and energetic needs. Large wetlands generally inaccessible to humans are important for diurnal refuge. Improved land use areas located within a mosaic of natural communities are tolerated. Panther habitat selection is related to prey availability, which means they select habitats that make prey vulnerable to stalking and capturing. Dense understory vegetation provides some of the most important feeding, resting, and denning cover for panthers. A search of the FNAI biodiversity index indicated the Florida panther has been documented within Matrix Units 46139, 46140, 46511, and 46512 (Attachment 3), within which the project is located. According to the FWC’s wildlife maps, the project site exists within the secondary 9.A.4.e Packet Pg. 1044 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 12 Florida panther habitat zone (Figure 5). The Secondary Zone is defined as lands that are contiguous with the Primary Zone and although these lands are used to a lesser extent by panthers, they are important to the long-term viability and persistence of the panther in the wild. Panthers use these lands in a much lower density than those found in the Primary Zone. Pursuant to telemetry data received from the FWC (Figure 6), almost all panther activity in the area has occurred in association with Corkscrew Swamp to the southwest and west of the project. There are a minimal number of telemetry records in the vicinity of the project that are located outside of Corkscrew Swamp. All these records are located to the east and southeast of the project site and all except one are from older records dating back to the 1980’s and 1990’s. Most of the records from the 2000’s or later are associated with Corkscrew Swamp approximately 1.8 miles to the west. There is one record from the 2010’s on a property adjacent to the eastern boundary of the project; however, considering it is the only record, regular use of this habitat as part of a territorial range or travel corridor appears unlikely. Due to the lack of telemetry data recorded onsite and the rarity of data on surrounding properties, the project does not appear to be regularly used as part of a travel corridor or territorial range. Additionally, there are no natural habitats associated with the project or nearby. All land which will be impacted consists of altered land use areas, with little to no functional value, such as extraction areas, citrus grove, disturbed land, and man-made surface water ditches. Onsite mining would appear to be compatible with Chapter 3.04.02 of the Collier County Land Development Codes which discourages the destruction of native habitats preferred by the Florida panther such as pine flatwoods and hardwood hammocks by directing intensive land uses to currently disturbed areas. As such, the project as proposed is not anticipated to adversely affect this species. Audubon’s crested caracara The Audubon’s crested caracara (caracara) is listed as “Threatened” by the USFWS and FWC. The project is located within the USFWS consultation area for the caracara. Caracaras prefer large pasture expanses, grasslands, or prairies with numerous shallow ponds and sloughs for foraging and single to small clumps (2 to 10) of cabbage palm, live oak (Quercus virginiana), and/or cypress (Taxodium spp.) for nesting, with a strong preference for cabbage palm as the primary nest tree. Nests are typically constructed 4 to 18 meters off the ground. Caracaras are opportunistic feeders that eat carrion and capture live prey, including a wide variety of vertebrates and invertebrates. 9.A.4.e Packet Pg. 1045 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 13 A search of the FNAI biodiversity index indicated the caracara is likely to occur within Matrix Units 46139, 46140, 46511, and 46512 (Attachment 3), in which the project is located; however, the project consists primarily of citrus grove and extraction areas. Evidence of caracara activity was observed surrounding the project but not within the CU area. During the March 2020 updated assessment, one caracara pair was observed on a power pole to the northwest of the mining expansion, and one caracara individual was observed foraging in a pasture east of Edwards Grove Road. A low number (<25) of young, solitary cabbage palm trees were observed in the mining expansion, mostly along the western boundary. Six trees were observed with a height suitable to support nesting (>13 feet), five along the western boundary and one within the grove. These trees were inspected for nests during the original and updated surveys, and no nests were observed. A protective buffer of 1,500 meters is recommended around active caracara nests to avoid impacts to potentially occupied habitat. All land surrounding the expansion area consists of citrus grove. Land surrounding the active mining/existing CU area consists of a mix of citrus groves and other agricultural lands. Scattered, solitary palm trees were observed in the groves and other agricultural lands surrounding the existing mine/CU area and proposed mining expansion. As such, coordination was conducted with the USFWS to obtain the most current nesting data. Pursuant to USFWS data, the closest documented caracara nest is approximately 4834 feet (1473 meters) north of the northern boundary of the project (Figure 9). Due to the distance of the project from the nest, no impacts to nests or habitat occupied by this species is anticipated. Black Bear The Florida black bear (Ursus americanus floridanus) was de-listed by the FWC in August 2012, but is still protected by the Florida Black Bear Conservation Rule, 68A-1.004, F.A.C. According to the rule, no person is allowed to possess, injure, shoot, wound, trap, collect, or sell Florida black bears and the FWC is to provide comments to permitting agencies to minimize the impacts of land modifications on the conservation and management of black bears as outlined in the Florida Black Bear Management Plan. A search of the FNAI’s Biodiversity Matrix indicated the Florida black bear is a likely element within the matrix units 46139, 46140, 46511, and 46512 (Attachment 3), in which the project is located. Additionally, pursuant to the latest FWC mapping from 2016, Florida 9.A.4.e Packet Pg. 1046 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 14 black bear use onsite has been designated as “abundant” (Figure 7). This designation is indicative of areas within their range where records have shown that densities are highest, and bears spend the most amount of time. Such areas make up the core of bear populations, where evidence of reproduction is consistent, and comparable to areas previously designated as being within the primary range. The Florida black bear is known to utilize a variety of habitats including pine flatwoods, swamps and forested scrub and relies on contiguous forested expanses for cover and travel corridors. Bears main forage in Florida includes acorns, saw palmetto, and cabbage palm. Denning typically occurs in the ground surrounded by dense protective vegetation such as saw palmetto. The project consists of active citrus and mining operations, with no saw palmetto or other native vegetation. As such, limited cover, and no foraging or denning habitat exists onsite; thus, while the project is within a range where potential use is designated as “abundant”, the land uses onsite provide little in terms of habitat value and so, the proposed project is not anticipated to adversely affect this species. Based upon known geographic distribution and habitat requirements, no other floral or faunal species listed or otherwise protected by the county, state or federal governments are likely to be found onsite or affected by the proposed CU activities. While no significant habitat for county, state and/or federally listed species is known to be present or anticipated onsite due to the site wide and long-term persistence of agricultural and mining related disturbances, if any use by listed species is identified, Stewart Materials will comply with all requirements to avoid and/or minimize impacts and mitigate if necessary. 4.0 RURAL LANDS STEWARDSHIP AREA The following additional project information is being provided to demonstrate consistency with the policies related to the Rural Lands Stewardship Area (RLSA) Overlay which are found in the CCME of the Growth Management Plan (GMP). Applicable policies are listed and addressed as follows: Policy 1.3.2: The overall purpose and description of the Rural Stewardship program is defined in the Rural Lands Stewardship Area (RLSA) Overlay found in the Future Land Use Element. A Stewardship Credit system has been established that shall serve as the primary basis for the protection of Flowway Stewardship Areas (FSAs), Habitat Stewardship Areas (HSAs) and Water Retention Areas (WRAs). The RLSA Overlay also contains policies that shall direct incompatible land uses away from FSAs, HSAs and WRAs in order to protect wetlands, upland habitats and listed species within the RLSA. 9.A.4.e Packet Pg. 1047 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 15 No wetlands or native upland habitat communities are located onsite, and it appears none have been present since the land was converted to citrus historically which occurred at least 50 years ago (Figure 3). As indicated in Section 3.4, based on field observations of site characteristics, land use, and known geographic distribution and habitat requirements for listed species, no protected floral species or significant nesting or foraging habitat associated with faunal species listed by either the State or Federal government are likely to be found within the expanded CU boundary or be affected by the proposed activities. As such, the proposed land use associated with the mining expansion would not appear to be incompatible with the purpose of the Rural Stewardship program. Policy 6.1.3: For the County’s RLSA Overlay, as designated on the FLUM, native vegetation shall be preserved pursuant to the RLSA policies found in the Future Land Use Element. According to the CCME Policy 6.1.1 (8), parcels that were legally cleared of native vegetation prior to January 1989 shall be exempt from the native vegetation preservation requirement of Policy 6.1.3. No native vegetative communities are presently located onsite, and none have been present since the land was converted to citrus historically as evidenced by the 1968 aerial (Figure 3). As such, there is no native vegetation to preserve, and pursuant to Policy 6.1.5, the entire site is exempt from the preservation requirement as further detailed in the next response. Policy 6.1.5: Agriculture shall be exempt from the above preservation requirements contained in Policies 6.1.1, and 6.1.2 of this Element provided that any new clearing of land for agriculture shall not be converted to non- agricultural development for 25 years. For any such conversions in less than 25 years, the requirements of Policy 6.1.1 and 6.1.2 of this Element shall be applied to the site at the time of the conversion. The percentage of native vegetation preserved shall be calculated on the amount of vegetation occurring at the time of the agricultural clearing, and if found to be deficient, a native plant community shall be restored to re-create a native plant community in all three strata (ground covers, shrubs and trees), utilizing larger plant materials so as to more quickly re-create the lost mature vegetation. Agricultural clearing within the RLSA Overlay shall be allowed and guided by the RLSA policies found in the FLUE. All lands onsite had been converted to agriculture historically by 1968 as evidenced by the 1968 aerial provided as Figure 3. Additionally, mining as authorized under the existing CU has been ongoing in the eastern half of the site; thus, there are no new areas onsite which could be converted to agriculture. As such, the entire site should be exempt from the native vegetation preservation requirements of Policy 6.1.3. Policy 7.1.3: Listed species within the RLSA shall be protected pursuant to the RLSA Overlay policies within the Future Land Use Element. As indicated in Section 3.4, no listed species have been documented within the expanded CU boundary being proposed. Based on field observations of site 9.A.4.e Packet Pg. 1048 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 16 characteristics, land use, and known geographic distribution and habitat requirements for listed species, no protected plants or significant nesting or foraging habitat associated with wildlife species listed by the county, state, and/or federal government are likely to be found onsite or be affected by the proposed activities. 5.0 SOILS AND GROUNDWATER QUALITY Pursuant to Section 3.08.00.A.4.d.ii. of the LDC, soil and/or ground water sampling is required at the time of the first development order submittal for sites that occupy farm fields, including crop fields. Soils and water quality testing were both conducted in January 2018 as part of previously approved ERP No. MMR_228414-005. The State requested analyses because of the citrus operation which has been present on the project site dating back to at least 1968. Water quality sampling involved the collection of a surface water sample from at least two feet below the surface of the mine lake which was considered to be representative of the vicinity groundwater per guidance from the FDEP. The water sample was analyzed for mercury, specific conductivity, pH, chloride, sulfate, total dissolved solids (TDS), nitrate, nitrite, gross alpha, uranium, and combined radionuclides (radium-226 and radium-228). All parameters tested met the required water quality standards. For more information, please refer to the Soils and Water Quality Sampling Results provided as Attachment 5. While no water quality exceedances occurred with the preliminary water quality sampling, a groundwater quality monitoring program is being proposed to meet the criteria of Section 8.3.2 of the ERP Applicant’s Handbook, Volume I. Soil sampling involved the collection and compositing of six soil samples at depth intervals of 0-6”. Samples were analyzed for organochlorine pesticides (EPA Method 8081), organophosphorus pesticides (EPA Method 8141), chlorinated herbicides (EPA Method 8151), ethylene dibromide (EPA Method 8011), and copper and arsenic (EPA Method 6010). Organic Vapor Analysis (OVA) was also conducted in areas where there could be potential impacts from fuel storage, fueling, and maintenance, and proximal to any aboveground storage tanks (ASTs) and/or pump houses. Soils testing was also conducted in association with the OVA where applicable for volatile organic compounds (VOCs) (EPA Method 8260), semi-volatile organic compounds (SVOCs) (EPA Method 8270), total recoverable petroleum hydrocarbons (TRPH) (Florida Residual Petroleum Range Organics (FL-PRO) Method), and metals (arsenic, cadmium, chromium, and lead) (EPA Method 6010). Soil sampling testing determined no contaminants of concern were present above respective soil cleanup target levels. For additional information on soils testing and results please refer to Attachment 5. 9.A.4.e Packet Pg. 1049 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) FIGURES 9.A.4.e Packet Pg. 1050 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 219.8 ACRE EXISTING MINE 231.7 ACRE MINING EXPANSION SR 82 Lamm RDEdwards Grove RDJohn son RD Wombles RD R evello ST O Qui nn RD Experimental RD Project Location Location Map 1 20193253.001A 4/24/2020 NCD/NL AWN 20-0424--SMI EdwardsGrove CUP-Location.mxdwww.kleinfelder.com PROJECT NO. DRAWN: DRAWN BY: CHECKED BY: FILE NAME: FIGURE The information included on this graphic representation has been compiled from a variety of sources and is subject to change without notice. Kleinfelder makes no representations or warranties, express or implied, as to accuracy, completeness, timeliness, or rights to the use of such information. This document is not intended for use as a land survey product nor is it designed or intended as a construction design document. The use or misuse of the information contained on this graphic representation is at the sole risk of the party using or misusing the information. Sections 18 & 19, Township 46 South, Range 29 East Legend Conditional Use Permit Boundary (450.7 Ac.±) Source: 2019 2.0-foot Natural-Color Orthophotos obtained from Collier County Property Appraiser's Office. £ 1 inch = 1,000 feet 1,000 0 1,000500 Feet Document Path: \\Mountdora\mountdora-data\GISCAD\Stewart Mining\_2019\20193253.001A_SMI Requested Services CY 2019\02-0000 Immo kalee RS\20-0424--SMI EdwardsGrove CUP-Location.mxd; Plotted: 4/24/2020, 10:41:52 AM, NLawrence Stewart Materials, LLC Edwards Grove Road Sand Mine Conditional Use Permit Application Collier County, Florida 9.A.4.e Packet Pg. 1051 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 221 514 514 514 514 514 514 514 514 514 514 514 514 514 514 514 514 514 514 514 514 514 514 514514 514 514 514 514 514 514 514 740 221 221 221 221 221221 221 221 221 221 221 221221 221 221 221 514 160 Existing Land Use Map Stewart Materials, LLC Edwards Grove Road Sand Mine Conditional Use Permit Application Collier County, Florida 2 20193253.001A 4/24/2020 NCD/NL AWN 20-0424--SMI EdwardsGrove CUP-ExistingLU.mxdwww.kleinfelder.com PROJECT NO. DRAWN: DRAWN BY: CHECKED BY: FILE NAME: FIGURE The information included on this graphic representation has been compiled from a variety of sources and is subject to change without notice. Kleinfelder makes no representations or warranties, express or implied, as to accuracy, completeness, timeliness, or rights to the use of such information. This document is not intended for use as a land survey product nor is it designed or intended as a construction design document. The use or misuse of the information contained on this graphic representation is at the sole risk of the party using or misusing the information. Sections 18 & 19, Township 46 South, Range 29 East Legend Conditional Use Permit Boundary (450.7 Ac.±) Existing Land Use Source: Land Use and Land Cover information prepared by Kleinfelder. The Florida Land Use, Cover and Forms Classification System Handbook, January 1999, was utilized to determine the specific land use classifications. 2019 2.0-foot Natural-Color Orthophotos obtained from Collier County Property Appraiser's Office.£ 1 inch = 500 feet 500 0 500250 Feet Document Path: \\Mountdora\mountdora-data\GISCAD\Stewart Mining\_2019\20193253.001A_SMI Requested Services CY 2019\02-0000 Immo kalee RS\20-0424--SMI EdwardsGrove CUP-ExistingLU.mxd; Plotted: 4/24/2020, 10:50:03 AM, NLawrence FLUCFCS CODE LAND USE ACREAGE % 160 Extractive 219.0 48.6 221 Citrus Groves 220.6 48.9 514 Man-Made Ditches 10.2 2.3 740 Disturbed Land 0.9 0.2 Total 450.7 100.0 FLORIDA LAND USE, COVER AND FORMS CLASSIFICATION SYSTEM, 1999 9.A.4.e Packet Pg. 1052 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 1968 Aerial Image Stewart Materials, LLC Edwards Grove Road Sand Mine Conditional Use Permit Application Collier County, Florida 3 20193253.001A 4/24/2020 NCD/NL AWN 20-0424--SMI EdwardsGrove CUP-1968Aerial.mxdwww.kleinfelder.com PROJECT NO. DRAWN: DRAWN BY: CHECKED BY: FILE NAME: FIGURE The information included on this graphic representation has been compiled from a variety of sources and is subject to change without notice. Kleinfelder makes no representations or warranties, express or implied, as to accuracy, completeness, timeliness, or rights to the use of such information. This document is not intended for use as a land survey product nor is it designed or intended as a construction design document. The use or misuse of the information contained on this graphic representation is at the sole risk of the party using or misusing the information. Sections 18 & 19, Township 46 South, Range 29 East Legend Conditional Use Permit Boundary (450.7 Ac.±) Source: Black & White Aerial Photography obtained from the FDOT, Surveying and Mapping Office, Image Services. Photograph Date: 1968. Source Scale: Unknown. Aerial Photography was rectified by Kleinfelder utilizing 1995 Color IR Photography acquired from Florida Department of Environmental Protection - LABINS. £ 1 inch = 500 feet 500 0 500250 Feet Document Path: \\Mountdora\mountdora-data\GISCAD\Stewart Mining\_2019\20193253.001A_SMI Requested Services CY 2019\02-0000 Immo kalee RS\20-0424--SMI EdwardsGrove CUP-1968Aerial.mxd; Plotted: 4/24/2020, 10:53:28 AM, NLawrence 9.A.4.e Packet Pg. 1053 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) [® [® [® COLLIER COUNTY HENDRY COUNTY LEE COUNTY GLADES COUNTYCHARLOTTE COUNTY MONROE COUNTY Corkscrew Barron Collier Collier - Hendry SR 93 SR 29SR 90SR 45SR 82 SR 25SR 80 SR 78SR 739SR 8 84 SR 29SR 80 SR 45SR 739S R 8 0 Wood Stork Colony Location Map Stewart Materials, LLC Edwards Grove Road Sand Mine Conditional Use Permit Application Collier County, Florida 4 20193253.001A 4/24/2020 NCD/NL AWN 20-0424--SMI EdwardsGrove CUP-WoodStork.mxdwww.kleinfelder.com PROJECT NO. DRAWN: DRAWN BY: CHECKED BY: FILE NAME: FIGURE The information included on this graphic representation has been compiled from a variety of sources and is subject to change without notice. Kleinfelder makes no representations or warranties, express or implied, as to accuracy, completeness, timeliness, or rights to the use of such information. This document is not intended for use as a land survey product nor is it designed or intended as a construction design document. The use or misuse of the information contained on this graphic representation is at the sole risk of the party using or misusing the information. Sections 18 & 19, Township 46 South, Range 29 East Legend Conditional Use Permit Boundary (450.7 Ac.±) [®Wood Stork Nesting Colony 18.6 Miles Core Foraging Area (CFA) Source: Florida Wood Stork Nesting Colonies information obtained from the US Fish & Wildlife Service in the form of a Shapefile Feature Class. Source date: 2018. £ 1 inch = 6 miles 6 0 63 Miles Document Path: \\Mountdora\mountdora-data\GISCAD\Stewart Mining\_2019\20193253.001A_SMI Requested Services CY 2019\02-0000 Immo kalee RS\20-0424--SMI EdwardsGrove CUP-WoodStork.mxd; Plotted: 4/24/2020, 11:18:30 AM, NLawrence 9.A.4.e Packet Pg. 1054 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) USFWS Florida Panther Focus Area Map Stewart Materials, LLC Edwards Grove Road Sand Mine Conditional Use Permit Application Collier County, Florida 5 20193253.001A 4/24/2020 NCD/NL AWN 20-0424--SMI Edwards Grove CUP-PantherFocus.mxdwww.kleinfelder.com PROJECT NO. DRAWN: DRAWN BY: CHECKED BY: FILE NAME: FIGURE The information included on this graphic representation has been compiled from a variety of sources and is subject to change without notice. Kleinfelder makes no representations or warranties, express or implied, as to accuracy, completeness, timeliness, or rights to the use of such information. This document is not intended for use as a land survey product nor is it designed or intended as a construction design document. The use or misuse of the information contained on this graphic representation is at the sole risk of the party using or misusing the information. Sections 18 & 19, Township 46 South, Range 29 East Legend Conditional Use Permit Boundary (450.7 Ac.±) USFWS Florida Panther Habitat Zones Primary Secondary Source: FWC-FWRI (Florida Fish and Wildlife Conservation Commission-Fish and Wildlife Research Institute). £ 1 inch = 3,000 feet 3,000 0 3,0001,500 Feet Document Path: \\Mountdora\mountdora-data\GISCAD\Stewart Mining\_2019\20193253.001A_SMI Requested Services CY 2019\02-0000 Immo kalee RS\20-0424--SMI EdwardsGrove CUP-PantherFocus.mxd; Plotted: 4/24/2020, 11:32:14 AM, NLawrence 9.A.4.e Packet Pg. 1055 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) # # # # #### ## # # # # # # # # # # # # # * * * * **** ** * * * * * * * * * * * * * " " " " " " " " " "" " " "" " " ) ) ) ) ) ) ) ) ) )) ) ) )) ) ) $ $ $ $ $ $ $ $ $ $ $$ $ $ $ $$$ $ $ $ + + + + + + + + + + ++ + + + +++ + + + ! ! ( ( Florida Panther Telemetry Map Stewart Materials, LLC Edwards Grove Road Sand Mine Conditional Use Permit Application Collier County, Florida 6 20193253.001A 4/24/2020 NCD/NL AWN 20-0424--SMI Edwards Grove CUP-PantherTelemetry.mxdwww.kleinfelder.com PROJECT NO. DRAWN: DRAWN BY: CHECKED BY: FILE NAME: FIGURE The information included on this graphic representation has been compiled from a variety of sources and is subject to change without notice. Kleinfelder makes no representations or warranties, express or implied, as to accuracy, completeness, timeliness, or rights to the use of such information. This document is not intended for use as a land survey product nor is it designed or intended as a construction design document. The use or misuse of the information contained on this graphic representation is at the sole risk of the party using or misusing the information. Sections 18 & 19, Township 46 South, Range 29 East Legend Conditional Use Permit Boundary (450.7 Ac.±) Florida Panther Telemetry (1981-2018) #*1980's ")1990's $+2000's !(2010's Source: FWC-FWRI (Florida Fish and Wildlife Conservation Commission-Fish and Wildlife Research Institute). £ 1 inch = 4,000 feet 4,000 0 4,0002,000 Feet Document Path: \\Mountdora\mountdora-data\GISCAD\Stewart Mining\_2019\20193253.001A_SMI Requested Services CY 2019\02-0000 Immo kalee RS\20-0424--SMI EdwardsGrove CUP-PantherTelemetry.mxd; Plotted: 4/24/2020, 11:39:57 AM, NLawrence 9.A.4.e Packet Pg. 1056 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Black Bear Range Map Stewart Materials, LLC Edwards Grove Road Sand Mine Conditional Use Permit Application Collier County, Florida 7 20193253.001A 4/24/2020 NCD/NL AWN 20-0424--SMI Edwards Grove CUP-BlackBear.mxdwww.kleinfelder.com PROJECT NO. DRAWN: DRAWN BY: CHECKED BY: FILE NAME: FIGURE The information included on this graphic representation has been compiled from a variety of sources and is subject to change without notice. Kleinfelder makes no representations or warranties, express or implied, as to accuracy, completeness, timeliness, or rights to the use of such information. This document is not intended for use as a land survey product nor is it designed or intended as a construction design document. The use or misuse of the information contained on this graphic representation is at the sole risk of the party using or misusing the information. Sections 18 & 19, Township 46 South, Range 29 East Legend Conditional Use Permit Boundary (450.7 Ac.±) Black Bear Range Abundant Common Occasional Source: FWC-FWRI (Florida Fish and Wildlife Conservation Commission-Fish and Wildlife Research Institute), 2016. £ 1 inch = 15,000 feet 15,000 0 15,0007,500 Feet Document Path: \\Mountdora\mountdora-data\GISCAD\Stewart Mining\_2019\20193253.001A_SMI Requested Services CY 2019\02-0000 Immo kalee RS\20-0424--SMI EdwardsGrove CUP-BlackBear.mxd; Plotted: 4/24/2020, 11:45:01 AM, NLawrence 9.A.4.e Packet Pg. 1057 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) %%[¶ [¶ [¶ Listed Species Survey Map Stewart Materials, LLC Edwards Grove Road Sand Mine Conditional Use Permit Application Collier County, Florida 8 20193253.001A 4/24/2020 NL AWN 20-0424--SMI Edwards Grove CUP-ListedSppSurvey.mxdwww.kleinfelder.com PROJECT NO. DRAWN: DRAWN BY: CHECKED BY: FILE NAME: FIGURE The information included on this graphic representation has been compiled from a variety of sources and is subject to change without notice. Kleinfelder makes no representations or warranties, express or implied, as to accuracy, completeness, timeliness, or rights to the use of such information. This document is not intended for use as a land survey product nor is it designed or intended as a construction design document. The use or misuse of the information contained on this graphic representation is at the sole risk of the party using or misusing the information. Sections 18 & 19, Township 46 South, Range 29 East Legend Conditional Use Permit Boundary (450.7 Ac.±) %%Survey Transects [¶Potentially Occupied Gopher Tortoise Burrows (3) Source: 2019 2.0-foot Orthophotos obtained from the Collier Property Appraiser, Image Services in the form of MrSid format.£ 1 inch = 500 feet 500 0 500250 Feet Document Path: \\Mountdora\mountdora-data\GISCAD\Stewart Mining\_2019\20193253.001A_SMI Requested Services CY 2019\02-0000 Immo kalee RS\20-0424--SMI EdwardsGrove CUP-ListedSppSurvey.mxd; Plotted: 4/24/2020, 11:48:00 AM, NLawrence Note: Field survey was conducted on March 3, 2020. 9.A.4.e Packet Pg. 1058 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) kj kj kj kj [b 18328.4'±12739.2'±4833.9'±SR-29SR-82 N 15TH STIMMOKALEE D R CR890/LK TR AFFORD R D W MAIN STCARSON RDN E W M A R K E T R D WS 1ST STWESTCLOX ST N 1ST STUSFWS Caracara Nest and Observation Stewart Materials, LLC Edwards Grove Road Sand Mine Conditional Use Permit Application Collier County, Florida 9 20193253.001A 4/24/2020 NL AWN 20-0424--SMI EdwardsGrove CUP-Caracara.mxdwww.kleinfelder.com PROJECT NO. DRAWN: DRAWN BY: CHECKED BY: FILE NAME: FIGURE The information included on this graphic representation has been compiled from a variety of sources and is subject to change without notice. Kleinfelder makes no representations or warranties, express or implied, as to accuracy, completeness, timeliness, or rights to the use of such information. This document is not intended for use as a land survey product nor is it designed or intended as a construction design document. The use or misuse of the information contained on this graphic representation is at the sole risk of the party using or misusing the information. Sections 18 & 19, Township 46 South, Range 29 East Legend Conditional Use Permit Boundary (450.7 Ac.±) USFWS Caracara Nest & Observation kj Nest [b Observation Source: U.S. Fish & Wildlife Service. World Imagery was obtained from ESRI Basemap. Image origin: State of Florida. Date: 12/23/2018 & 12/24/2018. £ 1 inch = 3,000 feet 3,000 0 3,0001,500 Feet Document Path: \\Mountdora\mountdora-data\GISCAD\Stewart Mining\_2019\20193253.001A_SMI Requested Services CY 2019\02-0000 Immo kalee RS\20-0424--SMI EdwardsGrove CUP-Caracara.mxd; Plotted: 4/24/2020, 11:50:19 AM, NLawrence 9.A.4.e Packet Pg. 1059 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) ATTACHMENTS 9.A.4.e Packet Pg. 1060 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) ATTACHMENT 1 9.A.4.e Packet Pg. 1061 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) BILL NEWLON Senior Environmental Scientist / Project Professional Experience Summary Mr. Newlon has worked in the field of environmental planning and permitting for over 17 years with an extensive background in wetlands, listed species, and natural resource management. Wetland experience includes state and/or federal delineations, significant nexus evaluations, formal jurisdictional determinations, agency verifications, ordinary high water determinations, hydrologic monitoring, and quantitative functional assessments. Wetland work has been conducted throughout the state of Florida, and in other states including Georgia, Pennsylvania, Virginia, West Virginia, Michigan, North Carolina, and Utah. Listed species experience includes preliminary listed species assessments, a wide variety of species specific faunal and floral surveys, submerged aquatic vegetation surveys, wildlife consultation for listed state and federal species, rookery and bald eagle surveys/monitoring, gopher tortoise, bald eagle, FL scrub jay and wood stork permitting, and translocations of the gopher tortoise and burrow commensals, FL mouse, and giant orchid. Natural resource management experience includes habitat and land use mapping, environmental site assessments, state and federal environmental resource permitting, mitigation design and monitoring, aerial photographic interpretation, sovereign submerged lands investigations, water quality monitoring, compliance investigations/resolution, mitigation banking, and exotic/nuisance species maintenance. He has worked for a wide variety of clients in public and private sectors, including local government departments like the School Board, Public Works, Board of County Commissioners, and Parks and Recreation, private mining companies involved in the extraction of limestone, sand, phosphate, peat and heavy minerals, residential, commercial, industrial, and waterfront developers, and oil, natural gas, and solar energy providers. To serve those clients, he has worked with various agencies/departments across local, state and federal governments to secure entitlements and permits, like the Environmental Management, Building and Zoning, and Planning and Development Departments of various municipalities; the Fish and Wildlife Conservation Commission, Department of Environmental Protection (Division of State Lands, Bureau of Mining and Minerals Regulation, Environmental Resource Program, Wetland Evaluation and Delineation Section, Compliance and Enforcement, and Industrial Wastewater Program), and Water Management Districts (Northwest Florida, St. Johns, Southwest Florida, South Florida, and Suwannee) of the state government of Florida; and the Army Corps of Engineers, Environmental Protection Agency, and Fish and Wildlife Service of the federal government of the United States. Education  M.S., Wildlife Biology, University of New Orleans, 2001. Thesis research conducted on phenotypic parameters of a colonial tunicate, Botryllus schlosseri, found in a brackish estuarine river in Damariscotta, ME.  B.S., Wildlife Biology, Old Dominion University, 1997  B.A., Management – Entrepreneurship, Gettysburg College, 1991 9.A.4.e Packet Pg. 1062 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Professional Affiliations  Society of Wetland Scientists  Florida Association of Environmental Professionals  Florida Wildlife Society  Gopher Tortoise Council Publications and Papers  Newlon, A.W., Yund, P.O., and Savage, J.S. 2003. Phenotypic Plasticity of Reproductive Effort in a Colonial Ascidian, Botryllus schlosseri. Journal of Experimental Zoology. 297A:180-188. Certifications, Conferences and Courses  Authorized FWC Gopher Tortoise Agent – Permit # GTA-09-00239A  Open Water Diver Certification, PADI  Mine Safety and Health Administration (MSHA) Safety Certification – Updated Annually  Adult CPR and AED Certification – Updated Bi-annually  Gopher Tortoise Conservation Initiative Course at the Ashton Biodiversity Research & Preservation Institute  NRCS / SWFWMD Soils and Seasonal High Ground Water Table (SHGWT) Workshop  FDEP Uniform Mitigation Assessment Method (UMAM) Workshop  Florida Wildlife Society Conferences  Basic Fire Management training certificate for sections I-100, S-130, S-190, and L- 180 9.A.4.e Packet Pg. 1063 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) ATTACHMENT 2 9.A.4.e Packet Pg. 1064 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) KLF Project #20180455.001A Page 1 of 5 December 2017 MOU17R66725 STEWART MATERIALS, INC. IMMOKALEE MINE EXPANSION ENVIRONMENTAL RESOURCE PERMIT APPLICATION STORMWATER MANAGEMENT CALCULATIONS October 2017 Revised December 2017 Submitted to: FLORIDA DEPARTMENT OF ENVIRONMENTAL PROTECTION Mining and Mitigation Program 2600 Blair Stone Road, MS 3577 Tallahassee, Florida 32399-2400 Prepared for: STEWART MATERIALS, INC. 2875 Jupiter Park Drive, Suite 1100 Jupiter, Florida 33458 Prepared by: KLEINFELDER INC. 1174 Camp Avenue Mount Dora, FL 32757 o| 352.383.1444, f| 352.383.3877 Certificate of Authorization #31004 Copyright 2017 Kleinfelder All Rights Reserved ONLY THE CLIENT OR ITS DESIGNATED REPRESENTATIVES MAY USE THIS DOCUMENT AND ONLY FOR THE SPECIFIC PROJECT FOR WHICH THIS REPORT WAS PREPARED. 9.A.4.e Packet Pg. 1065 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) ./)3URMHFW$3DJHRI'HFHPEHU 0285 ,PPRNDOHH0LQH([SDQVLRQ6WRUPZDWHU0DQDJHPHQW&DOFXODWLRQV&HUWLILFDWLRQ ,FHUWLI\WKDWWKLVGRFXPHQWZDVUHYLHZHGE\PHLQDFFRUGDQFHZLWKDV\VWHPGHVLJQHGWR DVVXUHWKDWTXDOLILHGSHUVRQQHOSURSHUO\JDWKHUHGDQGHYDOXDWHGWKHLQIRUPDWLRQVXEPLWWHG %DVHGRQP\LQTXLU\RIWKHSHUVRQRUSHUVRQVZKRPDQDJHWKHV\VWHPRUWKRVHSHUVRQV GLUHFWO\UHVSRQVLEOHIRUJDWKHULQJWKHLQIRUPDWLRQWKHLQIRUPDWLRQVXEPLWWHGLVWRWKHEHVW RIP\NQRZOHGJHDQGEHOLHIWUXHDFFXUDWHDQGFRPSOHWH BBBBBBBBBBBBBBBBBB 'DWH %ULDQ%XUNKDUW3( )/3( 3URMHFW(QJLQHHU .OHLQIHOGHU 10/28/2019 E. Brian Burkhart This item has been digitally signed and sealed by E. Brian Burkhart, PE on the date provided using a Digital Signature. Printed copies of this document are not considered signed and sealed and the SHA authentication code must be verified on any electronic copies. 2019.10.28 15:36:34-04'00' 9.A.4.e Packet Pg. 1066 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) KLF Project #20180455.001A Page 3 of 5 December 2017 MOU17R66725 STORMWATER MANAGEMENT CALCULATIONS The stormwater management calculations for Stewart Materials Inc. Immokalee Mine Expansion were performed to evaluate the stormwater runoff and storage associated with the mining and post-mining conditions of the existing permitted area and the proposed expansion area. The storage calculations were performed using a seasonal high water level (SHWL) of 34.0 feet-NGVD (FDEP ERP 0228414-003) and a rainfall depth of 10.2 inches for the 25-year, 72-hour storm event obtained from the NOAA Atlas 14, Volume 9, Version 2 for Immokalee, Florida (refer to Exhibit 1). The existing permitted area and the proposed expansion area are divided into two drainage areas during the pre-mining phase conditions with a total area of 447.95 acres (refer to Exhibit 2). The stormwater management calculations indicate that both the proposed mine pit and post-mining lake will provide sufficient storage to retain the total runoff volume from the 25-year, 72-hour storm event. No discharges are expected from the mine pits and lakes during the mining and post-mining phase conditions, respectively. MINING PHASE The worst case scenario during mining would occur after the topsoil has been removed and relocated to the perimeter of the mining area to create a berm, and before any excavation has commenced. At this time, the site itself would be utilized as the stormwater pond for any rainfall falling on the proposed site. The top of the berm surrounding the mining area will need to be a minimum of one (1) foot above existing grade to retain the total runoff volume generated by the 25-year, 72-hour storm event. As shown on the proposed Mine Site Plan, the topsoil will be stored to a minimum height of five (5) feet above grade, allowing more than four (4) feet of freeboard. Additionally, the removal of the overburden itself will create supplementary stormwater storage volume between the existing grade and the SHWL. The existing permitted area and the proposed expansion area are comprised of one drainage area during the mining phase conditions with a total area of 438.31 acres (refer to Exhibit 3). The total drainage area was defined using the top of the berm. POST - MINING PHASE Upon completion of mining operations, the berm surrounding the site will be reduced to a minimum elevation of 36 feet-NGVD and the extraction site will be converted into a lake. The top of the berm of the existing permitted area and proposed expansion area is considered the limit of the drainage basin. The post-mining phase drainage area will be approximately 433.77 acres (refer to Exhibit 4). The total drainage area was defined using the top of the berm. The lowest outfall elevation will be 36 feet-NGVD. The available storage volume in the lake was calculated using a SHWL of 34.0 feet-NGVD and 100 % impervious basin area. Runoff Volume = (433.77 ac x 10.2 in/12 in) = 368.70 ac-ft 9.A.4.e Packet Pg. 1067 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) KLF Project #20180455.001A Page 4 of 5 December 2017 MOU17R66725 Available Storage Volume (V): The proposed post-mining phase lake is 417.61 acres at the SHWL of 34 ft-NGVD and 419.96 acres at the top of berm (internal area) of 36 ft- NGVD. The difference in elevation within the available storage volume is 2 feet. V = [(417.61 + 419.96)/2] x 2 = 837.57 ac-ft Freeboard Calculation (FB): V = [(A1 + A2)/2] x H 𝑯 = 𝑉 (𝐴1 + 𝐴2 2 ) Where; V = runoff volume, ac-ft A1 = lake area at the SHWL, acres A2 = lake area at the top of berm, acres H = water depth above the SHWL, ft 𝑯 = 368.70 (417.61 +419.96 2 ) H = 0.88 ft The water level (WL) in the lake after the 25-year, 24-hour storm event is equal to the SHWL plus H. WL = 34.00 + 0.88 = 34.88 feet-NGVD FB = top of berm elevation – WL FB = 36.00 – 34.88 = 1.12 feet The lake will retain the total runoff volume from the 25-year, 72-hour storm event and provide a freeboard of approximately 1.12 feet. 9.A.4.e Packet Pg. 1068 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) KLF Project #20180455.001A Page 5 of 5 December 2017 MOU17R66725 Limitations This work was performed in a manner consistent with that level of care and skill ordinarily exercised by other members of Kleinfelder’s profession practicing in the same locality, under similar conditions and at the date the services are provided. Our conclusions, opinions, and recommendations are based on a limited number of observations and data. It is possible that conditions could vary between or beyond the data evaluated. Kleinfelder makes no other representation, guarantee, or warranty, express or implied, regarding the services, communication (oral or written), report, opinion, or instrument of service provided. This report may be used only by the Client and the registered design professional in responsible charge and only for the purposes stated for this specific engagement within a reasonable time from its issuance, but in no event later than two (2) years from the date of the report. The work performed was based on project information provided by Client. If Client does not retain Kleinfelder to review any plans and specifications, including any revisions or modifications to the plans and specifications, Kleinfelder assumes no responsibility for the suitability of our recommendations. In addition, if there are any changes in the field to the plans or specifications, Client must obtain written approval from Kleinfelder’s engineer that such changes do not affect our recommendati ons. Failure to do so will vitiate Kleinfelder’s recommendations. 9.A.4.e Packet Pg. 1069 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) NOAA Atlas 14, Volume 9, Version 2 Location name: Immokalee, Florida, USA* Latitude: 26.4683°, Longitude: -81.4612° Elevation: 33.34 ft** * source: ESRI Maps ** source: USGS POINT PRECIPITATION FREQUENCY ESTIMATES Sanja Perica, Deborah Martin, Sandra Pavlovic, Ishani Roy, Michael St. Laurent, Carl Trypaluk, Dale Unruh, Michael Yekta, Geoffery Bonnin NOAA, National Weather Service, Silver Spring, Maryland PF_tabular | PF_graphical | Maps_&_aerials PF tabular PDS-based point precipitation frequency estimates with 90% confidence intervals (in inches)1 Duration Average recurrence interval (years) 1 2 5 10 25 50 100 200 500 1000 5-min 0.538 (0.429-0.678) 0.609 (0.484-0.768) 0.725 (0.575-0.918) 0.822 (0.648-1.05) 0.956 (0.731-1.26) 1.06 (0.793-1.42) 1.16 (0.844-1.61) 1.27 (0.886-1.82) 1.41 (0.949-2.09) 1.52 (0.997-2.30) 10-min 0.788 (0.628-0.993) 0.892 (0.709-1.13) 1.06 (0.842-1.34) 1.20 (0.949-1.53) 1.40 (1.07-1.85) 1.55 (1.16-2.08) 1.70 (1.24-2.36) 1.86 (1.30-2.66) 2.07 (1.39-3.06) 2.22 (1.46-3.36) 15-min 0.961 (0.765-1.21) 1.09 (0.865-1.37) 1.30 (1.03-1.64) 1.47 (1.16-1.87) 1.71 (1.31-2.25) 1.89 (1.42-2.54) 2.08 (1.51-2.88) 2.27 (1.58-3.25) 2.52 (1.70-3.73) 2.71 (1.78-4.10) 30-min 1.48 (1.18-1.86) 1.67 (1.33-2.11) 1.99 (1.58-2.52) 2.26 (1.78-2.87) 2.63 (2.01-3.47) 2.91 (2.18-3.91) 3.20 (2.32-4.43) 3.49 (2.44-5.00) 3.88 (2.61-5.75) 4.18 (2.74-6.32) 60-min 1.95 (1.56-2.46) 2.20 (1.75-2.78) 2.61 (2.07-3.31) 2.96 (2.33-3.76) 3.44 (2.63-4.54) 3.82 (2.86-5.13) 4.20 (3.04-5.81) 4.59 (3.20-6.57) 5.11 (3.44-7.58) 5.52 (3.62-8.34) 2-hr 2.43 (1.94-3.04) 2.73 (2.18-3.42) 3.23 (2.58-4.06) 3.66 (2.90-4.62) 4.25 (3.27-5.58) 4.72 (3.56-6.31) 5.19 (3.79-7.15) 5.68 (3.99-8.09) 6.34 (4.30-9.34) 6.85 (4.53-10.3) 3-hr 2.65 (2.13-3.31) 2.99 (2.40-3.73) 3.55 (2.84-4.44) 4.03 (3.20-5.07) 4.70 (3.64-6.16) 5.24 (3.97-6.99) 5.79 (4.25-7.95) 6.36 (4.49-9.04) 7.14 (4.86-10.5) 7.74 (5.14-11.6) 6-hr 3.01 (2.43-3.72) 3.43 (2.77-4.25) 4.15 (3.34-5.17) 4.78 (3.82-5.98) 5.68 (4.43-7.42) 6.41 (4.89-8.52) 7.17 (5.30-9.81) 7.97 (5.67-11.3) 9.07 (6.22-13.3) 9.93 (6.64-14.8) 12-hr 3.34 (2.71-4.11) 3.90 (3.17-4.81) 4.87 (3.94-6.02) 5.73 (4.61-7.12) 6.98 (5.49-9.10) 8.01 (6.15-10.6) 9.08 (6.76-12.4) 10.2 (7.33-14.4) 11.8 (8.17-17.2) 13.1 (8.81-19.3) 24-hr 3.80 (3.10-4.65) 4.46 (3.64-5.46) 5.62 (4.57-6.90) 6.67 (5.40-8.23) 8.23 (6.52-10.7) 9.53 (7.37-12.6) 10.9 (8.19-14.8) 12.4 (8.96-17.4) 14.5 (10.1-21.0) 16.2 (11.0-23.7) 2-day 4.50 (3.70-5.47) 5.18 (4.26-6.30) 6.42 (5.25-7.83) 7.56 (6.15-9.27) 9.29 (7.42-12.0) 10.8 (8.39-14.1) 12.3 (9.32-16.7) 14.0 (10.2-19.6) 16.5 (11.6-23.8) 18.5 (12.6-26.9) 3-day 5.01 (4.13-6.06) 5.77 (4.75-6.99) 7.13 (5.85-8.66) 8.36 (6.83-10.2) 10.2 (8.18-13.2) 11.8 (9.20-15.4) 13.4 (10.2-18.1) 15.2 (11.1-21.2) 17.8 (12.5-25.5) 19.8 (13.6-28.8) 4-day 5.47 (4.52-6.60) 6.30 (5.20-7.61) 7.75 (6.38-9.40) 9.06 (7.42-11.0) 11.0 (8.81-14.1) 12.6 (9.87-16.4) 14.3 (10.9-19.1) 16.1 (11.8-22.3) 18.7 (13.2-26.7) 20.8 (14.3-30.0) 7-day 6.78 (5.63-8.14) 7.71 (6.40-9.27) 9.31 (7.70-11.2) 10.7 (8.80-13.0) 12.7 (10.2-16.1) 14.3 (11.3-18.4) 16.0 (12.2-21.3) 17.8 (13.1-24.4) 20.3 (14.4-28.7) 22.2 (15.4-32.0) 10-day 8.02 (6.68-9.59) 9.01 (7.49-10.8) 10.7 (8.85-12.8) 12.1 (9.98-14.6) 14.1 (11.3-17.7) 15.7 (12.4-20.1) 17.4 (13.3-22.9) 19.1 (14.1-26.0) 21.5 (15.3-30.3) 23.3 (16.2-33.4) 20-day 11.6 (9.72-13.8) 12.8 (10.7-15.2) 14.7 (12.2-17.5) 16.2 (13.5-19.4) 18.3 (14.8-22.7) 19.9 (15.8-25.2) 21.5 (16.5-28.0) 23.2 (17.1-31.2) 25.3 (18.1-35.2) 26.9 (18.8-38.3) 30-day 14.6 (12.2-17.2) 16.0 (13.4-18.9) 18.2 (15.2-21.6) 19.9 (16.6-23.8) 22.2 (17.9-27.3) 23.9 (19.0-30.0) 25.6 (19.7-33.1) 27.2 (20.2-36.3) 29.2 (20.9-40.4) 30.6 (21.5-43.4) 45-day 18.2 (15.4-21.5) 20.0 (16.9-23.6) 22.8 (19.1-27.0) 24.9 (20.8-29.6) 27.6 (22.3-33.7) 29.6 (23.5-36.8) 31.3 (24.2-40.2) 33.0 (24.5-43.8) 34.9 (25.1-48.0) 36.2 (25.6-51.2) 60-day 21.3 (18.0-25.1) 23.5 (19.9-27.7) 26.8 (22.6-31.7) 29.4 (24.6-34.9) 32.6 (26.3-39.5) 34.7 (27.6-43.0) 36.7 (28.3-46.8) 38.4 (28.6-50.8) 40.4 (29.1-55.2) 41.6 (29.4-58.6) 1 Precipitation frequency (PF) estimates in this table are based on frequency analysis of partial duration series (PDS). Numbers in parenthesis are PF estimates at lower and upper bounds of the 90% confidence interval. The probability that precipitation frequency estimates (for a given duration and average recurrence interval) will be greater than the upper bound (or less than the lower bound) is 5%. Estimates at upper bounds are not checked against probable maximum precipitation (PMP) estimates and may be higher than currently valid PMP values. Please refer to NOAA Atlas 14 document for more information. Back to Top Page 1 of 4Precipitation Frequency Data Server 9/28/2017https://hdsc.nws.noaa.gov/hdsc/pfds/pfds_printpage.html?lat=26.4683&lon=-81.4612&data=depth&units... 9.A.4.e Packet Pg. 1070 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU))EXHIBIT 1: PF graphical Back to Top Page 2 of 4Precipitation Frequency Data Server 9/28/2017https://hdsc.nws.noaa.gov/hdsc/pfds/pfds_printpage.html?lat=26.4683&lon=-81.4612&data=depth&units... 9.A.4.e Packet Pg. 1071 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Maps & aerials Small scale terrain Large scale terrain Large scale map + – 3km 2mi + – 100km 60mi + – 100km 60mi Page 3 of 4Precipitation Frequency Data Server 9/28/2017https://hdsc.nws.noaa.gov/hdsc/pfds/pfds_printpage.html?lat=26.4683&lon=-81.4612&data=depth&units... 9.A.4.e Packet Pg. 1072 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Large scale aerial Back to Top US Department of Commerce National Oceanic and Atmospheric Administration National Weather Service National Water Center 1325 East West Highway Silver Spring, MD 20910 Questions?: HDSC.Questions@noaa.gov Disclaimer + – 100km 60mi Page 4 of 4Precipitation Frequency Data Server 9/28/2017https://hdsc.nws.noaa.gov/hdsc/pfds/pfds_printpage.html?lat=26.4683&lon=-81.4612&data=depth&units... 9.A.4.e Packet Pg. 1073 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 35 40 4035 35 35 35 35 35 3 5 35 35 35 35 35 35 3535 35 3535 3535DA-2 DA-1 Pre-Mining PhaseDrainage Map Stewart Materials, Inc.Western Immokalee Mine ExpansionCollier County, Florida 2 20180455.001A 12/4/2017 CTC BN Pre Mining Phase Drainage Map.mxdwww.kleinfelder.com PROJECT NO. DRAWN: DRAWN BY: CHECKED BY: FILE NAME: EXHIBITThe information included on this graphic representation has beencompiled from a variety of sources and is subject to change withoutnotice. Kleinfelder makes no representations or warranties, expressor implied, as to accuracy, completeness, timeliness, or rights to theuse of such information. This document is not intended for use as aland survey product nor is it designed or intended as a constructiondesign document. The use or misuse of the information containedon this graphic representation is at the sole risk of the party using ormisusing the information. Sections 18 & 19, Township 46 South, Range 29 East Legend Permitted Project Boundary (219.8 Ac.±) Expansion Project Boundary (231.0 Ac.±) Surface Flow Direction (Off-Site) Surface Flow Direction (On-Site) Existing Contours (ft-NGVD) Existing Agricultural Ditch (Off-Site) Existing Agricultural Ditch (On-Site) Pre Mining Phase Drainage Area DA-1 = 211.33 Ac. DA-2 = 236.62 Ac. £ 1 inch = 550 feet 500 0 500250 Feet Document Path: \\mountdora\MOUNTDORA-DATA\GISCAD\Stewart Mining\_2017\20180455.001A_SMI-Immokalee West Expansion\Stormwater\GIS\ImmokaleeExpansion-PreMining Phase Drainage Map.mxd; Plotted: 12/4/2017, 9:33:01 AM, ccolon 9.A.4.e Packet Pg. 1074 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 35 40 35 35 35 3535 35 403 5 35 35 35 35 35 35 35 3535 35 35 3 5 35 DA-1_2 Mining PhaseDrainage Map Stewart Materials, Inc.Western Immokalee Mine ExpansionCollier County, Florida 3 20180455.001A 12/4/2017 CTC BN Mining Phase Drainage Map.mxdwww.kleinfelder.com PROJECT NO. DRAWN: DRAWN BY: CHECKED BY: FILE NAME: EXHIBITThe information included on this graphic representation has beencompiled from a variety of sources and is subject to change withoutnotice. Kleinfelder makes no representations or warranties, expressor implied, as to accuracy, completeness, timeliness, or rights to theuse of such information. This document is not intended for use as aland survey product nor is it designed or intended as a constructiondesign document. The use or misuse of the information containedon this graphic representation is at the sole risk of the party using ormisusing the information. Sections 18 & 19, Township 46 South, Range 29 East Legend Permitted Project Boundary (219.8 Ac.±) Expansion Project Boundary (231.0 Ac.±) Surface Flow Direction (Off-Site) Surface Flow Direction (On-Site) Existing Contours (ft-NGVD) Existing Agricultural Ditch (Off-Site) Mining Phase Drainage Area DA-1_2 = 438.31 Ac. (Top of Berm) £ 1 inch = 550 feet 500 0 500250 Feet Document Path: \\mountdora\MOUNTDORA-DATA\GISCAD\Stewart Mining\_2017\20180455.001A_SMI-Immokalee West Expansion\Stormwater\GIS\ImmokaleeExpansion-Mining Phase Drainage Map.mxd; Plotted: 12/4/2017, 9:58:01 AM, ccolon 9.A.4.e Packet Pg. 1075 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 35 40 353 5 35 35 35 3535 40DA-1_2 363532 24 -49Post-Mining PhaseDrainage Map Stewart Materials, Inc.Western Immokalee Mine ExpansionCollier County, Florida 4 20180455.001A 12/4/2017 CTC BN Post Mining Phase Drainage Map.mxdwww.kleinfelder.com PROJECT NO. DRAWN: DRAWN BY: CHECKED BY: FILE NAME: EXHIBIT The information included on this graphic representation has beencompiled from a variety of sources and is subject to change withoutnotice. Kleinfelder makes no representations or warranties, expressor implied, as to accuracy, completeness, timeliness, or rights to theuse of such information. This document is not intended for use as aland survey product nor is it designed or intended as a constructiondesign document. The use or misuse of the information containedon this graphic representation is at the sole risk of the party using ormisusing the information. Sections 18 & 19, Township 46 South, Range 29 East Legend Permitted Project Boundary (219.8 Ac.±) Expansion Project Boundary (231.0 Ac.±) Surface Flow Direction (Off-Site) Surface Flow Direction (On-Site) Post-Mining Phase Contours (ft-NGVD) Existing Agricultural Ditch (Off-Site) Post Mining Phase Drainage Area DA-1_2 = 433.77 Ac. (Top of Berm) £ 1 inch = 550 feet 500 0 500250 Feet Document Path: \\mountdora\MOUNTDORA-DATA\GISCAD\Stewart Mining\_2017\20180455.001A_SMI-Immokalee West Expansion\Stormwater\GIS\ImmokaleeExpansion-Post Mining Phase Drainage Map.mxd; Plotted: 12/4/2017, 9:48:40 AM, ccolon 9.A.4.e Packet Pg. 1076 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) ATTACHMENT 3 9.A.4.e Packet Pg. 1077 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) NOTE: The Biodiversity Matrix includes only rare species and natural communities tracked by FNAI. Report for 4 Matrix Units: 46139 , 46140 , 46511 , 46512 Descriptions DOCUMENTED - There is a documented occurrence in the FNAI database of the species or community within this Matrix Unit. DOCUMENTED-HISTORIC - There is a documented occurrence in the FNAI database of the species or community within this Matrix Unit; however the occurrence has not been observed/reported within the last twenty years. LIKELY - The species or community is known to occur in this vicinity, and is considered likely within this Matrix Unit because: 1. documented occurrence overlaps this and adjacent Matrix Units, but the documentation isn’t precise enough to indicate which of those Units the species or community is actually located in; or 2. there is a documented occurrence in the vicinity and there is suitable habitat for that species or community within this Matrix Unit. POTENTIAL - This Matrix Unit lies within the known or predicted range of the species or community based on expert knowledge and environmental variables such as climate, soils, topography, and landcover. Matrix Unit ID: 46139 1 Documented Element Found Scientific and Common Names Global Rank State Rank Federal Status State Listing Puma concolor coryi Florida Panther G5T1 S1 LE FE 0 Documented-Historic Elements Found 1018 Thomasville Road Suite 200-C Tallahassee, FL 32303 850-224-8207 850-681-9364 fax www.fnai.org Florida Natural Areas Inventory Biodiversity Matrix Query Results UNOFFICIAL REPORT Created 3/10/2020 (Contact the FNAI Data Services Coordinator at 850.224.8207 or kbrinegar@fnai.fsu.edu for information on an official Standard Data Report) Page 1 of 4FNAI Biodiversity Matrix 3/10/2020https://data.labins.org/mapping/FNAI_BioMatrix/GridSearch.cfm?sel_id=46139,46140,46... 9.A.4.e Packet Pg. 1078 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 3 Likely Elements Found Scientific and Common Names Global Rank State Rank Federal Status State Listing Caracara cheriway Crested Caracara G5 S2 LT FT Mycteria americana Wood Stork G4 S2 LT FT Ursus americanus floridanus Florida Black Bear G5T2 S2 N N Matrix Unit ID: 46140 1 Documented Element Found Scientific and Common Names Global Rank State Rank Federal Status State Listing Puma concolor coryi Florida Panther G5T1 S1 LE FE 0 Documented-Historic Elements Found 3 Likely Elements Found Scientific and Common Names Global Rank State Rank Federal Status State Listing Caracara cheriway Crested Caracara G5 S2 LT FT Mycteria americana Wood Stork G4 S2 LT FT Ursus americanus floridanus Florida Black Bear G5T2 S2 N N Matrix Unit ID: 46511 1 Documented Element Found Scientific and Common Names Global Rank State Rank Federal Status State Listing Puma concolor coryi Florida Panther G5T1 S1 LE FE 0 Documented-Historic Elements Found 5 Likely Elements Found Scientific and Common Names Global Rank State Rank Federal Status State Listing Caracara cheriway Crested Caracara G5 S2 LT FT Mesic flatwoods G4 S4 N N Mycteria americana Wood Stork G4 S2 LT FT Sciurus niger avicennia Mangrove Fox Squirrel G5T2 S2 N ST Ursus americanus floridanus Florida Black Bear G5T2 S2 N N Page 2 of 4FNAI Biodiversity Matrix 3/10/2020https://data.labins.org/mapping/FNAI_BioMatrix/GridSearch.cfm?sel_id=46139,46140,46... 9.A.4.e Packet Pg. 1079 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Matrix Unit ID: 46512 1 Documented Element Found Scientific and Common Names Global Rank State Rank Federal Status State Listing Puma concolor coryi Florida Panther G5T1 S1 LE FE 0 Documented-Historic Elements Found 5 Likely Elements Found Scientific and Common Names Global Rank State Rank Federal Status State Listing Caracara cheriway Crested Caracara G5 S2 LT FT Mesic flatwoods G4 S4 N N Mycteria americana Wood Stork G4 S2 LT FT Sciurus niger avicennia Mangrove Fox Squirrel G5T2 S2 N ST Ursus americanus floridanus Florida Black Bear G5T2 S2 N N Matrix Unit IDs: 46139 , 46140 , 46511 , 46512 21 Potential Elements Common to Any of the 4 Matrix Units Scientific and Common Names Global Rank State Rank Federal Status State Listing Andropogon arctatus Pine-woods Bluestem G3 S3 N T Aphelocoma coerulescens Florida Scrub-Jay G2 S2 LT FT Athene cunicularia floridana Florida Burrowing Owl G4T3 S3 N SSC Calopogon multiflorus Many-flowered Grass-pink G2G3 S2S3 N T Centrosema arenicola Sand Butterfly Pea G2Q S2 N E Drymarchon couperi Eastern Indigo Snake G3 S3 LT FT Elytraria caroliniensis var. angustifolia Narrow-leaved Carolina Scalystem G4T2 S2 N N Gopherus polyphemus Gopher Tortoise G3 S3 C ST Grus canadensis pratensis Florida Sandhill Crane G5T2T3 S2S3 N ST Gymnopogon chapmanianus Chapman's Skeletongrass G3 S3 N N Lechea cernua Nodding Pinweed G3 S3 N T Linum carteri var. smallii Small's Flax G2T2 S2 N E Lithobates capito Gopher Frog G3 S3 N SSC Mustela frenata peninsulae Florida Long-tailed Weasel G5T3 S3 N N Nemastylis floridana Celestial Lily G2 S2 N E G3 S3 N T Page 3 of 4FNAI Biodiversity Matrix 3/10/2020https://data.labins.org/mapping/FNAI_BioMatrix/GridSearch.cfm?sel_id=46139,46140,46... 9.A.4.e Packet Pg. 1080 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Nolina atopocarpa Florida Beargrass Picoides borealis Red-cockaded Woodpecker G3 S2 LE FE Platanthera integra Yellow Fringeless Orchid G3G4 S3 N E Pteroglossaspis ecristata Giant Orchid G2G3 S2 N T Rostrhamus sociabilis Snail Kite G4G5 S2 LE N Tephrosia angustissima var. curtissii Coastal Hoary-pea G1T1 S1 N E Disclaimer The data maintained by the Florida Natural Areas Inventory represent the single most comprehensive source of information available on the locations of rare species and other significant ecological resources statewide. However, the data are not always based on comprehensive or site-specific field surveys. Therefore, this information should not be regarded as a final statement on the biological resources of the site being considered, nor should it be substituted for on-site surveys. FNAI shall not be held liable for the accuracy and completeness of these data, or opinions or conclusions drawn from these data. FNAI is not inviting reliance on these data. Inventory data are designed for the purposes of conservation planning and scientific research and are not intended for use as the primary criteria for regulatory decisions. Unofficial Report These results are considered unofficial. FNAI offers a Standard Data Request option for those needing certifiable data. Page 4 of 4FNAI Biodiversity Matrix 3/10/2020https://data.labins.org/mapping/FNAI_BioMatrix/GridSearch.cfm?sel_id=46139,46140,46... 9.A.4.e Packet Pg. 1081 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) ATTACHMENT 4 9.A.4.e Packet Pg. 1082 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) STANDARD PROTECTION MEASURES FOR THE EASTERN INDIGO SNAKE U.S. Fish and Wildlife Service August 12, 2013 The eastern indigo snake protection/education plan (Plan) below has been developed by the U.S. Fish and Wildlife Service (USFWS) in Florida for use by applicants and their construction personnel. At least 30 days prior to any clearing/land alteration activities, the applicant shall notify the appropriate USFWS Field Office via e-mail that the Plan will be implemented as described below (North Florida Field Office: jaxregs@fws.gov; South Florida Field Office: verobeach@fws.gov; Panama City Field Office: panamacity@fws.gov). As long as the signatory of the e-mail certifies compliance with the below Plan (including use of the attached poster and brochure), no further written confirmation or “approval” from the USFWS is needed and the applicant may move forward with the project. If the applicant decides to use an eastern indigo snake protection/education plan other than the approved Plan below, written confirmation or “approval” from the USFWS that the plan is adequate must be obtained. At least 30 days prior to any clearing/land alteration activities, the applicant shall submit their unique plan for review and approval. The USFWS will respond via e- mail, typically within 30 days of receiving the plan, either concurring that the plan is adequate or requesting additional information. A concurrence e-mail from the appropriate USFWS Field Office will fulfill approval requirements. The Plan materials should consist of: 1) a combination of posters and pamphlets (see Poster Information section below); and 2) verbal educational instructions to construction personnel by supervisory or management personnel before any clearing/land alteration activities are initiated (see Pre-Construction Activities and During Construction Activities sections below). POSTER INFORMATION Posters with the following information shall be placed at strategic locations on the construction site and along any proposed access roads (a final poster for Plan compliance, to be printed on 11” x 17” or larger paper and laminated, is attached): DESCRIPTION: The eastern indigo snake is one of the largest non-venomous snakes in North America, with individuals often reaching up to 8 feet in length. They derive their name from the glossy, blue-black color of their scales above and uniformly slate blue below. Frequently, they have orange to coral reddish coloration in the throat area, yet some specimens have been reported to only have cream coloration on the throat. These snakes are not typically aggressive and will attempt to crawl away when disturbed. Though indigo snakes rarely bite, they should NOT be handled. SIMILAR SNAKES: The black racer is the only other solid black snake resembling the eastern indigo snake. However, black racers have a white or cream chin, thinner bodies, and WILL BITE if handled. LIFE HISTORY: The eastern indigo snake occurs in a wide variety of terrestrial habitat types throughout Florida. Although they have a preference for uplands, they also utilize some wetlands 1 9.A.4.e Packet Pg. 1083 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) and agricultural areas. Eastern indigo snakes will often seek shelter inside gopher tortoise burrows and other below- and above-ground refugia, such as other animal burrows, stumps, roots, and debris piles. Females may lay from 4 - 12 white eggs as early as April through June, with young hatching in late July through October. PROTECTION UNDER FEDERAL AND STATE LAW: The eastern indigo snake is classified as a Threatened species by both the USFWS and the Florida Fish and Wildlife Conservation Commission. “Taking” of eastern indigo snakes is prohibited by the Endangered Species Act without a permit. “Take” is defined by the USFWS as an attempt to kill, harm, harass, pursue, hunt, shoot, wound, trap, capture, collect, or engage in any such conduct. Penalties include a maximum fine of $25,000 for civil violations and up to $50,000 and/or imprisonment for criminal offenses, if convicted. Only individuals currently authorized through an issued Incidental Take Statement in association with a USFWS Biological Opinion, or by a Section 10(a)(1)(A) permit issued by the USFWS, to handle an eastern indigo snake are allowed to do so. IF YOU SEE A LIVE EASTERN INDIGO SNAKE ON THE SITE: • Cease clearing activities and allow the live eastern indigo snake sufficient time to move away from the site without interference; • Personnel must NOT attempt to touch or handle snake due to protected status. • Take photographs of the snake, if possible, for identification and documentation purposes. • Immediately notify supervisor or the applicant’s designated agent, and the appropriate USFWS office, with the location information and condition of the snake. • If the snake is located in a vicinity where continuation of the clearing or construction activities will cause harm to the snake, the activities must halt until such time that a representative of the USFWS returns the call (within one day) with further guidance as to when activities may resume. IF YOU SEE A DEAD EASTERN INDIGO SNAKE ON THE SITE: • Cease clearing activities and immediately notify supervisor or the applicant’s designated agent, and the appropriate USFWS office, with the location information and condition of the snake. • Take photographs of the snake, if possible, for identification and documentation purposes. • Thoroughly soak the dead snake in water and then freeze the specimen. The appropriate wildlife agency will retrieve the dead snake. Telephone numbers of USFWS Florida Field Offices to be contacted if a live or dead eastern indigo snake is encountered: North Florida Field Office – (904) 731-3336 Panama City Field Office – (850) 769-0552 South Florida Field Office – (772) 562-3909 2 9.A.4.e Packet Pg. 1084 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) PRE-CONSTRUCTION ACTIVITIES 1. The applicant or designated agent will post educational posters in the construction office and throughout the construction site, including any access roads. The posters must be clearly visible to all construction staff. A sample poster is attached. 2. Prior to the onset of construction activities, the applicant/designated agent will conduct a meeting with all construction staff (annually for multi-year projects) to discuss identification of the snake, its protected status, what to do if a snake is observed within the project area, and applicable penalties that may be imposed if state and/or federal regulations are violated. An educational brochure including color photographs of the snake will be given to each staff member in attendance and additional copies will be provided to the construction superintendent to make available in the onsite construction office (a final brochure for Plan compliance, to be printed double-sided on 8.5” x 11” paper and then properly folded, is attached). Photos of eastern indigo snakes may be accessed on USFWS and/or FWC websites. 3. Construction staff will be informed that in the event that an eastern indigo snake (live or dead) is observed on the project site during construction activities, all such activities are to cease until the established procedures are implemented according to the Plan, which includes notification of the appropriate USFWS Field Office. The contact information for the USFWS is provided on the referenced posters and brochures. DURING CONSTRUCTION ACTIVITIES 1. During initial site clearing activities, an onsite observer may be utilized to determine whether habitat conditions suggest a reasonable probability of an eastern indigo snake sighting (example: discovery of snake sheds, tracks, lots of refugia and cavities present in the area of clearing activities, and presence of gopher tortoises and burrows). 2. If an eastern indigo snake is discovered during gopher tortoise relocation activities (i.e. burrow excavation), the USFWS shall be contacted within one business day to obtain further guidance which may result in further project consultation. 3. Periodically during construction activities, the applicant’s designated agent should visit the project area to observe the condition of the posters and Plan materials, and replace them as needed. Construction personnel should be reminded of the instructions (above) as to what is expected if any eastern indigo snakes are seen. POST CONSTRUCTION ACTIVITIES Whether or not eastern indigo snakes are observed during construction activities, a monitoring report should be submitted to the appropriate USFWS Field Office within 60 days of project completion. The report can be sent electronically to the appropriate USFWS e-mail address listed on page one of this Plan. 3 9.A.4.e Packet Pg. 1085 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) IF YOU SEE A LIVE EASTERN INDIGO SNAKE ON THE SITE: • Cease clearing activities and allow the eastern indigo snake sufficient time to move away from the site without interference. • Personnel must NOT attempt to touch or handle snake due to protected status. • Take photographs of the snake, if possible, for identification and documentation purposes. • Immediately notify supervisor or the applicant’s designated agent, and the appropriate U.S. Fish and Wildlife Service (USFWS) office, with the location information and condition of the snake. • If the snake is located in a vicinity where continuation of the clearing or construction activities will cause harm to the snake, the activities must halt until such time that a representative of the USFWS returns the call (within one day) with further guidance as to when activities may resume. IF YOU SEE A DEAD EASTERN INDIGO SNAKE ON THE SITE: • Cease clearing activities and immediately notify supervisor or the applicant’s designated agent, and the appropriate USFWS office, with the location information and condition of the snake. • Take photographs of the snake, if possible, for identification and documentation purposes. • Thoroughly soak the dead snake in water and then freeze the specimen. The appropriate wildlife agency will retrieve the dead snake. USFWS Florida Field Offices to be contacted if a live or dead eastern indigo snake is encountered: North Florida ES Office – (904) 731-3336 Panama City ES Office – (850) 769-0552 South Florida ES Office – (772) 562-3909 DESCRIPTION: The eastern indigo snake is one of the largest non-venomous snakes in North America, with individuals often reaching up to 8 feet in length. They derive their name from the glossy, blue-black color of their scales above and uniformly slate blue below. Frequently, they have orange to coral reddish coloration in the throat area, yet some specimens have been reported to only have cream coloration on the throat. These snakes are not typically aggressive and will attempt to crawl away when disturbed. Though indigo snakes rarely bite, they should NOT be handled. SIMILAR SNAKES: The black racer is the only other solid black snake resembling the eastern indigo snake. However, black racers have a white or cream chin, thinner bodies, and WILL BITE if handled. LIFE HISTORY: The eastern indigo snake occurs in a wide variety of terrestrial habitat types throughout Florida. Although they have a preference for uplands, they also utilize some wetlands and agricultural areas. Eastern indigo snakes will often seek shelter inside gopher tortoise burrows and other below- and above- ground refugia, such as other animal burrows, stumps, roots, and debris piles. Females may lay from 4 - 12 white eggs as early as April through June, with young hatching in late July through October. 9.A.4.e Packet Pg. 1086 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Killing, harming, or harassing indigo snakes is strictly prohibited and punishable under State and Federal Law. Only individuals currently authorized through an issued Incidental Take Statement in association with a USFWS Biological Opinion, or by a Section 10(a)(1)(A) permit issued by the USFWS, to handle an eastern indigo snake are allowed to do so. LEGAL STATUS: The eastern indigo snake is classified as a Threatened species by both the USFWS and the Florida Fish and Wildlife Conservation Commission. “Taking” of eastern indigo snakes is prohibited by the Endangered Species Act without a permit. “Take” is defined by the USFWS as an attempt to kill, harm, harass, pursue, hunt, shoot, wound, trap, capture, collect, or engage in any such conduct. Penalties include a maximum fine of $25,000 for civil violations and up to $50,000 and/or imprisonment for criminal offenses, if convicted. ATTENTION: THREATENED EASTERN INDIGO SNAKES MAY BE PRESENT ON THIS SITE!!! Please read the following information provided by the U.S. Fish and Wildlife Service to become familiar with standard protection measures for the eastern indigo snake. Photo: Dirk Stevenson August 12, 2013 9.A.4.e Packet Pg. 1087 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road ATTENTION: THREATENED EASTERN INDIGO SNAKES MAY BE PRESENT ON THIS SITE!!! IF YOU SEE A LIVE EASTERN INDIGO SNAKE ON THE SITE: •Cease clearing activities and allow the eastern indigo snake sufficient time to move away from the site without interference. •Personnel must NOT attempt to touch or handle snake due to protected status. •Take photographs of the snake, if possible, for identification and documentation purposes. •Immediately notify supervisor or the applicant’s designated agent, and the appropriate U.S. Fish and Wildlife Service (USFWS) office, with the location information and condition of the snake. •If the snake is located in a vicinity where continuation of the clearing or construction activities will cause harm to the snake, the activities must halt until such time that a representative of the USFWS returns the call (within one day) with further guidance as to when activities may resume. IF YOU SEE A DEAD EASTERN INDIGO SNAKE ON THE SITE: •Cease clearing activities and immediately notify supervisor or the applicant’s designated agent, and the appropriate USFWS office, with the location information and condition of the snake. •Take photographs of the snake, if possible, for identification and documentation purposes. •Thoroughly soak the dead snake in water and then freeze the specimen. The appropriate wildlife agency will retrieve the dead snake. USFWS Florida Field Offices to be contacted if a live or dead eastern indigo snake is encountered: North Florida Field Office – (904) 731-3336 Panama City Field Office – (850) 769-0552 South Florida Field Office – (772) 562-3909 Killing, harming, or harassing indigo snakes is strictly prohibited and punishable under State and Federal Law. DESCRIPTION: The eastern indigo snake is one of the largest non-venomous snakes in North America, with individuals often reaching up to 8 feet in length. They derive their name from the glossy, blue-black color of their scales above and uniformly slate blue below. Frequently, they have orange to coral reddish coloration in the throat area, yet some specimens have been reported to only have cream coloration on the throat. These snakes are not typically aggressive and will attempt to crawl away when disturbed. Though indigo snakes rarely bite, they should NOT be handled. SIMILAR SNAKES: The black racer is the only other solid black snake resembling the eastern indigo snake. However, black racers have a white or cream chin, thinner bodies, and WILL BITE if handled. LIFE HISTORY: The eastern indigo snake occurs in a wide variety of terrestrial habitat types throughout Florida. Although they have a preference for uplands, they also utilize some wetlands and agricultural areas. Eastern indigo snakes will often seek shelter inside gopher tortoise burrows and other below- and above- ground refugia, such as other animal burrows, stumps, roots, and debris piles. Females may lay from 4 - 12 white eggs as early as April through June, with young hatching in late July through October. PROTECTION: The eastern indigo snake is classified as a Threatened species by both the USFWS and the Florida Fish and Wildlife Conservation Commission. “Taking” of eastern indigo snakes is prohibited by the Endangered Species Act without a permit. “Take” is defined by the USFWS as an attempt to kill, harm, harass, pursue, hunt, shoot, wound, trap, capture, collect, or engage in any such conduct. Penalties include a maximum fine of $25,000 for civil violations and up to $50,000 and/or imprisonment for criminal offenses, if convicted. Only individuals currently authorized through an issued Incidental Take Statement in association with a USFWS Biological Opinion, or by a Section 10(a)(1)(A) permit issued by the USFWS, to handle an eastern indigo snake are allowed to do so. Photo: Dirk Stevenson August 12, 2013 9.A.4.e Packet Pg. 1088 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) ATTACHMENT 5 9.A.4.e Packet Pg. 1089 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 8933 Western Way, Suite 12 Jacksonville, FL 32256 p|904.538.9171 f| 904.538.9172 February 9, 2018 20180455.001A|JAX18L73217 Florida Department of Environmental Protection Mining and Mitigation Program Attn: Alan Whitehouse via E-Mail: Alan.Whitehouse@dep.state.fl.us Bob Martinez Center 2600 Blair Stone Road, M.S. 3577 Tallahassee, Florida 32399 RE: Immokalee Sand Mine Expansion Stewart Materials, LLC Immokalee, Collier County, Florida MMR_228414-005 Dear Mr. Whitehouse: In response to the request for additional information (RAI) dated November 28, 2017 (Attachment A) for the proposed expansion of the Immokalee Mine (Site), Kleinfelder personnel mobilized to the Site on January 11, 2018 to conduct surface water and soil assessment activities. Surface water and soil assessment activities were conducted pursuant to the sampling plan approved by the Florida Department of Environmental Protection (FDEP) on December 14, 2017 (Attachment B). Methodology In order to assess for pollution sources from homogenous crop fields with routine agricultural application in the proposed mining area, one (1) composite soil sample was collected and composited from six (6) discrete soil sampling locations. A map of the discrete soil sampling locations is provided on Figure 1. Soil samples were collected in accordance with DEP-SOP- 001/01 FS 3000, Soil Sampling. The samples were collected at depth intervals of 0-6”. The composite sample was then immediately placed on ice and shipped to Advanced Environmental Laboratories, Inc. (AEL) to be analyzed for organochlorine pesticides (EPA Method 8081), organophosphorus pesticides (EPA Method 8141), chlorinated herbicides (EPA Method 8151), ethylene dibromide (EPA Method 8011), and copper and arsenic (EPA Method 6010). In order to assess for potential impacts in areas of fuel storage, fueling, and maintenance, and proximal to any aboveground storage tanks (ASTs) and/or pump houses within the proposed mining area, organic vapor analysis (OVA) was performed at five (5) locations where fueling, AST bulk fuel storage, and/or fuel use was suspected or had been identified. OVA screening was performed in general accordance with AST closure and assessment guidance as outlined in Chapter 62-762.801(2) 5, Florida Administrative Code (F.A.C.). Kleinfelder personnel installed soil borings at cardinal points surrounding each of the ASTs and/or secondary 9.A.4.e Packet Pg. 1090 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 20180455.001A|JAX18L73217 February 9, 2018 © 2018 Kleinfelder Page 2 of 3 containment structures with one (1) boring location near the containment drain valve, if present, or at areas exhibiting surface staining, stressed vegetation, or other signs of petroleum leaks or discharges. Soils were screened at 1’-intervals from each soil boring location to a terminal depth of 10’ below ground surface (bgs) or 1’ into the groundwater table, whichever was encountered first. When soils exhibited impacts based on OVA screening levels above background concentrations (>10 ppm), one (1) soil sample was collected from the boring and depth interval at each area of concern exhibiting the highest OVA concentration. Based on OVA screening results, one (1) soil sample (SB-3) was collected for subsequent analysis. SB-3, located near a diesel AST associated with a pumping station at the grove, had an OVA screening result of 40.3 ppm at a depth of 0-1’ bgs. The sample collected from SB-3 was immediately placed on ice and shipped to AEL to be analyzed for volatile organic compounds (VOCs) (EPA Method 8260), semi-volatile organic compounds (SVOCs) (EPA Method 8270), total recoverable petroleum hydrocarbons (TRPH) (Florida Residual Petroleum Range Organics (FL-PRO) Method), and metals (arsenic, cadmium, chromium, and lead) (EPA Method 6010). The location of the SB-3 soil sample location is depicted on Figure 1. One (1) surface water sample was collected from at least two (2) feet below the water surface of the active mine pit in accordance with DEP-SOP-001/01 FS 2100, Surface Water Sampling. The sample was immediately placed on ice and shipped to AEL to be analyzed for mercury, specific conductivity, pH, chloride, sulfate, total dissolved solids (TDS), nitrate, nitrite, gross alpha, uranium, and combined radionuclides (radium-226 and radium-228). The location of the surface water sample is depicted on Figure 1. Analytical Results No contaminants of concern (COCs) within the analytical suite were detected above their respective soil cleanup target levels (SCTLs) or applicable surface water quality criteria. Contaminants of concern within each analytical suite that were detected above the laboratory practical quantitation limit (PQL) are included in Table 1 (soil) and Table 2 (surface water). A copy of the laboratory analytical results is included as Attachment C. Conclusions Based on the analytical results discussed above, no additional assessment of soils and/or surface water is recommended at the site. We trust that the above response is sufficient to address remaining concerns as identified within the Department’s November 28, 2017 RAI at this time. If you have any other questions, please do not hesitate to contact us at your earliest convenience. 9.A.4.e Packet Pg. 1091 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.ePacket Pg. 1092Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Figure 1 Sample Location Map 9.A.4.e Packet Pg. 1093 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) &=&= &=&= &=&= Soil Sampling Location Map Stewart Materials, LLCImmokalee Sand Mine ExpansionCollier County, Florida 1 20180455.001A 12/7/2017 NL/NCD AWN 18-0207--Immokalee Exp-SoilSamplingLocation.mxdwww.kleinfelder.com PROJECT NO. DRAWN: DRAWN BY: CHECKED BY: FILE NAME: FIGUREThe information included on this graphic representation has beencompiled from a variety of sources and is subject to change withoutnotice. Kleinfelder makes no representations or warranties, expressor implied, as to accuracy, completeness, timeliness, or rights to theuse of such information. This document is not intended for use as aland survey product nor is it designed or intended as a constructiondesign document. The use or misuse of the information containedon this graphic representation is at the sole risk of the party using ormisusing the information. Sections 18 & 19, Township 46 South, Range 29 East Legend Expansion Project Boundary (231.0 Ac.±) &=Grove Discrete Soil Sampling Locations Pit Surface Water Sample Location SB-3 Soll Sample Location Source: 2016 RGB 2.0-foot Orthophotos obtained from the FDOT, Surveying and Mapping Office, Image Services in the form of MrSid format. £ 1 inch = 400 feet 400 0 400200 Feet Document Path: \\Mountdora\mountdora-data\GISCAD\Stewart Mining\_2017\20180455.001A_SMI-Immokalee West Expansion\03-0000 Requested Services\18-0207--ImmokaleeExp-SoilSamplingLocation.mxd; Plotted: 2/8/2018, 10:03:59 AM, NDePriest 9.A.4.e Packet Pg. 1094 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Table 1 Soil Sample Analytical Results Summary 9.A.4.e Packet Pg. 1095 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Table 1 Soil Sample Analytical Results Summary Chromium (mg/kg)Lead (mg/kg) Cadmium (mg/kg) SCTL Leachability Based on Groundwater 38 -7.5 SCTL Direct Exposure Residential 210 400 82 SCTL Direct Exposure Commercial/Industrial 470 1400 1700 Grove Comp-20180111 6.0 3.8 0.19 SB-3 (0-1)-20180111 2.2 1.9 ND Notes: SCTL = Soil Cleanup Target Level as set forth in 62-777, Florida Administrative Code ND = Not detected above PQL Only contaminants of concern detected above the laboratory PQL are listed. Sample ID Parameter Page 1 of 1 9.A.4.e Packet Pg. 1096 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Table 2 Surface Water Sample Analytical Results Summary 9.A.4.e Packet Pg. 1097 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Table 2 Surface Water Sample Analytical Results Summary Uranium (ug/L)Chloride (mg/L) Nitrate (mg/L) Sulfate (mg/L) Total Dissolved Solids (mg/L) SWQC ≤ 15 ---- SMI-PIP 2.8 19 2.6 54 100 Notes: SWQC = Surface Water Quality Criteria as set forth in 62-302, Florida Administrative Code Only contaminants of concern detected above the laboratory PQL are listed. Sample ID Parameter Page 1 of 1 9.A.4.e Packet Pg. 1098 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Attachment A Request for Additional Information 9.A.4.e Packet Pg. 1099 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Florida Department of Environmental Protection Bob Martinez Center 2600 Blair Stone Road Tallahassee, Florida 32399-2400 Rick Scott Governor Carlos Lopez-Cantera Lt. Governor Noah Valenstein Secretary REQUEST FOR ADDITIONAL INFORMATION November 28, 2017 Stewart Materials, LLC. c/o Mr. Nick Stewart, Chief Executive Officer 2875 Jupiter Park Drive, Suite 1100 Jupiter, Florida 33458 Re: Stewart Materials, LLC, File No. MMR_228414-005, Collier County Immokalee Sand Mine Expansion Dear Mr. Stewart: This is to acknowledge receipt of your application on October 30, 2017 for an environmental resource permit, pursuant to Part IV of Chapter 373, Florida Statutes. A Department staff review of the application and supporting documentation indicates that the application is incomplete. Pursuant to the provisions of Chapter 62-330, F.A.C., please provide the information in the attached document and refer to this correspondence in your response. Portions of the response to this correspondence must be signed, sealed, and dated by a registered Florida Professional. For the Department to continue processing your application, please submit the requested information as soon as possible. The Department must receive a response within 90 days of the date of this letter, unless a written request for additional time to provide the requested information is submitted and approved. Pursuant to Chapter 62-330 and Section 120.60, F.S., failure of an applicant to provide the timely requested information by the applicable deadline may result in denial of the application. You are encouraged to contact this office to discuss the items requested to assist you in developing a complete and adequate response. Please submit the response in electronic format to miningandmitigation@dep.state.fl.us, with a copy to Alan.Whitehouse@dep.state.fl.us. If the file is very large, you may post it to a folder on this office’s ftp site at: ftp://ftp.dep.state.fl.us/pub/incoming . After posting the document, send an e-mail to miningandmitigation@dep.state.fl.us, with a copy to Alan.Whitehouse@dep.state.fl.us, alerting us that it has been posted. If you have any questions, please contact me by telephone at 850-245-8641 or by e-mail at Alan.Whitehouse@dep.state.fl.us. 9.A.4.e Packet Pg. 1100 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Mr. Nick Stewart Page 2 of 2 November 28, 2017 Sincerely, Alan Whitehouse Environmental Specialist Florida Department of Environmental Protection Attachment: (1) 9.A.4.e Packet Pg. 1101 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Attachment: List of Requested Information Nick Stewart, Chief Executive Officer Site Name: Immokalee Sand Mine DEP Application No.: MMR_228414-005 Collier County Note: All the construction plans, stormwater management report, supplemental documentations and their revisions provided in support of the application should be dated, signed and sealed by the appropriate Florida-licensed professional. Also, please ensure that all the figures, tables and exhibits are appropriately numbered. 1. Section A, Part 1.H. The applicant reported the coordinates of the project central location as “Latitude (DMS) 26° 28' 3.91" and Longitude (DMS) 81° 27' 41.67".” However, the format of the reported longitude is not correct. Please revise the longitude format as “Longitude (DMS) - 81° 27' 41.67".” 2. Section A, Part 1.L: The applicant’s response to this item was: “No off-site discharge of mine process water or stormwater will occur as currently permitted. No named waterbodies are present, only ditches associated with the onsite citrus grove.”. However, the proposed mining activity occur within the “COW SLOUGH (WBID 3278E)” drainage. Please change the answer to this item to “COW SLOUGH.” 3. Section A, Part 2.D: Please submit the required application fee, in accordance with rule 62-4.050(4), F.A.C. 4. Section H, Part 2.1.a: In response to this item the applicant referred to drainage calculations provided in “Stormwater Management Report provided as Appendix B.” However, the Appendix B does not contain separate pre-development (existing), construction phase (during mining and reclamation) and post-development (post-reclamation) drainage/runoff maps. Please provide the requested maps as prescribed in this item. 5. Section H, Part 2.1.b: The applicant’s response to this item was: “Please refer to the Stormwater Management Report provided as Appendix B.” However, the Appendix B does not contain all the information and the drawings requested in this item. Please provide the requested maps as prescribed in this item. 6. Section H, Part 2.2.c: The applicant’s response to this item was: “Not applicable. No dewatering will occur in association with mining.” Please clarify if there are any private or public wells within 500ft of the proposed project boundary. 7. Section H, Part 2.2.f: Ambient surface water and groundwater quality characterization are necessary for the proposed project. The applicant did not provide ambient surface water or groundwater quality data. Please submit a water quality sampling plan. The sampling plan should address ambient surface water sampling (minimally in upgradient and downgradient of the project area), groundwater sampling (from minimum of one well downgradient of the groundwater flow). Since the expansion area is located immediately adjacent to the current permitted mine, it may be assumed that the mine pit water is representative of the vicinity water. As such, please collect and analyze at least one water sample from the active mine pit. 9.A.4.e Packet Pg. 1102 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Nick Stewart, Chief Executive Officer Site Name: Immokalee Sand Mine DEP Application No.: MMR_228414-005 Attachment Page 2 Water samples need to be performed according to DEP-SOP-001/01 FS 2100, Surface Water Sampling. A copy of the document can be found at the following web address: http://www.dep.state.fl.us/water/sas/sop/sops.htm. Surface water sample should be collected for analysis by a NELAC-certified laboratory for: Mercury, Specific conductivity, pH, Chloride, Sulfate, Total dissolved solids, Nitrate, Nitrite, Gross Alpha, Uranium, Combined Radionuclides (radium 226 and radium 228). Additionally, field measurements of temperature, dissolved oxygen and turbidity should be collected during sampling. Details about “Surface Water Quality Standards” can be found in Florida Administrative Code 62-302. The Department is available to discuss the specifics of a sampling plan. The applicant may also provide previously acquired sampling results for the project area. 8. Section H, Part 2.2.K: The applicant’s response to this item was: “No soil sampling has been conducted onsite or is proposed.” However, soil sampling is necessary for this project. Please submit a soil sampling plan as prescribed in this item for currently or previously under agricultural area. Soil samplings need to be performed according to DEP-SOP-001/01 FS 3000, Soil (Revision date March 31, 2008). 9. Section H, Part 3.a: please revise the analysis according to the response to comment number 4, if applicable. 9.A.4.e Packet Pg. 1103 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Attachment B Soil Sampling Plan and Soil Sampling Plan Approval 9.A.4.e Packet Pg. 1104 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) SMI IMMOKALEE SOIL SAMPLING PLAN Page 1 of 2 20180455.001A December 14, 2017 As part of the RAI Response to ERP Application No. MMR_228414-005, and based on conversation(s) with the Department, the following soil sampling plan is being proposed by Kleinfelder to address RAI Item 8. In order to assess for pollution sources from homogenous crop fields with routine agrichemical application in the proposed mining area, a composite soil sample will be collected and composited from six (6) discrete sampling sites as indicated on the Soil Sampling Location Map. The soil sample will be collected using the following methodology. Methodology The samples will be collected pursuant to DEP-SOP-001/01 FS 3000, Soil (Revision date March 31, 2008) along with the following: - The collection of samples will be performed using a hand auger and a sand bucket. - Samples will be collected at depth intervals of 0-6”. Analysis The composite sample collected from the six (6) sampling sites (Soil Sampling Location Map) will be analyzed by a NELAP-certified environmental analytical laboratory using the following analytes/methods. - Organochlorine pesticides (EPA Method 8081 or equivalent) - Organophosphorus pesticides (EPA Method 8141 or equivalent) - Chlorinated herbicides (EPA Method 8151 or equivalent) - Ethylene dibromide (EPA Method 8011 or equivalent) - Copper and Arsenic (EPA Method 6010 or equivalent) Additionally, to assess for potential impacts in areas of fuel storage, fueling, and maintenance, and proximal to any above ground storage tanks (ASTs) and/or pump houses within the proposed mining area, organic vapor analysis (OVA) will be performed at up to five (5) identified locations where fueling, AST bulk fuel storage and/or fuel use is suspected or has been identified using the following methodology. Methodology OVA analysis will be performed in general accordance with AST closure and assessment guidance as outlined in Chapter 62-762.801(2) 5, F.A.C. During field screening activities, Kleinfelder will install soil borings at cardinal points surrounding each of the ASTs and/or secondary containment structures with one (1) boring location near the containment drain valve, if present, or at areas exhibiting surface staining, stressed vegetation, or other signs of petroleum leaks or discharge. Soils will be screened at 1’-intervals from each soil boring location to a terminal depth of 10’ below ground surface (bls) or 1’ into the groundwater table, whichever is encountered first. If soils exhibit impacts based on OVA screening above background concentrations (>10 ppm), one (1) soil sample will be collected from the boring and depth interval at each area of concern exhibiting the highest OVA concentration. Analysis Any soil samples, up to a maximum of five (5), that are collected for subsequent analysis will be submitted to a NELAP-certified analytical laboratory for analysis of petroleum constituents of 9.A.4.e Packet Pg. 1105 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) SMI IMMOKALEE SOIL SAMPLING PLAN Page 2 of 2 20180455.001A December 14, 2017 concern using the following analytes/methods. - Volatile organic compounds (VOCs) including benzene, ethyl-benzene, toluene, total xylenes and methyl tert-butyl ether (EPA Method 8260 or equivalent) - Semi-volatile organic compounds (SVOCs) including 1-methylnaphthalene, 2- methylnaphthalene, acenaphthene, acenaphthylene, anthracene, benzo(a)anthracene, benzo(a)pyrene, benzo(b)fluoranthene, benzo(g,h,i)perylene, chrysene, dibenz(a,h)anthracene, fluoranthene, fluorine, indeno(1,2,3-cd)pyrene, naphthalene, phenanthrene, and pyrene (EPA Method 8270 or equivalent) - Total Recoverable Petroleum Hydrocarbons (Florida Residual Petroleum Range Organics Method) Metals: arsenic, cadmium, chromium, and lead (EPA Method 6010 or equivalent). No bulk hazardous chemical storage areas, pesticide or herbicide mixing stations, or cattle dipping vats have been identified within the area of proposed mining. If any of these or other suspected pollution sources are discovered, potential impacts will be assessed and reported to the Department, as appropriate, in accordance with Chapter 62-780, F.A.C. 9.A.4.e Packet Pg. 1106 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Soil Sampling Location Map Stewart Materials, LLCImmokalee Sand Mine ExpansionCollier County, Florida - 20180455.001A 12/7/2017 NL AWN 17-1207--Immokalee Exp-SoilSamplingLocation.mxdwww.kleinfelder.com PROJECT NO. DRAWN: DRAWN BY: CHECKED BY: FILE NAME: FIGUREThe information included on this graphic representation has beencompiled from a variety of sources and is subject to change withoutnotice. Kleinfelder makes no representations or warranties, expressor implied, as to accuracy, completeness, timeliness, or rights to theuse of such information. This document is not intended for use as aland survey product nor is it designed or intended as a constructiondesign document. The use or misuse of the information containedon this graphic representation is at the sole risk of the party using ormisusing the information. Sections 18 & 19, Township 46 South, Range 29 East Legend Expansion Project Boundary (231.0 Ac.±) Soil Sampling Locations Source: 2016 RGB 2.0-foot Orthophotos obtained from the FDOT, Surveying and Mapping Office, Image Services in the form of MrSid format. 1 inch = 400 feet 400 0 400200 Feet Document Path: \\mountdora\MOUNTDORA-DATA\GISCAD\Stewart Mining\_2017\20180455.001A_SMI-Immokalee West Expansion\03-0000 Requested Services\17-1207--ImmokaleeExp-SoilSamplingLocation.mxd; Plotted: 12/7/2017, 4:10:48 PM, NLawrence 9.A.4.e Packet Pg. 1107 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 1 Lisa Daugherty From:Mahjoor, Amirsasan <Amirsasan.Mahjoor@dep.state.fl.us> Sent:Thursday, December 14, 2017 3:41 PM To:Lisa Daugherty Cc:Whitehouse, Alan Subject:RE: Immokalee Sand Mine Soil Sampling Plan MMR 228414-005 External Email. Hello Lisa, Hello Lisa, I reviewed the proposed sampling plan. It appears to be sufficient. Please feel free to proceed with the plan. -Amir AmirSasan Mahjoor, P.G. Professional Geologist Engineering, Hydrology, and Geology Program 2600 Blair Stone Road, M.S. 3595 Tallahassee, Florida 32399 Office: 850-245-8817 AmirSasan.Mahjoor@dep.state.fl.us From: Lisa Daugherty [mailto:LDaugherty@kleinfelder.com] Sent: Thursday, December 14, 2017 2:55 PM To: Mahjoor, Amirsasan <Amirsasan.Mahjoor@dep.state.fl.us> Cc: Whitehouse, Alan <Alan.Whitehouse@dep.state.fl.us>; Bill Newlon <bnewlon@kleinfelder.com> Subject: Immokalee Sand Mine Soil Sampling Plan MMR 228414‐005 Hello Amir – As follow up to our coordination with you regarding the sampling requirements, attached please find our proposed soil sampling plan to address Item 8 of the FDEP RAI dated November 28, 2017. Please review this plan and provide concurrence or feedback at your earliest convenience. We are anticipating completing the sampling event in early January in conjunction with another project in the area. We look forward to receiving your feedback. Thank you, Lisa F. Daugherty, PMP Project Manager 9.A.4.e Packet Pg. 1108 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 2 1174 Camp Avenue Mount Dora, Florida 32757 o| 352.383.1444 x 3004 m| 407.276.4653 (Please note new mobile phone number) This email may contain confidential information. If you have received this email—including any attachments—in error, please notify the sender promptly and delete the email and any attachments from all of your systems. The linked be displayehave been ren amed, oVerify that to the corrlocation. 9.A.4.e Packet Pg. 1109 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Attachment C Laboratory Analytical Report 9.A.4.e Packet Pg. 1110 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Advanced Environmental Laboratories, Inc CERTIFICATE OF ANALYSIS This report shall not be reproduced, except in full, Report ID: 531893 - 126376 Page 1 of 16 Matt Byrum Kleinfelder 8933 Western Way, Suite 12 Jacksonville, FL 32246 January 31, 2018 RE:Workorder:F1800228 SMI IMMOKALEE Dear Matt Byrum: Enclosed are the analytical results for sample(s) received by the laboratory on Friday, January 12, 2018. Results reported herein conform to the most current NELAC standards, where applicable, unless otherwise narrated in the body of the report. The analytical results for the samples contained in this report were submitted for analysis as outlined by the Chain of Custody and results pertain only to these samples. If you have any questions concerning this report, please feel free to contact me. Sincerely, Enclosures 13100 Westlinks Terrace, Unit 10 Ft. Myers FL 33913 Payments: P.O. Box 551580Jacksonville, FL 32255-1580 Phone: (239) 674-8130 Fax: (239) 674-8128 without the written consent of Advanced Environmental Laboratories, Inc. 3004.1.0.0 9.A.4.e Packet Pg. 1111 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Advanced Environmental Laboratories, Inc CERTIFICATE OF ANALYSIS This report shall not be reproduced, except in full, Report ID: 531893 - 126376 Page 2 of 16 SAMPLE SUMMARY Workorder:F1800228 SMI IMMOKALEE Lab ID Sample ID Matrix Date Collected Date Received F1800228001 SMI-PIP Water 1/12/2018 12:20 1/12/2018 13:50 F1800228002 SB-3 (0-1)- 20180111 Soil 1/11/2018 18:17 1/12/2018 13:50 F1800228003 GROVE COMP-20180111 Soil 1/11/2018 16:15 1/12/2018 13:50 13100 Westlinks Terrace, Unit 10 Ft. Myers FL 33913 Payments: P.O. Box 551580Jacksonville, FL 32255-1580 Phone: (239) 674-8130 Fax: (239) 674-8128 without the written consent of Advanced Environmental Laboratories, Inc. 3004.1.0.0 9.A.4.e Packet Pg. 1112 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Advanced Environmental Laboratories, Inc CERTIFICATE OF ANALYSIS This report shall not be reproduced, except in full, Report ID: 531893 - 126376 Page 3 of 16 ANALYTICAL RESULTS Workorder: F1800228 SMI IMMOKALEE 01/12/18 13:50 SMI-PIP Matrix: Water RegLmt Parameters Lab ID: Sample ID: RegLmt F1800228001 Results Units Adjusted DF AnalyzedMDLQual Date Collected: Date Received: 01/12/18 12:20 Sample Description:Location: Adjusted PQL Lab METALS Analysis Desc: SW846 6020B Analysis,Total Preparation Method: SW-846 3010A Analytical Method: SW-846 6020 Uranium 2.8 ug/L 0.201 0.070 1/26/2018 14:57 J Analysis Desc: SW846 7470A Analysis,Water Preparation Method: SW-846 7470A Analytical Method: SW-846 7470A Mercury 0.000014 mg/L 0.000101 1/18/2018 13:06I0.000011 J WET CHEMISTRY Analysis Desc: IC,E300.0,Water Analytical Method: EPA 300.0 Chloride 19 mg/L 5.01 1/13/2018 03:410.11 F Nitrate 2.6 mg/L 0.501 1/13/2018 03:410.017 F Nitrite 0.042 mg/L 0.501 1/13/2018 03:41U0.042 F Sulfate 54 mg/L 5.01 1/13/2018 03:410.11 F Analysis Desc: Tot Dissolved Solids,SM2540C Analytical Method: SM 2540 C Total Dissolved Solids 100 mg/L 101 1/18/2018 16:1710 F 01/12/18 13:50 SB-3 (0-1)- 20180111 Matrix: Soil RegLmt Parameters Lab ID: Sample ID: RegLmt F1800228002 Results Units Adjusted DF AnalyzedMDLQual Date Collected: Date Received: 01/11/18 18:17 Sample Description:Location: Results for sample F1800228002 are reported on a dry weight basis. Adjusted PQL Lab METALS Analysis Desc: SW846 6010B Analysis,Soils Preparation Method: SW-846 3050B Analytical Method: SW-846 6010 Arsenic 0.13 mg/Kg 1.81 1/19/2018 11:12U0.13 M Cadmium 0.072 mg/Kg 0.301 1/19/2018 11:12I0.010 M Chromium 2.2 mg/Kg 0.301 1/19/2018 11:120.22 M Lead 1.9 mg/Kg 0.601 1/19/2018 11:120.063 M SEMIVOLATILES 13100 Westlinks Terrace, Unit 10 Ft. Myers FL 33913 Payments: P.O. Box 551580Jacksonville, FL 32255-1580 Phone: (239) 674-8130 Fax: (239) 674-8128 without the written consent of Advanced Environmental Laboratories, Inc. 3004.1.0.0 9.A.4.e Packet Pg. 1113 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Advanced Environmental Laboratories, Inc CERTIFICATE OF ANALYSIS This report shall not be reproduced, except in full, Report ID: 531893 - 126376 Page 4 of 16 ANALYTICAL RESULTS Workorder:F1800228 SMI IMMOKALEE 01/12/18 13:50 SB-3 (0-1)- 20180111 Matrix:Soil RegLmt Parameters Lab ID: Sample ID: RegLmt F1800228002 Results Units Adjusted DF AnalyzedMDLQual Date Collected: Date Received: 01/11/18 18:17 Sample Description:Location: Results for sample F1800228002 are reported on a dry weight basis. Adjusted PQL Lab Analysis Desc: FL-PRO Analysis, Soil Preparation Method: FL-PRO Analytical Method: FL-PRO TPH 12 mg/Kg 201 1/18/2018 02:16U12 M o-Terphenyl (S)94 %62-1091 1/18/2018 02:16 Nonatricontane-C39 (S)116 %60-1181 1/18/2018 02:16 Analysis Desc: 8270C-SIM Analysis, Soil Preparation Method: SW-846 3550B Analytical Method: SW-846 8270C (SIM) 1-Methylnaphthalene 0.0036 mg/Kg 0.00961 1/18/2018 01:20I0.0035 M 2-Methylnaphthalene 0.0035 mg/Kg 0.00961 1/18/2018 01:20U0.0035 M Acenaphthene 0.0030 mg/Kg 0.00961 1/18/2018 01:20U0.0030 M Acenaphthylene 0.0028 mg/Kg 0.00961 1/18/2018 01:20U0.0028 M Anthracene 0.0025 mg/Kg 0.00961 1/18/2018 01:20U0.0025 M Benzo[a]anthracene 0.0027 mg/Kg 0.00961 1/18/2018 01:20U0.0027 M Benzo[a]pyrene 0.0025 mg/Kg 0.00961 1/18/2018 01:20U0.0025 M Benzo[b]fluoranthene 0.0027 mg/Kg 0.00481 1/18/2018 01:20U0.0027 M Benzo[g,h,i]perylene 0.0067 mg/Kg 0.00961 1/18/2018 01:20U0.0067 M Benzo[k]fluoranthene 0.0023 mg/Kg 0.00961 1/18/2018 01:20U0.0023 M Chrysene 0.0027 mg/Kg 0.00961 1/18/2018 01:20U0.0027 M Dibenzo[a,h]anthracene 0.0076 mg/Kg 0.00961 1/18/2018 01:20U0.0076 M Fluoranthene 0.0024 mg/Kg 0.00961 1/18/2018 01:20U0.0024 M Fluorene 0.0030 mg/Kg 0.00961 1/18/2018 01:20U0.0030 M Indeno(1,2,3-cd)pyrene 0.0044 mg/Kg 0.00961 1/18/2018 01:20U0.0044 M Naphthalene 0.0062 mg/Kg 0.00961 1/18/2018 01:20U0.0062 M Phenanthrene 0.0024 mg/Kg 0.00961 1/18/2018 01:20U0.0024 M Pyrene 0.0022 mg/Kg 0.00961 1/18/2018 01:20U0.0022 M Nitrobenzene-d5 (S)50 %33-1341 1/18/2018 01:20 2-Fluorobiphenyl (S)57 %37-1271 1/18/2018 01:20 p-Terphenyl-d14 (S)72 %42-1411 1/18/2018 01:20 VOLATILES Analysis Desc: 8260B Analysis, Soil Preparation Method: SW-846 5035 Analytical Method: SW-846 8260B Benzene 0.00059 mg/Kg 0.00311 1/17/2018 17:36U0.00059 T Ethylbenzene 0.00034 mg/Kg 0.00311 1/17/2018 17:36U0.00034 T Methyl tert-butyl Ether (MTBE)0.0010 mg/Kg 0.00311 1/17/2018 17:36U0.0010 T Toluene 0.00042 mg/Kg 0.00311 1/17/2018 17:36U0.00042 T Xylene (Total)0.00048 mg/Kg 0.00621 1/17/2018 17:36U0.00048 T 1,2-Dichloroethane-d4 (S)110 %69-1341 1/17/2018 17:36 13100 Westlinks Terrace, Unit 10 Ft. Myers FL 33913 Payments: P.O. Box 551580Jacksonville, FL 32255-1580 Phone: (239) 674-8130 Fax: (239) 674-8128 without the written consent of Advanced Environmental Laboratories, Inc. 3004.1.0.0 9.A.4.e Packet Pg. 1114 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Advanced Environmental Laboratories, Inc CERTIFICATE OF ANALYSIS This report shall not be reproduced, except in full, Report ID: 531893 - 126376 Page 5 of 16 ANALYTICAL RESULTS Workorder:F1800228 SMI IMMOKALEE 01/12/18 13:50 SB-3 (0-1)- 20180111 Matrix:Soil RegLmt Parameters Lab ID: Sample ID: RegLmt F1800228002 Results Units Adjusted DF AnalyzedMDLQual Date Collected: Date Received: 01/11/18 18:17 Sample Description:Location: Results for sample F1800228002 are reported on a dry weight basis. Adjusted PQL Lab Toluene-d8 (S)82 %72-1221 1/17/2018 17:36 Bromofluorobenzene (S)109 %79-1261 1/17/2018 17:36 VOLATILES Analysis Desc: Percent Solids,SM2540G,Soil Analytical Method: SM 2540G Percent Moisture 19 %1 1/17/2018 13:33 M 01/12/18 13:50 GROVE COMP-20180111 Matrix:Soil RegLmt Parameters Lab ID: Sample ID: RegLmt F1800228003 Results Units Adjusted DF AnalyzedMDLQual Date Collected: Date Received: 01/11/18 16:15 Sample Description:Location: Results for sample F1800228003 are reported on a dry weight basis. Adjusted PQL Lab METALS Analysis Desc: SW846 6010B Analysis,Soils Preparation Method: SW-846 3050B Analytical Method: SW-846 6010 Arsenic 0.24 mg/Kg 0.531 1/17/2018 16:57U0.24 J Cadmium 0.19 mg/Kg 0.161 1/17/2018 16:570.033 J Chromium 6.0 mg/Kg 0.161 1/17/2018 16:570.074 J Lead 3.8 mg/Kg 0.531 1/17/2018 16:570.15 J SEMIVOLATILES Analysis Desc: 8081A Pesticide Analysis, Soil Preparation Method: SW-846 3550B Analytical Method: EPA 8081 4,4`-DDD 0.55 ug/Kg 3.41 1/16/2018 23:11U0.55 J 4,4`-DDE 0.42 ug/Kg 3.41 1/16/2018 23:11U0.42 J 4,4`-DDT 19 ug/Kg 6820 1/16/2018 15:11U19 J Aldrin 0.50 ug/Kg 3.41 1/16/2018 23:11U0.50 J Chlordane (technical)14 ug/Kg 341 1/16/2018 23:11U14 J Dieldrin 0.43 ug/Kg 3.41 1/16/2018 23:11U0.43 J Endosulfan I 0.53 ug/Kg 3.41 1/16/2018 23:11U0.53 J Endosulfan II 0.36 ug/Kg 3.41 1/16/2018 23:11U0.36 J Endosulfan Sulfate 0.62 ug/Kg 3.41 1/16/2018 23:11U0.62 J Endrin 0.93 ug/Kg 3.41 1/16/2018 23:11U0.93 J Endrin Aldehyde 0.56 ug/Kg 3.41 1/16/2018 23:11U0.56 J 13100 Westlinks Terrace, Unit 10 Ft. Myers FL 33913 Payments: P.O. Box 551580Jacksonville, FL 32255-1580 Phone: (239) 674-8130 Fax: (239) 674-8128 without the written consent of Advanced Environmental Laboratories, Inc. 3004.1.0.0 9.A.4.e Packet Pg. 1115 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Advanced Environmental Laboratories, Inc CERTIFICATE OF ANALYSIS This report shall not be reproduced, except in full, Report ID: 531893 - 126376 Page 6 of 16 ANALYTICAL RESULTS Workorder:F1800228 SMI IMMOKALEE 01/12/18 13:50 GROVE COMP-20180111 Matrix:Soil RegLmt Parameters Lab ID: Sample ID: RegLmt F1800228003 Results Units Adjusted DF AnalyzedMDLQual Date Collected: Date Received: 01/11/18 16:15 Sample Description:Location: Results for sample F1800228003 are reported on a dry weight basis. Adjusted PQL Lab Heptachlor 0.63 ug/Kg 3.41 1/16/2018 23:11U0.63 J Heptachlor Epoxide 0.46 ug/Kg 3.41 1/16/2018 23:11U0.46 J Methoxychlor 14 ug/Kg 6820 1/16/2018 15:11U14 J Toxaphene 480 ug/Kg 68020 1/16/2018 15:11U480 J alpha-BHC 0.57 ug/Kg 3.41 1/16/2018 23:11U0.57 J beta-BHC 0.39 ug/Kg 3.41 1/16/2018 23:11U0.39 J delta-BHC 0.40 ug/Kg 3.41 1/16/2018 23:11U0.40 J gamma-BHC (Lindane)0.60 ug/Kg 3.41 1/16/2018 23:11U0.60 J Tetrachloro-m-xylene (S)63 %42-1291 1/16/2018 23:11 Decachlorobiphenyl (S)77 %63-1301 1/16/2018 23:11 Analysis Desc: 8141A Org Phos Pesticide Analysis, Soil Preparation Method: SW-846 3550B Analytical Method: EPA 8141 Atrazine 13 ug/Kg 361 1/18/2018 02:22U13 J Azinphos-methyl 14 ug/Kg 361 1/18/2018 02:22U14 J Chlorpyrifos 9.8 ug/Kg 361 1/18/2018 02:22U9.8 J Chlorpyrifos-methyl 11 ug/Kg 361 1/18/2018 02:22U11 J Demeton 11 ug/Kg 361 1/18/2018 02:22U11 J Diazinon 11 ug/Kg 361 1/18/2018 02:22U11 J Dimethoate 11 ug/Kg 361 1/18/2018 02:22U11 J Disulfoton 7.9 ug/Kg 361 1/18/2018 02:22U7.9 J Ethion 10 ug/Kg 361 1/18/2018 02:22U10 J Ethoprop 8.5 ug/Kg 361 1/18/2018 02:22U8.5 J Famphur 13 ug/Kg 361 1/18/2018 02:22U13 J Fensulfothion 13 ug/Kg 361 1/18/2018 02:22U13 J Fonophos 10 ug/Kg 361 1/18/2018 02:22U10 J Malathion 11 ug/Kg 361 1/18/2018 02:22U11 J Merphos 10 ug/Kg 361 1/18/2018 02:22U10 J Methyl Parathion 7.7 ug/Kg 361 1/18/2018 02:22U7.7 J Mevinphos 14 ug/Kg 361 1/18/2018 02:22U14 J Parathion (Ethyl)11 ug/Kg 361 1/18/2018 02:22U11 J Phorate 9.7 ug/Kg 361 1/18/2018 02:22U9.7 J Phosmet 11 ug/Kg 361 1/18/2018 02:22U11 J Ronnel 9.3 ug/Kg 361 1/18/2018 02:22U9.3 J Simazine 11 ug/Kg 361 1/18/2018 02:22U11 J Tributylphosphate (S)115 %63-1111 1/18/2018 02:22 J Analysis Desc: 8151A Herbicides Analysis, Soil Preparation Method: 8151 Analytical Method: EPA 8151 2,4,5-T 9.2 ug/Kg 181 1/27/2018 15:00U9.2 J 13100 Westlinks Terrace, Unit 10 Ft. Myers FL 33913 Payments: P.O. Box 551580Jacksonville, FL 32255-1580 Phone: (239) 674-8130 Fax: (239) 674-8128 without the written consent of Advanced Environmental Laboratories, Inc. 3004.1.0.0 9.A.4.e Packet Pg. 1116 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Advanced Environmental Laboratories, Inc CERTIFICATE OF ANALYSIS This report shall not be reproduced, except in full, Report ID: 531893 - 126376 Page 7 of 16 ANALYTICAL RESULTS Workorder:F1800228 SMI IMMOKALEE 01/12/18 13:50 GROVE COMP-20180111 Matrix:Soil RegLmt Parameters Lab ID: Sample ID: RegLmt F1800228003 Results Units Adjusted DF AnalyzedMDLQual Date Collected: Date Received: 01/11/18 16:15 Sample Description:Location: Results for sample F1800228003 are reported on a dry weight basis. Adjusted PQL Lab 2,4-D 32 ug/Kg 541 1/27/2018 15:00U32 J 2,4-DB 19 ug/Kg 541 1/27/2018 15:00U19 J Dalapon 62 ug/Kg 1801 1/27/2018 15:00U62 J Dicamba 8.0 ug/Kg 181 1/27/2018 15:00U8.0 J Dichloroprop 29 ug/Kg 541 1/27/2018 15:00U29 J Dinoseb 13 ug/Kg 181 1/27/2018 15:00U13 J MCPA 1800 ug/Kg 90001 1/27/2018 15:00U1800 J MCPP 1800 ug/Kg 90001 1/27/2018 15:00U1800 J Pentachlorophenol 5.4 ug/Kg 9.01 1/27/2018 15:00U5.4 J Silvex (2,4,5-TP)6.3 ug/Kg 181 1/27/2018 15:00U6.3 J 2,4-Dichlorophenylacetic acid (S) 108 %46-1221 1/27/2018 15:00 J VOLATILES Analysis Desc: 8260B Analysis, Soil Preparation Method: SW-846 5035 Analytical Method: SW-846 8260B Ethylene Dibromide (EDB)1.5 ug/Kg 3.21 1/15/2018 11:15U1.5 J 1,2-Dichloroethane-d4 (S)102 %69-1341 1/15/2018 11:15 Toluene-d8 (S)107 %72-1221 1/15/2018 11:15 Bromofluorobenzene (S)117 %79-1261 1/15/2018 11:15 VOLATILES Analysis Desc: Percent Solids,SM2540G,Soil Analytical Method: SM 2540G Percent Moisture 6.7 %1 1/20/2018 13:38 J 13100 Westlinks Terrace, Unit 10 Ft. Myers FL 33913 Payments: P.O. Box 551580Jacksonville, FL 32255-1580 Phone: (239) 674-8130 Fax: (239) 674-8128 without the written consent of Advanced Environmental Laboratories, Inc. 3004.1.0.0 9.A.4.e Packet Pg. 1117 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.ePacket Pg. 1118Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Advanced Environmental Laboratories, Inc CERTIFICATE OF ANALYSIS This report shall not be reproduced, except in full, Report ID: 531893 - 126376 Page 8 of 16 ANALYTICAL RESULTS QUALIFIERS Workorder: F1800228 SMI IMMOKALEE PARAMETER QUALIFIERS The compound was analyzed for but not detected. The reported value is between the laboratory method detection limit and the laboratory practical quantitation limit. U I LAB QUALIFIERS DOH Certification #E82574(AEL-JAX)(FL NELAC Certification) DOH Certification #E82535(AEL-M)(FL NELAC Certification) DOH Certification #E84589(AEL-T)(FL NELAC Certification) J M T 13100 Westlinks Terrace, Unit 10 Ft. Myers FL 33913 Payments: P.O. Box 551580Jacksonville, FL 32255-1580 Phone: (239) 674-8130 Fax: (239) 674-8128 without the written consent of Advanced Environmental Laboratories, Inc. 3004.1.0.0 9.A.4.e Packet Pg. 1119 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Advanced Environmental Laboratories, Inc CERTIFICATE OF ANALYSIS This report shall not be reproduced, except in full, Report ID: 531893 - 126376 Page 9 of 16 QUALITY CONTROL DATA Workorder:F1800228 SMI IMMOKALEE QC Batch: QC Batch Method: DGMj/1037 SW-846 3050B Analysis Method:SW-846 6010 Prepared:01/16/2018 10:05 Associated Lab Samples:F1800228003 METHOD BLANK:2588125 Parameter Units Result Blank Limit Reporting Qualifiers METALS Arsenic 0.23mg/Kg 0.23 U Cadmium 0.032mg/Kg 0.032 U Chromium 0.069mg/Kg 0.069 U Lead 0.15mg/Kg 0.15 U QC Batch: QC Batch Method: MSVj/1070 SW-846 5035 Analysis Method:SW-846 8260B Prepared:01/15/2018 06:00 Associated Lab Samples:F1800228003 METHOD BLANK:2588146 Parameter Units Result Blank Limit Reporting Qualifiers VOLATILES Ethylene Dibromide (EDB)1.4ug/Kg 1.4 U 1,2-Dichloroethane-d4 (S)101%69-134 Toluene-d8 (S)99%72-122 Bromofluorobenzene (S)100%79-126 QC Batch: QC Batch Method: EXTj/1052 SW-846 3550B Analysis Method:EPA 8081 Prepared:01/16/2018 11:00 Associated Lab Samples:F1800228003 METHOD BLANK:2589105 Parameter Units Result Blank Limit Reporting Qualifiers SEMIVOLATILES alpha-BHC 0.54ug/Kg 0.54 U gamma-BHC (Lindane)0.57ug/Kg 0.57 U beta-BHC 0.37ug/Kg 0.37 U delta-BHC 0.38ug/Kg 0.38 U Heptachlor 0.60ug/Kg 0.60 U Aldrin 0.48ug/Kg 0.48 U Heptachlor Epoxide 0.44ug/Kg 0.44 U 13100 Westlinks Terrace, Unit 10 Ft. Myers FL 33913 Payments: P.O. Box 551580Jacksonville, FL 32255-1580 Phone: (239) 674-8130 Fax: (239) 674-8128 without the written consent of Advanced Environmental Laboratories, Inc. 3004.1.0.0 9.A.4.e Packet Pg. 1120 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Advanced Environmental Laboratories, Inc CERTIFICATE OF ANALYSIS This report shall not be reproduced, except in full, Report ID: 531893 - 126376 Page 10 of 16 QUALITY CONTROL DATA Workorder:F1800228 SMI IMMOKALEE METHOD BLANK:2589105 Parameter Units Result Blank Limit Reporting Qualifiers Endosulfan I 0.50ug/Kg 0.50 U 4,4`-DDE 0.40ug/Kg 0.40 U Dieldrin 0.41ug/Kg 0.41 U Endrin 0.89ug/Kg 0.89 U 4,4`-DDD 0.52ug/Kg 0.52 U Endosulfan II 0.34ug/Kg 0.34 U Endrin Aldehyde 0.53ug/Kg 0.53 U 4,4`-DDT 0.89ug/Kg 0.89 U Endosulfan Sulfate 0.59ug/Kg 0.59 U Methoxychlor 0.65ug/Kg 0.65 U Chlordane (technical)13ug/Kg 13 U Toxaphene 23ug/Kg 23 U Tetrachloro-m-xylene (S)59%42-129 Decachlorobiphenyl (S)72%63-130 QC Batch: QC Batch Method: WCAf/1036 EPA 300.0 Analysis Method:EPA 300.0 Prepared: Associated Lab Samples:F1800228001 METHOD BLANK:2589470 Parameter Units Result Blank Limit Reporting Qualifiers WET CHEMISTRY Chloride 3.8mg/L 0.11 I Nitrite 0.042mg/L 0.042 U Nitrate 0.017mg/L 0.017 U Sulfate 0.11mg/L 0.11 U QC Batch: QC Batch Method: EXTj/1063 SW-846 3550B Analysis Method:EPA 8141 Prepared:01/17/2018 09:00 Associated Lab Samples:F1800228003 METHOD BLANK:2589944 Parameter Units Result Blank Limit Reporting Qualifiers SEMIVOLATILES Mevinphos 13ug/Kg 13 U Demeton 10ug/Kg 10 U Ethoprop 7.7ug/Kg 7.7 U 13100 Westlinks Terrace, Unit 10 Ft. Myers FL 33913 Payments: P.O. Box 551580Jacksonville, FL 32255-1580 Phone: (239) 674-8130 Fax: (239) 674-8128 without the written consent of Advanced Environmental Laboratories, Inc. 3004.1.0.0 9.A.4.e Packet Pg. 1121 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Advanced Environmental Laboratories, Inc CERTIFICATE OF ANALYSIS This report shall not be reproduced, except in full, Report ID: 531893 - 126376 Page 11 of 16 QUALITY CONTROL DATA Workorder:F1800228 SMI IMMOKALEE METHOD BLANK:2589944 Parameter Units Result Blank Limit Reporting Qualifiers Phorate 8.8ug/Kg 8.8 U Diazinon 10ug/Kg 10 U Disulfoton 7.2ug/Kg 7.2 U Ronnel 8.5ug/Kg 8.5 U Methyl Parathion 7.1ug/Kg 7.1 U Chlorpyrifos 8.9ug/Kg 8.9 U Merphos 9.2ug/Kg 9.2 U Fensulfothion 12ug/Kg 12 U Azinphos-methyl 12ug/Kg 12 U Dimethoate 10ug/Kg 10 U Fonophos 9.2ug/Kg 9.2 U Chlorpyrifos-methyl 10ug/Kg 10 U Malathion 9.8ug/Kg 9.8 U Parathion (Ethyl)9.8ug/Kg 9.8 U Ethion 9.2ug/Kg 9.2 U Famphur 12ug/Kg 12 U Phosmet 10ug/Kg 10 U Atrazine 12ug/Kg 12 U Simazine 10ug/Kg 10 U Tributylphosphate (S)85%63-111 QC Batch: QC Batch Method: EXTm/1054 SW-846 3550B Analysis Method:SW-846 8270C (SIM) Prepared:01/17/2018 13:30 Associated Lab Samples:F1800228002 METHOD BLANK:2590633 Parameter Units Result Blank Limit Reporting Qualifiers SEMIVOLATILES Naphthalene 0.0050mg/Kg 0.0050 U 2-Methylnaphthalene 0.0028mg/Kg 0.0028 U 1-Methylnaphthalene 0.0028mg/Kg 0.0028 U Acenaphthylene 0.0023mg/Kg 0.0023 U Acenaphthene 0.0024mg/Kg 0.0024 U Fluorene 0.0024mg/Kg 0.0024 U Phenanthrene 0.0020mg/Kg 0.0020 U Anthracene 0.0020mg/Kg 0.0020 U Fluoranthene 0.0019mg/Kg 0.0019 U Pyrene 0.0018mg/Kg 0.0018 U Benzo[a]anthracene 0.0022mg/Kg 0.0022 U Chrysene 0.0022mg/Kg 0.0022 U Benzo[b]fluoranthene 0.0022mg/Kg 0.0022 U 13100 Westlinks Terrace, Unit 10 Ft. Myers FL 33913 Payments: P.O. Box 551580Jacksonville, FL 32255-1580 Phone: (239) 674-8130 Fax: (239) 674-8128 without the written consent of Advanced Environmental Laboratories, Inc. 3004.1.0.0 9.A.4.e Packet Pg. 1122 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Advanced Environmental Laboratories, Inc CERTIFICATE OF ANALYSIS This report shall not be reproduced, except in full, Report ID: 531893 - 126376 Page 12 of 16 QUALITY CONTROL DATA Workorder:F1800228 SMI IMMOKALEE METHOD BLANK:2590633 Parameter Units Result Blank Limit Reporting Qualifiers Benzo[k]fluoranthene 0.0019mg/Kg 0.0019 U Benzo[a]pyrene 0.0021mg/Kg 0.0021 U Indeno(1,2,3-cd)pyrene 0.0036mg/Kg 0.0036 U Dibenzo[a,h]anthracene 0.0062mg/Kg 0.0062 U Benzo[g,h,i]perylene 0.0054mg/Kg 0.0054 U Nitrobenzene-d5 (S)66%33-134 2-Fluorobiphenyl (S)72%37-127 p-Terphenyl-d14 (S)93%42-141 QC Batch: QC Batch Method: EXTm/1055 FL-PRO Analysis Method:FL-PRO Prepared:01/17/2018 13:30 Associated Lab Samples:F1800228002 METHOD BLANK:2590643 Parameter Units Result Blank Limit Reporting Qualifiers SEMIVOLATILES TPH 9.5mg/Kg 9.5 U o-Terphenyl (S)91%62-109 Nonatricontane-C39 (S)112%60-118 QC Batch: QC Batch Method: DGMj/1050 SW-846 7470A Analysis Method:SW-846 7470A Prepared:01/18/2018 09:30 Associated Lab Samples:F1800228001 METHOD BLANK:2591298 Parameter Units Result Blank Limit Reporting Qualifiers METALS Mercury 0.000011mg/L 0.000011 U QC Batch: QC Batch Method: DGMm/1032 SW-846 3050B Analysis Method:SW-846 6010 Prepared:01/18/2018 09:30 Associated Lab Samples:F1800228002 13100 Westlinks Terrace, Unit 10 Ft. Myers FL 33913 Payments: P.O. Box 551580Jacksonville, FL 32255-1580 Phone: (239) 674-8130 Fax: (239) 674-8128 without the written consent of Advanced Environmental Laboratories, Inc. 3004.1.0.0 9.A.4.e Packet Pg. 1123 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Advanced Environmental Laboratories, Inc CERTIFICATE OF ANALYSIS This report shall not be reproduced, except in full, Report ID: 531893 - 126376 Page 13 of 16 QUALITY CONTROL DATA Workorder:F1800228 SMI IMMOKALEE METHOD BLANK:2591464 Parameter Units Result Blank Limit Reporting Qualifiers METALS Arsenic 0.10mg/Kg 0.10 U Cadmium 0.0084mg/Kg 0.0084 U Chromium 0.18mg/Kg 0.18 U Lead 0.052mg/Kg 0.052 U QC Batch: QC Batch Method: MSVt/1072 SW-846 5035 Analysis Method:SW-846 8260B Prepared:01/17/2018 13:30 Associated Lab Samples:F1800228002 METHOD BLANK:2591671 Parameter Units Result Blank Limit Reporting Qualifiers VOLATILES Methyl tert-butyl Ether (MTBE) 0.0010mg/Kg 0.0010 U Benzene 0.00057mg/Kg 0.00057 U Toluene 0.00041mg/Kg 0.00041 U Ethylbenzene 0.00033mg/Kg 0.00033 U Xylene (Total)0.00047mg/Kg 0.00047 U 1,2-Dichloroethane-d4 (S)99%69-134 Toluene-d8 (S)84%72-122 Bromofluorobenzene (S)104%79-126 QC Batch: QC Batch Method: DGMj/1052 SW-846 3010A Analysis Method:SW-846 6020 Prepared:01/19/2018 03:30 Associated Lab Samples:F1800228001 METHOD BLANK:2591938 Parameter Units Result Blank Limit Reporting Qualifiers METALS Uranium 0.070ug/L 0.070 U QC Batch: QC Batch Method: WCAf/1063 SM 2540 C Analysis Method:SM 2540 C Prepared: Associated Lab Samples:F1800228001 13100 Westlinks Terrace, Unit 10 Ft. Myers FL 33913 Payments: P.O. Box 551580Jacksonville, FL 32255-1580 Phone: (239) 674-8130 Fax: (239) 674-8128 without the written consent of Advanced Environmental Laboratories, Inc. 3004.1.0.0 9.A.4.e Packet Pg. 1124 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Advanced Environmental Laboratories, Inc CERTIFICATE OF ANALYSIS This report shall not be reproduced, except in full, Report ID: 531893 - 126376 Page 14 of 16 QUALITY CONTROL DATA Workorder: F1800228 SMI IMMOKALEE METHOD BLANK: 2593975 Parameter Units Result Blank Limit Reporting Qualifiers WET CHEMISTRY Total Dissolved Solids 10mg/L 10 U QC Batch: QC Batch Method: EXTj/1106 8151 Analysis Method: EPA 8151 Prepared:01/23/2018 12:00 Associated Lab Samples: F1800228003 METHOD BLANK: 2597050 Parameter Units Result Blank Limit Reporting Qualifiers SEMIVOLATILES Dalapon 57ug/Kg 57 U Dicamba 7.4ug/Kg 7.4 U Dichloroprop 26ug/Kg 26 U 2,4-D 30ug/Kg 30 U Pentachlorophenol 5.0ug/Kg 5.0 U Silvex (2,4,5-TP)5.8ug/Kg 5.8 U 2,4,5-T 8.5ug/Kg 8.5 U 2,4-DB 17ug/Kg 17 U Dinoseb 12ug/Kg 12 U MCPA 1600ug/Kg 1600 U MCPP 1700ug/Kg 1700 U 2,4-Dichlorophenylacetic acid (S) 100%46-122 QUALITY CONTROL DATA QUALIFIERS Workorder: F1800228 SMI IMMOKALEE QUALITY CONTROL PARAMETER QUALIFIERS The compound was analyzed for but not detected. The reported value is between the laboratory method detection limit and the laboratory practical quantitation limit. U I 13100 Westlinks Terrace, Unit 10 Ft. Myers FL 33913 Payments: P.O. Box 551580Jacksonville, FL 32255-1580 Phone: (239) 674-8130 Fax: (239) 674-8128 without the written consent of Advanced Environmental Laboratories, Inc. 3004.1.0.0 9.A.4.e Packet Pg. 1125 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Advanced Environmental Laboratories, Inc CERTIFICATE OF ANALYSIS This report shall not be reproduced, except in full, Report ID: 531893 - 126376 Page 15 of 16 QUALITY CONTROL DATA CROSS REFERENCE TABLE Workorder:F1800228 SMI IMMOKALEE Lab ID Sample ID Prep Method Analysis MethodPrep Batch Batch Analysis F1800228003 DGMj/1037GROVE COMP-20180111 ICPj/1019SW-846 3050B SW-846 6010 F1800228003 MSVj/1070GROVE COMP-20180111 MSVj/1071SW-846 5035 SW-846 8260B F1800228003 EXTj/1052GROVE COMP-20180111 GCSj/1033SW-846 3550B EPA 8081 F1800228001 SMI-PIP WCAf/1036EPA 300.0 F1800228003 EXTj/1063GROVE COMP-20180111 GCSj/1050SW-846 3550B EPA 8141 F1800228002 SB-3 (0-1)- 20180111 WCAm/1121SM 2540G F1800228002 EXTm/1054SB-3 (0-1)- 20180111 MSSm/1027SW-846 3550B SW-846 8270C (SIM) F1800228002 EXTm/1055SB-3 (0-1)- 20180111 GCSm/1028FL-PRO FL-PRO F1800228001 DGMj/1050SMI-PIP CVAj/1010SW-846 7470A SW-846 7470A F1800228002 DGMm/1032SB-3 (0-1)- 20180111 ICPm/1033SW-846 3050B SW-846 6010 F1800228002 MSVt/1072SB-3 (0-1)- 20180111 MSVt/1073SW-846 5035 SW-846 8260B F1800228001 DGMj/1052SMI-PIP ICMj/1013SW-846 3010A SW-846 6020 F1800228003 GROVE COMP-20180111 WCAj/1102SM 2540G F1800228001 SMI-PIP WCAf/1063SM 2540 C F1800228003 EXTj/1106GROVE COMP-20180111 GCSj/10658151EPA 8151 13100 Westlinks Terrace, Unit 10 Ft. Myers FL 33913 Payments: P.O. Box 551580Jacksonville, FL 32255-1580 Phone: (239) 674-8130 Fax: (239) 674-8128 without the written consent of Advanced Environmental Laboratories, Inc. 3004.1.0.0 9.A.4.e Packet Pg. 1126 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Page 16 of 16 Wednesday, January 31, 2018 3:09:57 PM 9.A.4.ePacket Pg. 1127Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road 9.A.4.e Packet Pg. 1128 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1129 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1130 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1131 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1132 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1133 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1134 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1135 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1136 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1137 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1138 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.ePacket Pg. 1139Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road 9.A.4.e Packet Pg. 1140 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1141 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1142 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1143 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) CU-PL20190000808 9.A.4.e Packet Pg. 1144 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) CU-PL20190000808 9.A.4.e Packet Pg. 1145 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) CU-PL20190000808 9.A.4.e Packet Pg. 1146 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) CU-PL201900008089.A.4.ePacket Pg. 1147Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.ePacket Pg. 1148Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 4365 Radio Road • Suite 201 • Naples, FL 34104 • P: 239.434.6060 • www.davidsonengineering.com Civil Engineering • Planning • Permitting D esigningE xcellence M E M O R A N D U M September 22, 2020 To: Timothy Finn, AICP Principal Planner, Collier County Zoning Division From: Sean Sammon, Planner Reviewed By: Jessica Harrelson, AICP, Senior Planner RE: EDWARDS GROVE ROAD MINE – CU PL20190000808 Neighborhood Information Meeting Summary Davidson Engineering conducted a Neighborhood Information Meeting (NIM) for the subject Conditional Use on Thursday, July 23, 2020 at 5:30pm. The meeting was held at the Immokalee Sports Complex, located at 505 Escambia Street, Immokalee, FL 34142. Jessica Harrelson, AICP, with Davidson Engineering, was in attendance to represent the applicant and make a presentation. There were zero individuals from the public that attended the meeting (in-person). Three individuals, listed below, virtually participated in the meeting via Zoom: Zoom Participants: James Morris (jmcubsfan1988@gmail.com) Patty Swilley (junco_motorsports@msn.com) Rafael Jimenez (rafaele.jimenez@cemex.com) The following individuals, associated with the project, were in attendance: Jessica Harrelson, AICP, Davidson Engineering, Inc. (in-person) Sean Sammon, Davidson Engineering, Inc. (in-person) Ed Almedia, Stewart Materials (in-person) Rudd Jones, Stewart Materials (Zoom) Nick Stewart, Stewart Materials (Zoom) 9.A.4.e Packet Pg. 1149 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 2 Jessica Harrelson, agent for the applicant, began the presentation at approximately 5:30p.m. and reviewed: • Request for application for Conditional Use • Review of the total site area, location, and zoning • Master Concept Plan o Development Area o Access and Circulation o Perimeter Landscape Buffers o Right-of-Way Reservation • Currently proposed conditions of approval Jessica communicated that currently the Conditional Use Application is still under review by County Staff, once application is deemed sufficient by all reviewers, it will move on to the Hearing process: first heard by the CCPC for recommendation and then move onto the BCC for final action. Jessica made known to everyone that they can contact her and/or the county planner for any additional information. Following the presentation, attendees were asked for questions or comments. No questions were asked, and any future questions were suggested to contact the planners by email directly. A copy of the PowerPoint presentation is attached. 9.A.4.e Packet Pg. 1150 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1151 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Join by phone for Audio: 1.646.558.8656 Meeting ID: 955 6023 1837 9.A.4.e Packet Pg. 1152 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 TOTAL NEW SITE AREA: 450.7-ACRES 9.A.4.e Packet Pg. 1153 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 LOCATION SUBJECT PROPERTY LOCATION R 9.A.4.e Packet Pg. 1154 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 ZONING AGRICULTURAL – MOBILE HOME OVERLAY- RURAL LANDS STEWARDSHIP AREA OVERLAY 9.A.4.e Packet Pg. 1155 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 MASTER CONCEPT PLANDevelopment Area= ±422.5-acres 9.A.4.e Packet Pg. 1156 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 EXISTING INGRESS/ EGRESS (TO REMAIN) ON-SITE VEHICULAR CIRCULATION ACCESS & CIRCULATION 9.A.4.e Packet Pg. 1157 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Perimeter Landscape Buffers 10’ Type A 10’ Type A 10’ Type A 10’ Type A 9.A.4.e Packet Pg. 1158 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 ROW RESERVATION 200’ ROW RESERVATION 9.A.4.e Packet Pg. 1159 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 CONDITIONS OF APPROVAL 1.The petitioner shall obtain a South Florida Water Management District Agricultural Surface Water Management Permit or permit modification for this site,if applicable. 2.The site shall be cleared of all exotic vegetation and maintained exotic-free in perpetuity. 3.Material hauling activities are permitted from 5:00 a.m.to 5:00 p.m.,Monday through Saturday. 4.The excavation shall be contained by a berm constructed to the height of the 100-year flood elevation.Unless the berm contains adequate clay content to slow the flow of water (as determined by the Collier County Transportation Engineering Division),the berm shall contain a membrane impervious to water. 5.The site shall be limited to a maximum of 49 pm peak hour,two-way trips based on the use codes in the ITE Manual on trip generation rates in effect at time of application for SDP/SDPA or subdivision plat approval,or based on an alternate methodology accepted by staff at time of application for SDP/SDPA in accordance with the County’s Traffic Impact Statement (TIS) guidelines in Resolution No.2006-299,as it may be amended. 6.Evidence of U.S.Fish and Wildlife Service (FWS)and Florida Fish and Wildlife Conservation Commission (FWC)accepted mitigation for impacts to panthers,woodstorks,Florida black bear and other listed species will be required prior to excavation permit approval. 7.A littoral shelf planting area to commence during the reclamation phase of the project shall be shown on the excavation permit for this petition and shall meet the current standards of the Land Development Code at time of submittal of the Commercial Excavation Permit. 8.Prior to any vehicular use of the site,the owner shall post two (2)signs along the entry drive,clearly visible to vehicles entering and leaving the site,providing information regarding potential panther presence and notifying drivers of the need to use caution.Sign wording,placement and size will be subject to review and approval by the Collier County Environmental Staff.The owner shall submit,and receive approval,of the proposed signage in conjunction with the Commercial Excavation Application or other local development order as may be required,which may allow vehicular use of the site. 9.All other applicable state or federal permits must be obtained before commencement of the development. 10.Pursuant to Section 125.022(5)F.S.,issuance of a development permit by a County does not in any way create any rights on the part of the applicant to obtain a permit from a state or federal agency and does not create any liability on the part of the county for issuance of the permit if the applicant fails to obtain requisite approvals or fulfill the obligations imposed by a state or federal agency or undertakes actions that result in a violation of state or federal law. 11.The westernmost 200 feet of the parcel shall be reserved for right-of-way,for the purpose of the future Little League Road extension. 12.The petitioner shall be responsible for maintenance of Edwards Grove Road,from State Road 82 to the subject property line,for the duration of the mining operation.Edwards Grove Road shall be paved a minimum of 22 feet in width and a depth of 1.5 inches of asphalt or asphalt millings. 9.A.4.e Packet Pg. 1160 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 AGENT: Jessica Harrelson, AICP Email: Jessica@davidsonengineering.com COUNTY PLANNER: Timothy Finn, AICP Email: Timothy.Finn@colliercountyfl.gov 9.A.4.e Packet Pg. 1161 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine CU-PL20190000808 AFFIDAVIT OF COMPLIANCE I hereby certify that pursuant to Ordinance 2004-41, of the Collier County Land Development Code, I did cause the attached newspaper advertisement to appear and I did give notice by mail to the following property owners and/or condominium and civic associations whose members may be affected by the proposed land use changes of an application request for a Planned Unit Development Rezone and Growth Management Plan Amendment, at least 15 days prior to the scheduled Neighborhood Information Meeting. For the purposes of this requirement, the names and addresses of property owners shall be deemed those appearing on the latest tax rolls of Collier County and any other persons or entities who have made a formal request of the county to be notified. The said notice contained the laymen’s description of the site property of proposed change and the date, time, and place of a Neighborhood Information Meeting. Per the attached letters, property owner’s list, and copy of newspaper advertisement which are hereby made a part of this Affidavit of Compliance _________________________________________________ Jessica Harrelson, AICP State of Florida County of Collier The foregoing Affidavit of compliance was acknowledged before me this _22nd_ day of _September_______, 2020 by Jessica Harrelson, AICP, who is personally known to me. _____________________________________________ (Signature of Notary Public) (Notary Seal) Tocia Hamlin__________________________________ Printed Name of Notary 9.A.4.e Packet Pg. 1162 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1163 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1164 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1165 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1166 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 1 NAME1 NAME2 NAME3 NAME4 NAME6 BARRON COLLIER P'SHIP LLLP 2600 GOLDEN GATE PKWY # 200 NAPLES, FL 34105---3227 E & B MILLER FAMILY FLORIDA LIMITED PARTNERSHIP PO BOX 728 LABELLE, FL 33975---728 JOHNSON PLANTS INC 1255 N 15TH ST #7 IMMOKALEE, FL 34142---2859 RINKER MATERIALS WEST LLC 1501 BELVEDERE RD WEST PALM BEACH, FL 33406---1501 SOUTHWESTERN PROPERTIES LLC 2875 JUPITER PARK DR #1100 JUPITER, FL 33458---0 TIITF /ED UNIV FL UNIV OF FL EXP STATION % DEP DOUGLAS BLDG 3900 COMMONWEALTH BLVD TALLAHASSEE, FL 32399---3000 TIPPEN BAY PROPERTIES LLLP PO BOX 2357 LABELLE, FL 33975---2357 TURNER GROVES CITRUS LTD PRTNR ATTN: RICH CHOMA CONSOLIDATED CITRUS LTD PRTNR 3602 COLONIAL CT FORT MYERS, FL 33913---6636 IMMOKALEE CIVIC ASSOCIATION ATTN: MR. LEO RODGERS 502 E. NEW MARKET RD.IMMOKALEE, FL 34142---2859 Notice: This data belongs to the Collier County Property Appraiser's Office (CCPA). Therefore, the recipient agrees not to represent this data to anyone as other than CCPA provided data. The recipient may not transfer this data to others without consent from the CCPA. Petition: PL20190000808 | Buffer: 1000' | Date: 4/23/2020 | Site Location: 00065520004 and 00065680009 2020-05-27 LABELS- SPREADSHEET 9.A.4.e Packet Pg. 1167 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 4365 Radio Road • Suite 201 • Naples, FL 34104 • P: 239.434.6060 • www.davidsonengineering.com D esigningE xcellence Civil Engineering • Planning • Permitting June 26, 2020 Dear Property Owner, The public is invited to attend a Neighborhood Information Meeting, held by Davidson Engineering, Inc. on: Thursday, July 23rd, 2020 at 5:30 p.m., at the Immokalee Sports Complex, located at 505 Escambia Street, Immokalee, Florida, 34142 The subject site consists of two parcels, approximately 1.3 miles south of SR 82 and approximately 1 mile west of SR 29, in Section 18 and 19, Township 46 South, Range 29 East in Immokalee, Florida (see back for location map). A formal application has been submitted to Collier County seeking approval for the following: Edwards Grove Road Mine Conditional Use (CU-PL20190000808): To obtain a Conditional Use (CU) for a ±450.7-acre site, consisting of two separately owned parcels. The request is to expand the existing commercial excavation operation, known as Stewart Mining, to include the property adjacent to the west. This request will replace and repeal the existing Conditional Use on the Stewart Mining property. Business and property owners, residents and visitors are welcome to attend the presentation to discuss the project. If you are unable to attend the meeting in-person and would like the opportunity to participate virtually, an on-line Zoom meeting will be available. Reservations for in-person meeting attendance is required to ensure that the CDC guidelines for social distancing can be achieved and details related to joining the meeting via Zoom can be obtained by contacting the individual listed below. If you are unable to attend the meeting in-person or participate virtually, and have questions or comments, they can also be directed by mail, phone or e-mail to the individual below: Jessica Harrelson, AICP Davidson Engineering, Inc. 4365 Radio Road, Suite 201 Naples, FL 34104 Phone: 239-434-6060 Email: jessica@davidsonengineering.com 9.A.4.e Packet Pg. 1168 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1169 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Edwards Grove Road Mine- Conditional Use PL20190000808 SIGN POSTING INSTRUCTIONS (CHAPTER 8, COLLIER COUNTY ADMINISTRATIVE CODE FOR LAND DEVELOPMENT) A zoning sign(s) must be posted by the petitioner or the petitioner’s agent on the parcel for a minimum of fifteen (15) calendar days in advance of the first public hearing and said sign(s) must be maintained by the petitioner or the petitioner’s agent through the Board of County Commissioners Hearing. Below are general guidelines for signs, however these guidelines should not be construed to supersede any requirement of the LDC. For specific sign requirements, please refer to the Administrative Code, Chapter 8 E. 1.The sign(s) must be erected in full view of the public, not more than five (5) feet from the nearest street right-of-way or easement. 2.The sign(s) must be securely affixed by nails, staples, or other means to a wood frame or to a wood panel and then fastened securely to a post, or other structure. The sign may not be affixed to a tree or other foliage. 3.The petitioner or the petitioner’s agent must maintain the sign(s) in place, and readable condition until the requested action has been heard and a final decision rendered. If the sign(s) is destroyed, lost, or rendered unreadable, the petitioner or the petitioner’s agent must replace the sign(s) - - - - - - - - - - - - - - - - - - - - - - - - --- - - - - -- AFFIDAVIT OF POSTING NOTICE STATE OF FLORIDA COUNTY OF COLLIER BEFORE THE UNDERSIGNED AUTHORITY, PERSONALLY APPEARED JESSICA HARRELSON, AICP WHO ON OATH SAYS THAT HE/SHE HAS POSTED PROPER NOTICE AS REQUIRED BY SECTION 10.03.00 OF THE COLLIER COUNTY LAND DEVELOPMENT CODE ON THE PARCEL COVERED IN PETITION NUMBER CU- PL20190000808. 4365 Radio Road, Suite 201 SIGNATURE OF APPLICANT OR AGENT STREET OR P.O. BOX Jessica Harrelson, AICP, Senior Planner, Davidson Engineering, Inc. Naples, FL 34104 NAME (TYPED OR PRINTED) CITY, STATE ZIP STATE OF FLORIDA COUNTY OF COLLIER The foregoing instrument was sworn to and subscribed before me this 22nd day of September , 2020, by Jessica Harrelson, AICP, who is personally known to me and who did take an oath. Signature of Notary Public Tocia Hamlin Rosa Printed Name of Notary Public My Commission Expires: (Stamp with serial number) NOTE: AFTER THE SIGN HAS BEEN POSTED, THIS AFFIDAVIT OF POSTING NOTICE SHOULD BE RETURNED NO LATER THAN TEN (10) WORKING DAYS BEFORE THE FIRST HEARING DATE TO THE ASSIGNED PLANNER. 9.A.4.e Packet Pg. 1170 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1171 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1172 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1173 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Experimental RD Revello ST State STO Quinn RDEdwards Grove RDJohnson RDLamm RD¯SR 29C R 8 46 C R 8 5 8CR 850IM MO K A L E E R D E SR 82 SR 29 N0 105Miles 0 0.50.25 Miles Stewart Materials, LLCSTEWART MATERIALS CU 2301 & 2315 Edwards Grove Rd,Immokalee, FL 34142 LOCATION MAP Z:\Active Projects\S\STEWART MINING\DWG\PLANNING\GIS\Stewart Mining CU location.mxd Date Saved: 12/19/2019 PROJECT: NOTES: EXHIBIT DESC: 4365 RADIO ROADSUITE 201NAPLES, FL 34104239-434-6060 CLIENT: LOCATION: Legend Subject property: ±450.7 acres 9.A.4.e Packet Pg. 1174 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road LEGEND EXPANSION SITE EXISTING MINE SITE SOURCES: COLLIER COUNTY GEOGR APHIC INFOR MATION SYSTEMS (2019)¯0 800400Feet Southwestern Properties, LLC &Tippen Bay Properties, LLLP LOCATION MAPSTEWART MATERIAL S 2301 & 2315 Edward s Grove Road C:\Users\Jessica.Harrelson.DE-LAN\Desktop\2020-03-23 STEWART M IN E.mxd Date Saved: 3/23/2020 PROJECT: NOTES: EXHIBIT DESC: 4365 RADIO ROA DSUITE 201NAPLES, FL 34104239-434-6060 CLIENT: LOCATION:Edwards Grove Road Mine 9.A.4.e Packet Pg. 1175 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 3/17/2017 Page 7 of 14 STATEMENT OF UTILITY PROVISIONS FOR CONDITIONAL USE REQUEST APPLICANT INFORMATION Name of Applicant(s): ___________________________________________________________ Address: ______________________________City: ___________ State: ________ ZIP: _______ Telephone: ____________________ Cell: _____________________ Fax: __________________ E-Mail Address: ________________________________________________________________ Address of Subject Property (If available): ___________________________________________ City: ________________ State: __________ ZIP: ___________ LEGAL DESCRIPTION Section/Township/Range: / / Lot: Block: Subdivision: _______________________________________________ Plat Book: Page #: Property I.D. Number: _________________________________ Metes & Bounds Description: _____________________________________________________ TYPE OF SEWAGE DISPOSAL TO BE PROVIDED Check applicable system: a. County Utility System b. City Utility System c. Franchised Utility System Provide Name: ____________________ d. Package Treatment Plant (GPD Capacity): ___________________ e. Septic System TYPE OF WATER SERVICE TO BE PROVIDED a. County Utility System b. City Utility System c. Franchised Utility System PROVIDE NAME_______________ d. Private System (Well) Total Population to be served: ____________________________________________________ Peak and Average Daily Demands: A. Water-Peak: _______ Average Daily: ________ B. Sewer-Peak: _______ Average Daily: ________ 9.A.4.e Packet Pg. 1176 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU))Southwestern Properties, LLC and Tippen Bay Properties, LLLP 2875 Jupiter Park Dr, 1100 Jupiter FL 33458 561.972.4517 Rudd@stewartmaterials.com 2315 Edwards Grove Rd Immokalee FL 34142 18/19 46 29 00065520004 & 00065680009 See attached survey N/A 4 4 COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 3/17/2017 Page 8 of 14 If proposing to be connected to Collier County Regional Water System, please provide the date service is expected to be required: ____________________________________________ Narrative statement: Provide a brief and concise narrative statement and schematic drawing of sewage treatment process to be used as well as a specific statement regarding the method of affluent and sludge disposal. If percolation ponds are to be used, then percolation data and soil involved shall be provided from tests prepared and certified by a professional engineer. ______________________________________________________________________________ ______________________________________________________________________________ ______________________________________________________________________________ ______________________________________________________________________________ County Utility Dedication Statement: If the project is located within the service boundaries of Collier County’s utility service system, a notarized statement shall be provided agreeing to dedicate the water distribution and sewage collection facilities within the project area to the Collier County Utilities. This shall occur upon completion of the construction of these facilities in accordance with all applicable County ordinances in effect at that time. This statement shall also include an agreement that the applicable system development charges and connection fees will be paid to the County Utilities Division prior to the issuance of building permits by the County. If applicable, the statement shall contain an agreement to dedicate the appropriate utility easements for serving the water and sewer systems. ______________________________________________________________________________ ______________________________________________________________________________ ______________________________________________________________________________ ______________________________________________________________________________ Statement of Availability Capacity from other Providers: Unless waived or otherwise provided for at the pre-application meeting, if the project is to receive sewer or potable water services from any provider other than the County, a statement from that provider indicating adequate capacity to serve the project shall be provided. 9.A.4.e Packet Pg. 1177 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU))N/A N/A. N/A. COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 3/17/2017 Page 9 of 14 RECORDING OF DEVELOPER COMMITMENTS Within 30 days of adoption of the Ordinance, the owner or developer at their expense shall record in the Public Records of Collier County a Memorandum of Understanding of Developer Commitments or Notice of Developer Commitments that contains the legal description of the property that is the subject of the land use petition and contains each and every commitment of the owner or developer specified in the Ordinance. The Memorandum or Notice shall be in form acceptable to the County and shall comply with the recording requirements of F.S. §695. A recorded copy of the Memorandum or Notice shall be provided to the assigned Principal Planner, Zoning Services Department, within 15 days of recording of said Memorandum or Notice. Chapter 8 of the Administrative Code requires that the applicant must remove their public hearing advertising sign(s) after final action is taken by the Board of County Commissioners. Based on the Board's final action on this item, please remove all public hearing advertising sign(s) immediately. 9.A.4.e Packet Pg. 1178 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Historic Preservation/Forms/rev. 06/05/08 1 COLLIER COUNTY WAIVER APPLICATION FROM THE REQUIRED HISTORICAL AND ARCHAEOLOGICAL SURVEY AND ASSESSMENT DATE SUBMITTED: _______________ PLANNER: PETITION NUMBER ASSOCIATED WITH THE WAIVER: _____________________ (To Be Completed By Zoning and Land Development Review Staff) PROJECT NAME: STEWART MINING LOCATION: (Common Description) 2315 Edward Groves Road, Immokalee, FL. SUMMARY OF WAIVER REQUEST: The property is approximately 231.73-acres and has histocially been developed as a citrus grove (see attached 1968 aerial). Per the attached letters from Florida Master Site File, no previously recorded cultural resources are listed for the subject property. Due to the long standing history of citrus production onsite, there are no wetlands or native vegetative communities to be impacted by the conditional use of the site for sand mining excavation. (Properties located within an area of Historical and Archaeological Probability but with a low potential for historical/archaeological sites may petition the Community Development & Environmental Services Administrator County Manager or designee to waive the requirement for a Historical/Archaeological Survey and Assessment. Once the waiver application has been submitted, it shall be reviewed and acted upon within five (5) working days. The waiver request shall adequately demonstrate that the area has low potential for historical/archaeological sites.) 9.A.4.e Packet Pg. 1179 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Historic Preservation/Forms/rev. 06/05/08 2 SECTION ONE: APPLICANT AND PROPERTY OWNERSHIP DATA A. Name of applicant: Same As Owner Mailing Address: Phone: E-Mail: B. Name of agent(s) for applicant, if any: Anna Ritenour, Davidson Engineering, Inc. Mailing Address: 4365 Radio Rd, Suite 201, Naples, FL 34104 Phone: 239.434.6060 E-Mail: anna@davidsonengineering.com C. Name of owner(s) of property: Southwestern Properties, LLC and Tippen Bay Properties, LLLP Mailing Address: 2875 Jupiter Park Dr, 1100, Jupiter, FL 33458 Phone: 561.972.4517 E-Mail: Rudd@stewartmaterials.com Note: If names in answers to A and/or B are different than name in C, notarized letter(s) of authorization from property owner (C) must be attached. 9.A.4.e Packet Pg. 1180 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Historic Preservation/Forms/rev. 06/05/08 3 SECTION TWO: SUBJECT PROPERTY DATA (Attach copy of the plat book page (obtainable from Clerk’s Office at the original scale) with subject property clearly marked.) A. Legal description of subject property. Answer only 1 or 2, as applicable. 1. Within platted subdivision, recorded in official Plat Books of Collier County. Subdivision Name: 2. If not in platted subdivision, a complete legal description must be attached which is sufficiently detailed so as to locate said property on County maps or aerial photographs. The legal description must include the Section, Township and Range. If the applicant includes multiple contiguous parcels, the legal description may describe the perimeter boundary of the total area, and need not describe each individual parcel, except where different zoning requests are made on individual parcels. A boundary sketch is also required. Collier County has the right to reject any legal description, which is not sufficiently detailed so as to locate said property, and may require a certified survey or boundary sketch to be submitted. B. Property dimensions: Area: square feet, or 231.7 acres Width along roadway: See attached survey Depth: See attached survey C. Present use of property: Vacant / Undeveloped AG Land D. Present zoning classification: A-MHO-RSLAO 9.A.4.e Packet Pg. 1181 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Historic Preservation/Forms/rev. 06/05/08 4 SECTION THREE: WAIVER CRITERIA Note: This provision is to cover instances in which it is obvious that any archaeological or historic resource that may have existed has been destroyed. Examples would be evidence that a major building has been constructed on the site or that an area has been excavated. A. Waiver Request Justification. 1. Interpretation of Aerial Photograph The attached aerial shows an existing citrus grove. 2. Historical Land Use Description: CITRUS GROVE 3. Land, cover, formation and vegetation description: 221 Citrus Groves (219.5 acres, 94.7%) The majority of the site consists of an actively maintained citrus grove operation. Numerous features such as primitive roads and pump houses are associated with the grove. Vegetative cover within the citrus grove was dominated by planted orange trees (Citrus spp.). Ground cover consisted of a variety of ruderal species such as common ragweed (Ambrosia artemisiifolia), Bermuda grass (Cynodon dactylon), crowfootgrass (Dactyloctenium aegyptium), dogfennel (Eupatorium capillifolium), natalgrass (Melinis repens), wild balsam apple (Momordica charantia), guineagrass (Panicum maximum), and Caesar-weed (Urena lobata). 513 Man-Made Ditches (11.3 acres, 4.9%) A network of ditches were observed throughout the site which appear to be used for water management purposes in association with the citrus grove. Ditches varied in size from approximately 2 to 20 feet in width. Ditches between grove sections were approximately 5-10 feet wide and a perimeter ditch along the western boundary was approximately 15-20 feet wide. Numerous risers and corrugated pipes connected grove ditches onsite but no off-site surface water connectivity was identified during the 20180455.001A-04 | MOU17O68573 Page 2 January 12, 2018 Copyright 2018 Kleinfelder site investigation. Small ditches approximately 2 feet in width were also present in between individual rows which appeared to assist with drainage. These ditches, however, had no indicators of regular hydrology, and as such, were included as part of the citrus grove instead of being mapped out separately. A shrub layer of colonial species was present along ditch banks which included eastern false-willow (Baccharis halimifolia), southern willow (Salix caroliniana), and Brazilian pepper (Schinus terebinthifolius). Ground cover along the ditch banks was dominated by lantana (Lantana camara), guineagrass, primrose willow (Ludwigia peruviana), and Caesar-weed while a dense, 9.A.4.e Packet Pg. 1182 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Historic Preservation/Forms/rev. 06/05/08 5 overgrown layer of primrose willow was observed within the ditch interiors. Little to no standing water was observed in the ditches at the time of the field investigation. 740 Disturbed Land (0.9 acres, 0.4%) A disturbed area of land was located within the northeastern most portion of the expansion area which appeared to be a staging, storage, and parking area for the citrus operation. Vegetation where present consisted of ruderal ground cover species such as beggar-ticks (Bidens pilosa), Bermuda grass, yellow nutsedge (Cyperus esculentus), natalgrass, guineagrass, smutgrass (Sporobolus indicus), and Caesar-weed. 4. Other: ________________________________________________________ B. The County Manager or designee may deny a waiver, grant the waiver, or grant the waiver with conditions. He shall be authorized to require examination of the site by an accredited archaeologist where deemed appropriate. The applicant shall bear the cost of such evaluation by an independent accredited archaeologist. The decision of the County Manager or designee regarding the waiver request shall be provided to the applicant in writing. In the event of a denial of the waiver request, written notice shall be provided stating the reasons for such denial. Any party aggrieved by a decision of the County Manager or designee regarding a waiver request may appeal to the Preservation Board. Any party aggrieved by a decision of the Preservation Board regarding a waiver request may appeal that decision to the Board of County Commissioners. SECTION FOUR: CERTIFICATION A. The applicant shall be responsible for the accuracy and completeness of this application. Any time delays or additional expenses necessitated due to the submittal of inaccurate or incomplete information shall be the responsibility of the applicant. B. All information submitted with the application becomes a part of the public record and shall be a permanent part of the file. C. All attachments and exhibits submitted shall be of a size that will fit or conveniently fold to fit into a legal size (8 ½” x 14”) folder. Signature of Applicant or Agent: Anna Ritenour, AICP 9.A.4.e Packet Pg. 1183 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Historic Preservation/Forms/rev. 06/05/08 6 ===================================================================== -TO BE COMPLETED BY THE COMMUNITY DEVELOPMENT SERVICES DIVISION- SECTION FIVE: NOTICE OF DECISION The County Manager or designee has made the following determination: Approved on: _____________ By:______________________________ Approved with Conditions on: ____________ By: _____________________________ (see attached) Denied on: _______________ By: ______________________________ (see attached) 9.A.4.e Packet Pg. 1184 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 221 514 514 514 514 514 514 514 514 514 514 514 514 514 514 514 514 514 514 514 514 514 514 514514 514 514 514 514 514 514 514 740 221 221 221 221 221221 221 221 221 221 221 221221 221 221 221 514 160 Existing Land Use Map Stewart Materials, LLCImmokalee Sand MineConditional Use Permit ApplicationCollier County, Florida 2 20193253.001A 10/31/2019 NCD AWN 19-1031--SMI Immokalee-CUP-LandUse.mxdwww.kleinfelder.com PROJECT NO. DRAWN: DRAWN BY: CHECKED BY: FILE NAME: FIGUREThe information included on this graphic representation has beencompiled from a variety of sources and is subject to change withoutnotice. Kleinfelder makes no representations or warranties, expressor implied, as to accuracy, completeness, timeliness, or rights to theuse of such information. This document is not intended for use as aland survey product nor is it designed or intended as a constructiondesign document. The use or misuse of the information containedon this graphic representation is at the sole risk of the party using ormisusing the information. Sections 18 & 19, Township 46 South, Range 29 East Legend Conditional Use Permit Boundary (450.7 Ac.±) Existing Land Use Source: Land Use and Land Cover information prepared by Kleinfelder. The Florida Land Use, Cover and Forms Classification System Handbook, January 1999, was utilized to determine the specific land use classifications. 2019 2.0-foot Natural-Color Orthophotos obtained from Collier County Property Appraiser's Office.£ 1 inch = 500 feet 500 0 500250 Feet Document Path: \\mountdora\MOUNTDORA-DATA\GISCAD\Stewart Mining\_2019\20193253.001A_SMI Requested Services CY 2019\02-0000 Immokalee RS\19-1031--SMI Immokalee-CUP-LandUse.mxd; Plotted: 10/31/2019, 4:23:39 PM, NDePriest FLUCFCS CODE LAND USE ACREAGE % 160 Extractive 219.0 48.6 221 Citrus Groves 220.6 48.9 514 Man-Made Ditches 10.2 2.3 740 Disturbed Land 0.9 0.2Total450.7 100.0 FLORIDA LAND USE, COVER AND FORMS CLASSIFICATION SYSTEM, 1999 9.A.4.e Packet Pg. 1185 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 1968 Aerial Image Stewart Materials, LLCImmokalee Sand MineConditional Use Permit ApplicationCollier County, Florida 3 20193253.001A 10/31/2019 NCD AWN 19-1031--SMI Immokalee-CUP-1968Aerial.mxdwww.kleinfelder.com PROJECT NO. DRAWN: DRAWN BY: CHECKED BY: FILE NAME: FIGUREThe information included on this graphic representation has beencompiled from a variety of sources and is subject to change withoutnotice. Kleinfelder makes no representations or warranties, expressor implied, as to accuracy, completeness, timeliness, or rights to theuse of such information. This document is not intended for use as aland survey product nor is it designed or intended as a constructiondesign document. The use or misuse of the information containedon this graphic representation is at the sole risk of the party using ormisusing the information. Sections 18 & 19, Township 46 South, Range 29 East Legend Conditional Use Permit Boundary (450.7 Ac.±) Source: Black & White Aerial Photography obtained from the FDOT, Surveying and Mapping Office, Image Services. Photograph Date: 1968. Source Scale: Unknown. Aerial Photography was rectified by Kleinfelder utilizing 1995 Color IR Photography acquired from Florida Department of Environmental Protection - LABINS. £ 1 inch = 500 feet 500 0 500250 Feet Document Path: \\mountdora\MOUNTDORA-DATA\GISCAD\Stewart Mining\_2019\20193253.001A_SMI Requested Services CY 2019\02-0000 Immokalee RS\19-1031--SMI Immokalee-CUP-1968Aerial.mxd; Plotted: 10/31/2019, 4:01:22 PM, NDePriest 9.A.4.e Packet Pg. 1186 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 500 South Bronough Street • Tallahassee, FL 32399-0250 • www.flheritage.com/preservation/sitefile 850.245.6440 ph | 850.245.6439 fax | SiteFile@dos.state.fl.us This record search is for informational purposes only and does NOT constitute a project review. This search only identifies resources recorded at the Florida Master Site File and does NOT provide project approval from the Division of Historical Resources. Contact the Compliance and Review Section of the Division of Historical Resources at 850-245-6333 for project review information. November 6, 2019 Anna Ritenour Davidson Engineering, Inc. 4365 Radio Road Naples, FL 34104 Phone: 239.434.6060 Email: anna@davidsonengineering.com In response to your inquiry of November 6, 2019 the Florida Master Site File lists no previously recorded cultural or historic resources in the following parcel of Collier County, Florida: Parcel ID: 00065520004 with a 500 foot buffer as shown on the corresponding map. When interpreting the results of this search, please consider the following information: • This search area may contain unrecorded archaeological sites, historical structures or other resources even if previously surveyed for cultural resources. • Federal, state and local laws require formal environmental review for most projects. This search DOES NOT constitute such a review. If your project falls under these laws, you should contact the Compliance and Review Section of the Division of Historical Resources at 850-245-6333. Please do not hesitate to contact us if you have any questions regarding the results of this search. Sincerely, Cody VanderPloeg Archaeological Data Analyst Florida Master Site File Cody.VanderPloeg@dos.myflorida.com 9.A.4.e Packet Pg. 1187 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Esri, HERE, Garmin, © OpenStreetMap contributors, Copyright:©2013 National Geographic Society, i-cubed, Source: Esri,DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS,USDA, USGS, AeroGRID, IGN, and the GIS User Community Cultural Resource Search500 Foot BufferCollier County November 2019 ¯ 0 0.15 0.3 0.45 0.60.075 Miles Legend Parcel00065520004 %2 FloridaStructures Florida Sites HistoricalBridges HistoricalCemeteries National Register ResourceGroups 9.A.4.e Packet Pg. 1188 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.ePacket Pg. 1189Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) Stewart Mining CU – PL20190000808 Attachment “A” – Legal Description December 20, 2019 www.davidsonengineering.com LEGAL DESCRIPTION ATTACHMENT “A” A TRACT OF LAND LOCATED IN THE SOUTHWEST ONE-QUARTER (SW ¼) OF SECTION 18, TOWNSHIP 46 SOUTH, RANGE 29 EAST AND A PART OF THE NORTH ONE-HALF (N ½) OF SECTION 19, TOWNSHIP 46 SOUTH, RANGE 29 EAST, COLLIER COUNTY, FLORIDA, BEING MORE PARTICULARLY DESCRIBED AS FOLLOWS: BEGINNING AT THE SOUTHWEST CORNER OF SAID SECTION 18 RUN N 00°25’14” W FOR A DISTANCE OF 1,331.53 FEET TO THE NORTHWEST CORNER OF THE SOUTHWEST ONE-QUARTER (SW ¼) OF THE SOUTHWEST ONE-QUARTER (SW ¼) OF SAID SECTION 18; THENCE ALONG THE NORTH LINE OF SAID QUARTER-QUARTER LINE N 88°51'13" E 2,481.73 FEET; THENCE LEAVING SAID LINE S 00°55'38" E 2,658.69 FEET; THENCE N 89°04'22" E 84.00 FEET; THENCE S 00°35'34" E 1,352.26 FEET TO AN INTERSECTION WITH THE EAST-WEST QUARTER LINE OF SAID SECTION 19; THENCE ALONG SAID QUARTER LINE S 89°27'14" W 2,589.72 FEET TO THE WEST ONE-QUARTER CORNER OF SAID SECTION 19; THENCE ALONG THE WEST LINE OF SAID SECTION 19 N 00°29'38" W 2,652.80 FEET TO THE POINT OF BEGINNING. THE ABOVE DESCRIBES AN AREA OF APPROXIMATELY 231.73 ACRES FEET OF LAND. AND A TRACT OF LAND LOCATED IN THE SOUTHEAST QUARTER OF SECTION 18, TOWNSHIP 46 SOUTH, RANGE 29 EAST, AND THE NORTHEAST QUARTER OF SECTION 19, TOWNSHIP 46 SOUTH, RANGE 29 EAST, COLLIER COUNTY, FLORIDA, FURTHER DESCRIBED AS FOLLOWS, TO WIT: BEGINNING AT THE NORTHEAST CORNER OF SECTION 19, TOWNSHIP 46 SOUTH, RANGE 29 EAST, THENCE SOUTH 00°11'07" WEST (BASIS OF BEARING IS ASSUMED) ALONG THE EAST LINE OF SAID SECTION A DISTANCE OF 2692.02 FEET TO A CONCRETE MONUMENT BEING THE EAST QUARTER CORNER OF SECTION 19; THENCE NORTH 89 DEGREES 43'00" WEST ALONG THE SOUTH LINE OF THE NORTHEAST QUARTER A DISTANCE OF 2340.90 FEET; THENCE NORTH 00 DEGREES 12'54" WEST, A DISTANCE OF 1353.32 FEET; THENCE SOUTH 89 DEGREES 52'57" WEST, A DISTANCE OF 84.00 FEET; THENCE NORTH 00 DEGREES 07'03" WEST, A DISTANCE OF 2658.62 FEET TO A POINT ON THE EAST/WEST QUARTER LINE OF THE SOUTHEAST QUARTER OF SECTION 18, TOWNSHIP 46 SOUTH, RANGE 29 EAST; THENCE NORTH 89 DEGREES 39'50" EAST, ALONG SAID QUARTER, QUARTER LINE A DISTANCE OF 2448.79 FEET TO A CONCRETE MONUMENT BEING THE EAST QUARTER QUARTER OF SAID SOUTHEAST 1/4; THENCE SOUTH 00 DEGREES 12'15" WEST, ALONG THE EAST LINE OF SECTION 18, A DISTANCE OF 1345.64 FEET TO THE POINT OF BEGINNING. LESS AND EXCEPT FROM SAID TRACT, THE EAST 30 FEET THEREOF. THE ABOVE DESCRIBES AN AREA OF APPROXIMATELY 9,538,320 SQUARE FEET OR 218.97 ACRES OF LAND 9.A.4.e Packet Pg. 1190 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) RESOLUTION NO A RESOLUTION PROVIDINGFOR THE ESTABLISHMENT OF CONDITIONAL USE I FOR EARTHMINING IN THE A MHO RURAL AGRICULTURAL ZONING DISTRICT WITH MOBILE HOME OVERLAY PURSUANT TO SECTION OF THE COLLIER COUNTY LAND DEVELOPMENT CODE FOR PROPERTY LOCATED IN SECTIONS AND TOWNSHIP SOUTH RANGE EAST COLLIER COUNTY FLORIDA WHEREAS the Legislature of the State of Florida in Chapter Laws of Florida and Chapter Florida Statutes has conferred on Collier County the power to establish coordinate and enforce zoning and such business regulations as are necessary for the protection of the public and WHEREAS the County pursuant thereto has adopted a Land Development Code Ordinance No which includes a Comprehensive Zoning Ordinance establishing regulations for the zoning ofparticular geographic divisions of the County among which isthe granting of Conditional Uses and WHEREAS the Collier County Planning Commission being the duly appointed and constituted planning board for the area hereby affected has held a public hearing after notice as in said regulations made and provided andhas considered the advisability of Conditional Use of Section of the Collier County Land Development Code for earthmining inan A MHO Rural Agricultural Zoning District with Mobile Home Overlay on the property hereinafter described and has found as amatter of fact Exhibit A that satisfactory provision and arrangement have been made concerning all applicable matters required by said regulations and inaccordance with Subsection of the Land Development Code tor the Collier County Planning Commission and WHEREAS all interested parties have been given opportunity to be heard bythis Board in a public meeting assembled and the Board having considered all matters presented NOW THEREFORE BE IT RESOLVED BY THE BOARD OF ZONING APPEALS OF COLLIER COUNTY FLORIDA that The petition filed by Jeff Davidson P E of Davidson Engineering Inc representing Stewart Mining Industries Inc with respect to the property hereinafter described as Exhibit B which is attached hereto and incorporated by reference herein 9.A.4.e Packet Pg. 1191 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) ti be and the same is hereby approved for Conditional Use I ot Section of the Collier County Land Development Code in an A MHO Rural Agricultural Zoning District with Mobile Home Overlay for earthmining inaccordance with the Conceptual Master Plan Exhibit Cand subject to the following conditions Exhibit D which is attached hereto and incorporated by reference herein BEIT FURTHER RESOLVED that this Resolution berecorded in the minutes of this Board This Resolution adopted after motion second and super majority vote Done this Zn lday ofBOAR OF NING COLLIE UNTY BY TOM HENNING CHAIRM ATTEST jDWlyHT E BROCK CLERK Atti IS ChlfrIIIJI S sfan lyre ll Approveo asJo Form andLegalSufficiencyb I A tL rnMal orMStudent Assistant County Attorney CU AR FRIsp 9.A.4.e Packet Pg. 1192 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) i ru FINDINGS OF FACT BY COLLIER COUNTY PLANNING COMMISSION FOR A CONDITIONAL USE PETITION FOR CU AR The following facts are found Subsection of the Land Development Code authorizes the conditional use Granting the conditional use will not adversely affect the public interest and will notadversely affect other property or uses in the same districtorneighborhoodbecauseofAConsistencywiththeLandDevelopmentCodeandGrowthManagement Plan Yes f No B Ingress and egress toproperty and proposed structures thereon with particular reference toautomotive and pedestrian safety and convenience traffic flowandcontrolandaccessincaseoffireorcatastropheAdequateingressegressXYesNoCAffectsneighboringproperties inrelation to noiseglare economic or odor effects No affect or Affect mitigated by Affect cannot bemitigated D Compatibility with adjacent properties and other property in the district Compatible use within district Yes V No Based on the above findings this conditional use should with stipulations copy attached should not be recommended for approval DATE y CHArRMAN iCjCTEXHIBITAr 9.A.4.e Packet Pg. 1193 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) CU AR DESCRIPTION as provided by client A tract of land located In the Southeast quarter of Section Township South Range and the Northeast quarter Section Township South Range East Collier County FI further described os follows to wit Beginning at the Northeast corner of Section Township South Range East thence S degrees West Basis for bearing assumed along the East line of said Section a dlstc of feet to a concrete monument being the East quarter comer of SectIon thence degrees West along the South line of the Northeast quarter a distance of fthence North degrees West a distance of feet thence South degrees West a distance of feet thence North degrees West a distance of f to apoint on the East West quarter quarter line of th e outheast quarter of Section Towr South Range East thence North degrees East along sold quarter quarter IIn distance of feet to a concrete monument being the East quarter quarter corner of so Southeast thence South degrees West olong the East line of SectIon a dlst of feet to the Point of Beginning LESS AND EXCEPT from sold tract the East feet thereof EXHIBIT B 9.A.4.e Packet Pg. 1194 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) l zfrCAeltiii URAL ZlNNG h lllllllllllillllIIIIraIIIPIIIIPIIIIIII I I II IINI II I I I I rF I I I IIIIIIIIIIIigs I I i l i U C IIfli Jol I I I eo I JI IaHi I I II IilIJhlnjiiif lil e ItikStmIiliiiirJrjIliffIm J IIiifj JiIrJlrfJfIrbiHd tg nJi r i ro alJ f t fr II IrUJ gisCIaJ o Oni t iItirfiITj l ftIJ a iiz iii p JtiJJf g I r i I l l J r J lII i Ill t F IntI J I il r i I j l l II I F j ft j t I if i i fl I rt I il i t I I i jt I t i Q f rf r J t CI f I i l r t i i el iIS f i Iiiiiiilu 9.A.4.ePacket Pg. 1195Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road i CU AR CONDITIONS The Petitioner shall obtain a South Florida Water Management District Agricultural Surface Water Management Permit or permit modification for this site if applicable The site shall be cleared of all exotic vegetation and maintained exotic free in perpetuity The petitioner shall pave the access road from State Road to the subject property line prior to commencement of earthmining operations The pavement shall bea minimum of feet in width and a depth of inches of asphalt or asphalt millings The petitioner shall be responsible for maintenance of the access road for the duration of the operation Turn lanes on SR westbound left in eastbound right in shall be provided prior to commencement of earthrnining operations Excavation activities are permitted from AM until PM Monday through Saturday The excavation shall becontained by a berm constructed to the height of the year flood elevation Unless the berm contains adequate clay content to slow the flow of water as determined by the Collicr County Engineering Services Department the berm shall contain a membrane impervious to water A landscaped berm feet in height shall be constructed adjacent to parcels zoned residential within months of the adjacent parcel being rezoned The easternmost feet of the parcel shall be reserved for right of way and shall bedeeded to Collier County at no cost to Collier County within days of receipt of notification by the Collier County Transportation Services Department that the property is needed for the purpose of providing a right of way connection from Westclox Road to State Road EXHIBIT D 9.A.4.e Packet Pg. 1196 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1197 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1198 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1199 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1200 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1201 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1202 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1203 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1204 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1205 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1206 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1207 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1208 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1209 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1210 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1211 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1212 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1213 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.e Packet Pg. 1214 Attachment: Attachment D - Application-Backup Materials (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 9.A.4.fPacket Pg. 1215Attachment: Attachment E - Hybrid Waiver - Southwestern Properties LLC (13089 : PL20190000808 Edwards Grove Road Mine (CU)) As Vice President of J.R. Paul Properties, Inc., General Partner of Tippen Bay Properties, LLLP9.A.4.gPacket Pg. 1216Attachment: Attachment F - Hybrid Waiver - Tippen Bay (13089 : PL20190000808 Edwards Grove Road Mine (CU)) 11/19/2020 COLLIER COUNTY Collier County Planning Commission Item Number: 9.A.5 Item Summary: **Note: This item was continued from the November 5, 2020 CCPC meeting.*** PL20200000564 PUDA - An Ordinance of the Board of County Commissioners of Collier County, Florida amending Ordinance Number 05-46, the Bembridge Emergency Services Complex Community Facility Planned Unit Development (CFPUD) and Residential Planned Unit Development (RPUD), to redesignate 5.11± acres of land from Tract A to Tract A-1; to increase the residential density from 6 to 16 units/acre for a maximum of 82 residential units on Tract A-1, using the affordable housing density bonus and to amend the master plan; and providing an effective date. The subject property consists of 39.82± acres and is located east of Santa Barbara Boulevard, north of Davis Boulevard (SR 84) in Section 4, Township 50 South, Range 26 East, Collier County, Florida. [Coordinator: Timothy Finn, AICP, Principal Planner] Meeting Date: 11/19/2020 Prepared by: Title: – Zoning Name: Tim Finn 10/22/2020 4:28 PM Submitted by: Title: Manager - Planning – Zoning Name: Ray Bellows 10/22/2020 4:28 PM Approved By: Review: Planning Commission Diane Lynch Review item Completed 10/23/2020 12:24 PM Zoning Ray Bellows Review Item Completed 10/23/2020 4:50 PM Growth Management Operations & Regulatory Management Donna Guitard Review Item Completed 11/04/2020 1:01 PM Growth Management Department James C French Review Item Completed 11/05/2020 12:19 PM Zoning Ray Bellows Review Item Completed 11/05/2020 12:47 PM Planning Commission Edwin Fryer Meeting Pending 11/19/2020 9:00 AM 9.A.5 Packet Pg. 1217 PUDA-PL20200000564; Bembridge Emergency Services Complex Page 1 of 16 Revised: November 9, 2020 STAFF REPORT TO: COLLIER COUNTY PLANNING COMMISSION FROM: ZONING DIVISION – ZONING SERVICES SECTION GROWTH MANAGEMENT DEPARTMENT HEARING DATE: NOVEMBER 19, 2020 SUBJECT: PUDA-PL20200000564 BEMBRIDGE EMERGENCY SERVICES COMPLEX ______________________________________________________________________________ Owner/Applicant: Contract Purchaser: Agent: Collier County, a Political McDowell Housing Jessica Harrelson, AICP Subdivision of the State of Florida 3335 Tamiami Trail E Naples, FL 34112 Partners, LLC 601 Brickell Key Dr. Suite 700 Miami. FL 33131 Davidson Engineering, Inc. 4365 Radio Rd. Suite 201 Naples, FL 34104 REQUESTED ACTION: The petitioner is requesting that the Collier County Planning Commission (CCPC) consider an application to amend Ordinance Number 05-46, as amended, the Bembridge Emergency Services Complex Community Facility Planned Unit Development (PUD). GEOGRAPHIC LOCATION: The subject property consists of 39.82± acres and is located east of Santa Barbara Boulevard, north of Davis Boulevard (SR 84) in Section 4, Township 50 South, Range 26 East, Collier County, Florida. (see location map, page 2). PURPOSE/DESCRIPTION OF PROJECT: The petitioner seeks to amend the Bembridge Emergency Services Complex Community Facility Planned Unit Development (CFPUD) and Residential Planned Unit Development (RPUD), to redesignate 5.11± acres of land from Tract A to Tract A-1; to increase the residential density from 6 to 16 units/acre for a maximum of 82 residential units on Tract A-1, using the affordable housing density bonus and to amend the master plan. 9.A.5.a Packet Pg. 1218 Attachment: Staff Report - Bembridge PUDA (13384 : PL20200000564 Bembridge PUDA) PUDA-PL20200000564; Bembridge Emergency Services Complex Page 2 of 16 Revised: November 9, 2020 9.A.5.aPacket Pg. 1219Attachment: Staff Report - Bembridge PUDA (13384 : PL20200000564 Bembridge PUDA) PUDA-PL20200000564; Bembridge Emergency Services Complex Page 3 of 16 Revised: November 9, 2020 SURROUNDING LAND USE AND ZONING: This section of the staff report identifies the land uses and zoning classifications for properties surrounding boundaries of Tract A-1 of the Bembridge Emergency Services Complex Community Facility CFPUD and RPUD: North: Undeveloped land with a current zoning designation of Santa Barbara Landings RPUD (7.0 DU/AC) that is approved for single family attached, duplex and multiple family dwellings South: Plans to develop a master county pump station, with a current zoning designation of Bembridge Emergency Services Complex Community Facility CFPUD and RPUD (6.0 DU/AC) that is approved for multi-family residential, emergency medical services, and educational plants then to the south is mostly undeveloped land with a gas station at the corner of Santa Barbara Blvd and Davis Blvd with a current zoning designation of Shoppes at Santa Barbara PUD and is approved for commercial uses East: Developed with a water management area then to the east developed with Calusa Park Elementary School with a current zoning designation of Bembridge Emergency Services Complex Community Facility CFPUD and RPUD (6.0 DU/AC) that is approved for multi-family residential, emergency medical services, and educational plants then to the east is developed with multifamily residential with a current zoning designation of Wildwood Estates (12.4 DU/AC) that is approved for residential and commercial uses West: Santa Barbara Boulevard, a six-lane arterial roadway, and then developed with a golf course and multi-family with a current zoning designation of Berkshire Lakes PUD (3.8 DU/AC) and is approved for commercial, golf course, single and multi- family, and open space/conservation Intentionally blank 9.A.5.a Packet Pg. 1220 Attachment: Staff Report - Bembridge PUDA (13384 : PL20200000564 Bembridge PUDA) PUDA-PL20200000564; Bembridge Emergency Services Complex Page 4 of 16 Revised: November 9, 2020 Source: Davidson Engineering GROWTH MANAGEMENT PLAN (GMP) CONSISTENCY: The GMP is the prevailing document to support land-use decisions, such as this proposed amendment. Staff is required to make a recommendation regarding a finding of consistency or inconsistency with the overall GMP as part of the recommendation for approval, approval with conditions, or denial of any amendment petition. This petition is consistent with the GMP. Future Land Use Element (FLUE): The subject site is designated Urban, Urban Mixed Use District, Urban Residential Fringe Subdistrict. The purpose of this Subdistrict is to provide transitional densities between the Urban Designated Area and the Agricultural/Rural Area. Urban designated areas allow for both residential and non-residential uses. Non-residential uses lists 9.A.5.a Packet Pg. 1221 Attachment: Staff Report - Bembridge PUDA (13384 : PL20200000564 Bembridge PUDA) PUDA-PL20200000564; Bembridge Emergency Services Complex Page 5 of 16 Revised: November 9, 2020 “Essential services as defined by the most recent Land Development Code” as an allowed use. This petition is consistent with the GMP. Transportation Element: In evaluating this project, staff reviewed the applicant’s July 8, 2020 (revised) Traffic Impact Statement for consistency with Policy 5.1 of the Transportation Element of the Growth Management Plan (GMP) using the applicable 2019 Annual Update and Inventory Reports (AUIR). Policy 5.1 of the Transportation Element of the GMP states; “The County Commission shall review all rezone petitions, SRA designation applications, conditional use petitions, and proposed amendments to the Future Land Use Element (FLUE) affecting the overall countywide density or intensity of permissible development, with consideration of their impact on the overall County transportation system, and shall not approve any petition or application that would directly access a deficient roadway segment as identified in the current AUIR or if it impacts an adjacent roadway segment that is deficient as identified in the current AUIR, or which significantly impacts a roadway segment or adjacent roadway segment that is currently operating and/or is projected to operate below an adopted Level of Service Standard within the five year AUIR planning period, unless specific mitigating stipulations are also approved. A petition or application has significant impacts if the traffic impact statement reveals that any of the following occur: a. For links (roadway segments) directly accessed by the project where project traffic is equal to or exceeds 2% of the adopted LOS standard service volume; b. For links adjacent to links directly accessed by the project where project traffic is equal to or exceeds 2% of the adopted LOS standard service volume; and c. For all other links the project traffic is considered to be significant up to the point where it is equal to or exceeds 3% of the adopted LOS standard service volume. Mitigating stipulations shall be based upon a mitigation plan prepared by the applicant and submitted as part of the traffic impact statement that addresses the project’s significant impacts on all roadways.” Staff finding: According to the TIS provided with this petition the proposed 82 multi-family dwelling unit development will generate a projected total of +/- 50 PM peak hour, 2-way trips on the adjacent roadway segments of Santa Barbara Boulevard. The trips generated by this development will occur on the following adjacent roadway link: Link/Roadway Link 2019 AUIR LOS Current Peak Hour Peak Direction Volume/Peak Direction 2019 Remaining Capacity 76.0/Santa Barbara Boulevard Green Boulevard to Golden Gate Parkway D 2,100/North 480 9.A.5.a Packet Pg. 1222 Attachment: Staff Report - Bembridge PUDA (13384 : PL20200000564 Bembridge PUDA) PUDA-PL20200000564; Bembridge Emergency Services Complex Page 6 of 16 Revised: November 9, 2020 77.0/Santa Barbara Boulevard Golden Gate Parkway to Radio Road C 3,100/North 1,086 78.0/Santa Barbara Boulevard Radio Road to Davis Boulevard C 3,100/ North 1,439 79.0/Santa Barbara Boulevard Davis Boulevard to Rattlesnake Hammock Road B 3,100/South 1,900 15.0/Davis Boulevard County Barn Road to Santa Barbara Boulevard C 2,200/East 606 70.0/Radio Road Livingston to Santa Barbara Boulevard C 1,800/East 653 71.0/Radio Road Santa Barbara Boulevard to Davis Boulevard B 1,800/West 951 Based on the TIS and the 2019 AUIR, the subject PUD Amendment can be found consistent with Policy 5.1 of the Transportation Element of the Growth Management Plan, the Traffic Impact Statement (TIS) indicates that the adjacent roadway network has sufficient capacity to accommodate this project within the 5-year planning period. Conservation and Coastal Management Element (CCME): Environmental review staff has found this project to be consistent with the Conservation & Coastal Management Element (CCME). The project site consists of 0.82 acres of native vegetation. A minimum of 0.12 (15%) acres of native vegetation will be preserved to meet the preservation requirement. STAFF ANALYSIS: Staff has completed a comprehensive evaluation of this land use petition, including the criteria upon which a recommendation must be based, specifically noted in LDC Section 10.02.13.B.5, Planning Commission Recommendation (commonly referred to as the “PUD Findings”), and Section 10.02.08.F, Nature of Requirements of Planning Commission Report (referred to as “Rezone Findings”), which establish the legal basis to support the CCPC’s recommendation. An evaluation relative to these subsections is discussed below, under the heading “Zoning Services Analysis.” Drainage: The proposed PUD Amendment request is not anticipated to create drainage problems in the area. Stormwater best management practices, treatment, and storage will be addressed through the environmental resource permitting process with the South Florida Water Management District. County staff will also evaluate the project’s stormwater management system, calculations, and design criteria at the time of site development plan (SDP) and/or platting (PPL). 9.A.5.a Packet Pg. 1223 Attachment: Staff Report - Bembridge PUDA (13384 : PL20200000564 Bembridge PUDA) PUDA-PL20200000564; Bembridge Emergency Services Complex Page 7 of 16 Revised: November 9, 2020 Environmental Review: Environmental Planning staff has reviewed the petition to address environmental concerns. The Master Plan illustrates the minimum PUD preserve requirement; the required preserve is 0.12 acres (15% of 0.82 acres). The applicant has proposed to meet the preserve requirement in accordance with LDC 3.07.05. The size of the required preserve gives the petitioner the option to meet the preservation requirement offsite in accordance with LDC Section 3.07.05 H.1.f. No listed animal or plant species were observed on the property. Landscape Review: The applicant is seeking 3 deviations regarding landscape buffers. See Deviation Discussion below. Affordable Housing Review: Staff has reviewed the petition and accompanying Affordable Housing Density Bonus Agreement. The application seeks a density bonus of 12 units per acre in exchange for providing 100% of the residential units (82 units) as rental housing affordable to households earning less than 80% of the Area Median Income. Of the 82 units proposed, 13 will be restricted to tenants earning less than 50% AMI, 50 will be restricted to tenants earning between 51% AMI to 60% AMI, and the remaining 19 units will be restricted to tenants earning between 61% AMI to 80% AMI. Number Income Percent of Corresponding Affordable of Units Level Development Housing Density Bonus 13 50% 16% 7.6 u/a bonus 50+19 60-80% 84% 12.4 u/a bonus 82 100% 20.0 u/a bonus (capped at 12 u/a bonus max) Base density of 4 u/a + bonus density of 12 u/a = 16 u/a X 5.11 acres = 82 units The proposal meets the requirements of the Affordable Housing Density Bonus provisions on the LDC. Community and Human Services Division recommends approval of this project and the associated Affordable Housing Density Bonus Agreement. (See Attachment B) Transportation Review: Transportation Planning staff has reviewed the petition for compliance with the GMP and the LDC and recommends approval. Utilities Review: The project lies within the regional potable water and south wastewater service areas of the Collier County Water-Sewer District. Water and wastewater services are readily available via existing infrastructure along the project’s frontage on Santa Barbara Boulevard. Sufficient water and wastewater treatment capacities are available Zoning Services Review: The Bembridge Emergency Services Complex Community Facilities Planned Unit Development (CFPUD) and Residential Planned Unit Development (RPUD) totals ±39.82 acres and is located on the east side of Santa Barbara, south of Radio Road and north of Davis Boulevard. The intent of the Planned Unit Development Amendment (PUDA) is to request an increase in residential density from 6 units per acre to 16 units per acre, using the Affordable 9.A.5.a Packet Pg. 1224 Attachment: Staff Report - Bembridge PUDA (13384 : PL20200000564 Bembridge PUDA) PUDA-PL20200000564; Bembridge Emergency Services Complex Page 8 of 16 Revised: November 9, 2020 Housing Density Bonus, for a maximum of 82 residential units within the Bembridge Emergency Services Complex CFPUD/RPUD. The subject County-owned parcel (folio #00400246406) is ±5.1-acres, now designated as Tract “A-1” on the updated PUD Master Plan. Of the parcel’s total site area, 3.77-acres is allocated for the proposed Affordable Housing Development (Tract ‘A-1 Residential’) and the remaining 1.33-acres is allocated for the development of a future Master County Pump Station (Tract ‘A-1 Master County Pump Station’). Density is calculated utilizing the site’s total area of 5.1-acres (16 DU/A x 5.1 = 82 units). Via a public-private partnership, the future apartments (to be known as The Harmony on Santa Barbara) will be developed by McDowell Housing Partners, while the County maintains ownership of the 5.1-acre parcel. The apartment community will serve Collier County residents earning between 30 and 80 percent of the County’s area median income (AMI). The Developer agrees to target and market at least 10% of units for seniors, veterans, or special needs populations. The community will provide one, two- and three-bedroom apartments along with accessory recreational facilities. The request complies the County’s Growth Management Policies that encourage the development of affordable housing such as, “The goal of the Housing Element of the Collier County Growth Management Plan is ‘to create an adequate supply of decent, safe, sanitary, and affordable housing for all residents of Collier County’. The development of private housing in Collier County is driven by an expensive housing stock; leaving a shortage of housing for low-income and working-class families. Thus, there is a need for the County to find way to encourage the provision of affordable-workforce housing for these families. LDC Section 10.02.13.B.5 states that “In support of its recommendation, the CCPC shall make findings as to the PUD Master Plan’s compliance with the following criteria in addition to the findings in LDC Section 10.02.08”: 1. The suitability of the area for the type and pattern of developmen t proposed in relation to physical characteristics of the land, surrounding areas, traffic and access, drainage, sewer, water, and other utilities. Water transmission and wastewater transmission mains are readily available within the Santa Barbara Boulevard right-of-way, and there is adequate water and wastewater treatment capacity to serve the proposed PUD. Moreover, Staff has reviewed the proposed amendment and is of the opinion the uses and property development regulations are compatible with the development approved in the area in regard to traffic and drainage. 2. Adequacy of evidence of unified control and suitability of any proposed agreements, contracts, or other instruments, or for amendments in those proposed, particularly as they may relate to arrangements or provisions to be made for the continuing operation and maintenance of such areas and facilities that are not to be provided or maintained at public expense. Documents submitted with the application, which were reviewed by the County Attorney’s Office, demonstrate unified control of the property. 3. Conformity of the proposed Planned Unit Development with the goals, objectives, and 9.A.5.a Packet Pg. 1225 Attachment: Staff Report - Bembridge PUDA (13384 : PL20200000564 Bembridge PUDA) PUDA-PL20200000564; Bembridge Emergency Services Complex Page 9 of 16 Revised: November 9, 2020 policies of the Growth Management Plan (GMP). County staff has reviewed this petition and has offered an analysis of conformity with the relevant goals, objectives, and policies of the GMP within the GMP Consistency portion of this staff report on page 4. 4. The internal and external compatibility of proposed uses, which conditions may include restrictions on location of improvements, restrictions on design, and buffering and screening requirements. As described in the Staff Analysis section of this staff report, the proposed changes to the PUD do not affect the landscaping standards of the original PUD. 5. The adequacy of usable open space areas in existence and as proposed to serve the development. No deviation from the required usable open space is being requested, and compliance would be demonstrated at the time of SDP or PPL. 6. The timing or sequence of development for the purpose of ensuring the adequacy of available improvements and facilities, both public and private. The roadway infrastructure is sufficient to serve the proposed project, as noted in the Transportation Element consistency review. Operational impacts will be addressed at time of first development order (SDP or Plat), at which time a new TIS will be required to demonstrate turning movements for all site access points. Finally, the project’s development must comply with all other applicable concurrency management regulations when development approvals, including but not limited to any plats and or site development plans, are sought. Moreover, Collier County has sufficient treatment capacity for water and wastewater services to the project. Conveyance capacity must be confirmed at the time of development permit application. 7. The ability of the subject property and of surrounding areas to accommodate expansion. The area has adequate supporting infrastructure, including adjacent Collier County Water- Sewer District potable water and wastewater mains, to accommodate this project. 8. Conformity with PUD regulations, or as to desirable modifications of such regulations in the particular case, based on determination that such modifications are justified as meeting public purposes to a degree at least equivalent to literal application of such regulations. Five new deviations is proposed in connection with this request to amend the PUD. See deviations section beginning on page 12. Rezone Findings: 9.A.5.a Packet Pg. 1226 Attachment: Staff Report - Bembridge PUDA (13384 : PL20200000564 Bembridge PUDA) PUDA-PL20200000564; Bembridge Emergency Services Complex Page 10 of 16 Revised: November 9, 2020 LDC Subsection 10.02.08.F states, “When pertaining to the rezoning of land, the report and recommendations to the planning commission to the Board of County Commissioners…shall show that the planning commission has studied and considered proposed change in relation to the following when applicable”: 1. Whether the proposed change will be consistent with the goals, objectives, and policies of the Future Land Use Map and the elements of the GMP. Comprehensive Planning staff determined the subject petition is consistent with the goals, objectives, and policies of the (FLUM) and other elements of the GMP. 2. The existing land use pattern. The existing land use pattern (of the abutting properties) is described in the Surrounding Land Use and Zoning section of this staff report. The proposed use would not change the existing land use patterns of the surrounding properties. 3. The possible creation of an isolated district unrelated to adjacent and nearby districts. The property is currently zoned PUD and would remain as such. 4. Whether existing district boundaries are illogically drawn in relation to existing conditions on the property proposed for change. This petition does not propose any change to the boundaries of the PUD. 5. Whether changed or changing conditions make the passage of the proposed rezoning necessary. The proposed change is not necessary; however, it is being requested in compliance with the LDC provisions to seek such changes because the petitioner wishes to include the proposed uses and development standards that are specific to the subject parcel. 6. Whether the proposed change will adversely influence living conditions in the neighborhood. The proposed PUD Amendment is not anticipated to adversely influence living conditions in the neighborhood. 7. Whether the proposed change will create or excessively increase traffic congestion or create types of traffic deemed incompatible with surrounding land uses, because of peak volumes or projected types of vehicular traffic, including activity during construction phases of the development, or otherwise affect public safety. The roadway infrastructure has adequate capacity to serve the proposed project at this time, i.e., GMP consistent at the time of rezoning as evaluated as part of the GMP Transportation Element consistency review. Operational impacts will be addressed at t ime of first development order (SDP or Plat). Additionally, the project’s development must comply 9.A.5.a Packet Pg. 1227 Attachment: Staff Report - Bembridge PUDA (13384 : PL20200000564 Bembridge PUDA) PUDA-PL20200000564; Bembridge Emergency Services Complex Page 11 of 16 Revised: November 9, 2020 with all other applicable concurrency management regulations when development approvals are sought. 8. Whether the proposed change will create a drainage problem. The proposed PUD Amendment request is not anticipated to create adverse drainage impacts in the area; provided stormwater best management practices, treatment, and storage on this project are addressed through Environmental Resource Permitting (ERP) with the South Florida Water Management District (SFWMD). County staff will evaluate the project’s stormwater management system, calculations, and design criteria at the time of SDP and/or PPL. 9. Whether the proposed change will seriously reduce light and air to adjacent areas. It is not anticipated the changes proposed to this PUD Amendment would seriously reduce light or air to the adjacent areas. 10. Whether the proposed change will adversely affect property values in the adjacent areas. This is a subjective determination based upon anticipated results, which may be internal or external to the subject property. Property valuation is affected by a host of factors including zoning; however, zoning by itself may or may not affect values, since value determination is driven by market value. 11. Whether the proposed change will be a deterrent to the improvement or development of adjacent property in accordance with existing regulations. The increase of residential density from 6 to 16 units/acre for a maximum of 82 residential units on Tract A-1, using the affordable housing density bonus is not anticipated to serve as a deterrent to the improvement of adjacent property. 12. Whether the proposed change will constitute a grant of special privilege to an individual owner as contrasting with the public welfare. If the proposed development complies with the GMP through the proposed amendment, then that constitutes a public policy statement supporting zoning actions when they are consistent with said Comprehensive Plan. In light of this fact, the proposed change does not constitute a grant of special privilege. Consistency with the FLUE is further determined to be a public welfare relationship because actions consistent with plans are in the public interest. 13. Whether there are substantial reasons why the property cannot be used in accordance with existing zoning. 9.A.5.a Packet Pg. 1228 Attachment: Staff Report - Bembridge PUDA (13384 : PL20200000564 Bembridge PUDA) PUDA-PL20200000564; Bembridge Emergency Services Complex Page 12 of 16 Revised: November 9, 2020 The subject property can be used in accordance with existing zoning; however, the proposed uses cannot be achieved without amending the PUD. 14. Whether the change suggested is out of scale with the needs of the neighborhood or the County. It is staff’s opinion that the proposed uses, associated development standards, and developer commitments will ensure that the project is not out of scale with the needs of the community. 15. Whether is it impossible to find other adequate sites in the County for the proposed use in districts already permitting such use. The petition was reviewed for compliance with the GMP and the LDC, and staff does not specifically review other sites in conjunction with a specific petition. 16. The physical characteristics of the property and the degree of site alteration, which would be required to make the property usable for any of the range of potential uses under the proposed zoning classification. Any development anticipated by the PUD Document would require considerable site alteration, and this project will undergo extensive evaluation relative to all federal, state, and local development regulations during the SDP and/or platting processes, and again later as part of the building permit process. 17. The impact of development on the availability of adequate public facilities and services consistent with the levels of service adopted in the Collier County Growth Management Plan and as defined and implemented through the Collier County Adequate Public Facilities Ordinance, as amended. The activity proposed by this amendment will have no adverse impact on public utilities facility adequacy. 18. Such other factors, standards, or criteria that the Board of County Commissioners shall deem important in the protection of the public health, safety, and welfare. To be determined by the Board during its advertised public hearing. DEVIATION DISCUSSION: The PUD was approved via Ordinance 05-46 with one deviation. The petitioner is now seeking to add five deviations. The deviations are directly extracted from PUD Section 4.12. The petitioner’s justification and staff analysis/recommendation for this deviation are listed below. Deviation #1: (Signs) 9.A.5.a Packet Pg. 1229 Attachment: Staff Report - Bembridge PUDA (13384 : PL20200000564 Bembridge PUDA) PUDA-PL20200000564; Bembridge Emergency Services Complex Page 13 of 16 Revised: November 9, 2020 “Deviation #1 Subsection 5.06.00 of the LDC Signs - Deviation from Subsection 5.06.06.C.1 of the LDC, which limits the number of signs to one ground sign or one pole sign. Calusa Park Elementary School shall be permitted two entry signs with one being a marquee sign. Staff Recommendation: No modifications proposed, was previously approved by Ordinance 05- 46. Deviation #2: (Buffer Requirements) “Deviation #2 seeks relief from LDC section 4.06.02 C.4., “Type D Landscape Buffer,” which requires a 20-foot Type “D” landscape buffer along rights-of-way for developments of 15 acres or more, to instead allow a 15-foot wide Type “D” buffer on Tracts “A” and “A-1-Residential” along Santa Barbara Boulevard.” Petitioners Justification: The existing EMS Station site, located on Tract A of the PUD, has an existing 15’ Type D buffer to remain. This deviation request will solidify the existing 15’ Type D buffer on the EMS Station’s site and allow Tract A-1 to provide the same buffer for consistency. In addition, the existing water management lake and required lake maintenance easement, located on Tract B, creates development restraints on Tract A-1 and a 20’ Type ‘D’ buffer requirement would further reduce developable area and restrict on-site circulation needed for emergency services. The request for a reduction in width does not result in any negative impacts to the surrounding area. All required plant material will still be installed within the proposed 15’ Type ‘D’ Landscape Buffer. Staff Analysis and Recommendation: Staff recommends APPROVAL, finding that, in compliance with LDC section 10.02.13.A.3., the petitioner has demonstrated that “the element may be waived without detrimental effect on the health, safety and welfare of the community” and LDC section 10.02.13.B.5.h the petitioner as demonstrated that the deviation is “justified as meeting public purposes to a degree at least equivalent to literal application of such regulations.” Deviation #3: (Buffer Requirements) “Deviation #3 seeks relief from LDC Section 4.06.02 C.2., “Type B Landscape Buffer,” which requires a 15’ Type ‘B’ buffer between multi-family residential and a community facility, to instead allow a 7’ Type ‘B’ buffer along the eastern property line of Tract “A-1-Residential.” Petitioners Justification: The existing water management lake and required lake maintenance easements, located within Tract B, creates development restraints for Tract “A-1 Residential”; therefore, a reduction in the required buffer width is being requested. In addition, the reduction in width of the landscape buffer will allow the site to be to be designed/constructed to accommodate emergency service vehicles to easily circulate the site. A 7’ Type B buffer provides sufficient width for plant materials to be installed and does not create a negative impact to the surrounding area. Staff Analysis and Recommendation: Staff recommends APPROVAL, finding that, in compliance with LDC section 10.02.13.A.3., the petitioner has demonstrated that “the element 9.A.5.a Packet Pg. 1230 Attachment: Staff Report - Bembridge PUDA (13384 : PL20200000564 Bembridge PUDA) PUDA-PL20200000564; Bembridge Emergency Services Complex Page 14 of 16 Revised: November 9, 2020 may be waived without detrimental effect on the health, safety and welfare of the community” and LDC section 10.02.13.B.5.h the petitioner as demonstrated that the deviation is “justified as meeting public purposes to a degree at least equivalent to literal application of such regulations.” Deviation #4: (Parking Space Requirements) “Deviation #4 seeks relief from LDC Section 4.05.04. G., “Parking Space Requirements,” which requires parking spaces for offices/clubhouses to be parked at 50% normal requirements and accessory recreational facilities for multi-family projects, to instead require a total of four (4) parking spaces for the office/clubhouse and no additional parking spaces for the accessory recreational facilities on Tract “A-1”. Petitioners Justification: Per the actual parking demand, a total of four (4) parking spaces is sufficient for the office/clubhouse component of the proposed affordable housing development. Additional parking for the accessory recreational facilities is not needed due to the small size of the site (3.77-acres) and the compact design of the project. Sidewalks will be provided throughout, making the project a walkable/pedestrian friendly community. Parking requirements for the dwelling units will be met, as required by the Collier County Land Development Code Staff Analysis and Recommendation: Staff sees no detrimental effect if this deviation request is approved. Zoning and Development Review staff recommends APPROVAL of this deviation, finding that in compliance with LDC Section 10.02.13.A.3, the petitioner has demonstrated that “the element may be waived without a detrimental effect on the health, safety, and welfare of the community,” and LDC Section 10.02.13.B.5.h, the petitioner has demonstrated that the deviation is “justified as meeting public purposes to a degree at least equivalent to literal application of such regulations.” Deviation #5: (Buffer Requirements) “Deviation #5 seeks relief from LDC Section 4.06.02. C.4., “Type D Landscape Buffer,” which requires a 20-foot Type ’D’ landscape buffer along rights-of-way for developments of 15 acres or more, to instead allow a 10-foot wide Type ‘D’ buffer along Santa Barbara Boulevard and along the Roadway Easement for Tract B.” Petitioners Justification: The above requested deviation is to solidify existing conditions along the western and southern PUD boundaries for Tract B (Lake Tract) and is consistent with the approved plans for the water management lake. Staff Analysis and Recommendation: The as-built drawing for the lake on Tract B of the PUD, which was constructed as part of the Santa Barbara road widening project (see below), identifies an approved 10’ landscape buffer adjacent to Santa Barbara Blvd. Therefore, staff recommends APPROVAL, finding that, in compliance with LDC section 10.02.13.A.3., the petitioner has demonstrated that “the element may be waived without detrimental effect on the health, safety and welfare of the community” and LDC section 10.02.13.B.5.h the petitioner as demonstrated that 9.A.5.a Packet Pg. 1231 Attachment: Staff Report - Bembridge PUDA (13384 : PL20200000564 Bembridge PUDA) PUDA-PL20200000564; Bembridge Emergency Services Complex Page 15 of 16 Revised: November 9, 2020 the deviation is “justified as meeting public purposes to a degree at least equivalent to literal application of such regulations.” Deviation #6: (Buffer Requirements) “Deviation #6 seeks relief from LDC Section 4.05.02 Exhibit ‘A’, “Off-Street Parking Design Standards,” which permits a 2’ vehicular overhang into any landscape buffer that is 10’ or greater in width, to instead allow vehicular overhang into the 7’ Type ‘B’ buffer along the eastern boundary of Tract “A-1-Residential.” Petitioners Justification: Through coordination with South Florida Water Management District, on-site pavement/impervious areas for the proposed affordable housing development have been reduced to the extent possible. To create a site plan that is designed with more green space, parking spaces abutting the eastern buffer are being planned at 16’ in length rather than 18’. Providing parking spaces at this length prevents the opportunity to provide wheel stops, which would prevent vehicular overhang into the 7’ Type ‘B’ landscape buffer. There are no negative impacts created by this deviation request. Staff Analysis and Recommendation: Staff sees no detrimental effect if this deviation request is approved. Zoning and Development Review staff recommends APPROVAL of this deviation, finding that in compliance with LDC Section 10.02.13.A.3, the petitioner has demonstrated that “the element may be waived without a detrimental effect on the health, safety, and welfare of the 9.A.5.a Packet Pg. 1232 Attachment: Staff Report - Bembridge PUDA (13384 : PL20200000564 Bembridge PUDA) PUDA-PL20200000564; Bembridge Emergency Services Complex Page 16 of 16 Revised: November 9, 2020 community,” and LDC Section 10.02.13.B.5.h, the petitioner has demonstrated that the deviation is “justified as meeting public purposes to a degree at least equivalent to literal application of such regulations.” NEIGHBORHOOD INFORMATION MEETING (NIM): The applicant conducted a NIM on September 10, 2020 at New Hope Ministries located at 7675 Davis Boulevard, Naples, Fl. The meeting commenced at approximately 5:30 p.m. and ended at 6:17 p.m. The applicant’s agent explained the request for the proposed PUD Amendment. Jessica Harrelson, the agent, gave a PowerPoint presentation. It was discussed that the County entered into a private-public partnership and the applicant is requesting to increase the density from 6 to 16 units on the 5.1-acre parcel for a total of 82 units. The meeting was opened to attendees for questions. The concerns were height, traffic access points, too many apartments and rental units in the area, landscape buffers, increase of 30 units to 82 units, objection to affordable housing, too many affordable housing projects in the area. No commitments were discussed at this NIM meeting. A copy of the NIM materials are included in Attachment C. Currently there are no pending petitions at this location other than this PUDA. ENVIRONMENTAL ADVISORY COUNCIL (EAC) RECOMMENDATION: This project does not require Environmental Advisory Council (EAC) review, as this project did not meet the EAC scope of land development project reviews as identified in Section 2-1193 of the Collier County Codes of Laws and Ordinances. COUNTY ATTORNEY OFFICE REVIEW: The County Attorney’s Office reviewed this staff report on October 22, 2020. RECOMMENDATION: Staff recommends the CCPC forward this petition to the Board with a recommendation of approval of the PUDA and of the Agreement Authorizing Affordable Housing Density Bonus. Attachments: A) Proposed Ordinance B) Affordable Housing Density Bonus Agreement C) Application/Backup Materials 9.A.5.a Packet Pg. 1233 Attachment: Staff Report - Bembridge PUDA (13384 : PL20200000564 Bembridge PUDA) 9.A.5.b Packet Pg. 1234 Attachment: Attachment A - Proposed Ordinance (13384 : PL20200000564 Bembridge PUDA) HFAC 10-22-20 9.A.5.b Packet Pg. 1235 Attachment: Attachment A - Proposed Ordinance (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 BEMBRIDGE EMERGENCY SERVICES COMPLEX A COMMUNITY FACILITIES AND RESIDENTIAL PLANNED UNIT DEVELOPMENT REGULATIONS AND SUPPORTING MASTER PLAN GOVERNING BEMBRIDGE EMERGENCY SERVICES COMPLEX, A COMMUNITY FACILITIES PLANNED UNIT DEVELOPMENT PURSUANT TO PROVISIONS OF THE COLLIER COUNTY LAND DEVELOPMENT CODE PREPARED FOR: COLLIER COUNTY BOARD OF COMMISSONERS And McDowell Housing Partners 601 Brickell Key Drive, Suite 700 Miami, FL 33131 PREPARED BY: Coastal Engineering Consultants, Inc. 3106 South Horseshoe Drive Naples, FL 34104 Jessica Harrelson, AICP Davidson Engineering, Inc. 4365 Radio Road, Suite 201 Naples, FL 34104 DATE REVIEWD BY CCPC DATE APPROVED BY BCC 9-13-2005 ORDINANCE NUMBER 2005-46 AMENDMENTS AND REPEAL 1998-06 EXHIBIT A Revised September 19, 2005 1 9.A.5.b Packet Pg. 1236 Attachment: Attachment A - Proposed Ordinance (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 TABLE OF CONTENTS PAGE LIST OF EXHIBITS………………………………………………………………………………………………3 STATEMENT OF COMPLIANCE………………………………………………………………….………4 SECTION I PROPERTY OWNERSHIP AND DESCRIPTION……………………………...……..5 SECTION II PROJECT DEVELOPMENT REQUIREMENTS……………………………...………7 SECTION III COMMUNITY FACILITIES AREAS PLAN………………………………….………109 SECTION IV GENERAL DEVELOPMENT COMMITMENTS…………………………...…….1514 2 9.A.5.b Packet Pg. 1237 Attachment: Attachment A - Proposed Ordinance (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 LIST OF EXHIBITS EXHIBIT A PUD MASTER PLAN 3 9.A.5.b Packet Pg. 1238 Attachment: Attachment A - Proposed Ordinance (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 STATEMENT OF COMPLIANCE The development of approximately 39.82± acres of property in Collier County, as a Community Facilities Planned Unit Development to be known as Bembridge Emergency Services Complex Community Facilities Planned Unit Development (Bembridge ESC CFPUD and RPUD) shall be in compliance with the goals, objectives and policies of Collier County as set forth in the Growth Management Plan (GMP), and implementing land development regulations. The Calusa Park Elementary School and auxiliary school facilities are subject to the Interlocal Agreement adopted in May 2003. The Calusa Park Elementary School and existing facilities shall also be considered consistent with the Growth Management Plan. The land uses of the CFPUD and the RPUD will be consistent with the growth policies, land development regulations and applicable comprehensive planning objectives of each of the elements of the GMP for the following reasons: 1. The subject property is within the Urban Mixed Use, Urban Residential Subdistrict Land Use Designation and located just north of Activity Center #6 as identified on the Future Land Use Map. Residential uses, government facilities and essential services are permitted within this designation. 2. The subject property is located within the residential density band of Mixed Use Activity Center Number 6 located at the intersection of Davis Boulevard and Santa Barbara Boulevard. As such, the subject property is eligible for 3 additional dwelling units per acre (DU/A). The projected density of 6 16 DU/A shall be calculated using Tract A-1’s total site area of 5.1-acres and is in compliance with the FLUE of the GMP based on the following relationships to required criteria: Base Density (Based on FLUE Density Rating System) 4.0 DU/A Bonus Density, proximate to an Activity Center 3.0 DU/A Affordable Housing Density Bonus 12.0 DU/A Total Permitted Density for Tract “A-1 Residential” 7.0 16.0 DU/A RPUD Density (calculated on undeveloped portion of Tract A only) 6.0 DU/A 16.0 DU/A x 5.1-acres = 82 maximum residential units 3. The subject property's location in relation to existing or proposed community facilities and services permits the development's intensity as required in Objective 2 of the Future Land Use Element (FLUE). 4. The project development is compatible and complementary to existing and future surrounding land uses as required in Policy 5.4 of the FLUE. 4.5. The project development will result in an efficient and economical extension of community facilities and services. 5.6. All final local development orders for this project are subject to Sections 6.02.00 and 10.02.07 of the Collier County Land Development Code (LDC). 6.7. The Bembridge ESC CFPUD and RPUD project is compatible with and complementary to existing and future surround land uses and is considered to be consistent with Policy 5.4 of the FLUE. 4 9.A.5.b Packet Pg. 1239 Attachment: Attachment A - Proposed Ordinance (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 SECTION I PROPERTY OWNERSHIP AND DESCRIPTION 1.1 PURPOSE The purpose of this Section is to set forth the location and ownership of the property, and to describe the existing conditions of the property proposed to be developed under the project name of the Bembridge ESC CFPUD and RPUD. 1.2 LEGAL DESCRIPTION The subject property is currently known as the Bembridge PUD, which is approximately 39.82± acres, located in Section 4, Township 50 South, and Range 26 East, and described as follows: The Northwest 1/4 of the Southwest 1/4 of Section 4, Township 50 South, Range 26 East, Collier County, Florida. Tax Folio Numbers: 00399840007, 00400246406, 00400246309 and 00400248006 1.3 PROPERTY OWNERSHIP The subject property is currently under the ownership of Collier County, 3301 Tamiami Trail East, Naples, FL 34112, and the Collier County School District, 5775 Osceola Trail, Naples, FL 34109. 1.4 GENERAL DESCRIPTION OF PROPERTY AREA A. The project is located on the east side of Santa Barbara Boulevard approximately 2,906 feet south of Radio Road and 1,396 feet north of Davis Boulevard. B. The zoning classification of the subject property prior to the effective date of this approved CFPUD Document was Planned Unit Development (PUD). That PUD was approved by the Board of County Commissioners in 1998 (Ordinance 98-86) for residential and church use with a nursing home. Prior to that date it was designated Agricultural. C. Collier County Public Schools purchased 39.82± acres of the Bembridge PUD in January 2000 to build the Calusa Park Elementary School. In 2001 and 2002, Collier County purchased a 5.998± acre parcel and a 7± acre parcel from the School District of Collier County to build the ESC Center and EMS Station #1975 and water management lakes. D. The property has received the following approvals: 1. SDP approval for EMS Station #1975 (SDP-2003-AR-4786), May, 2004. 5 9.A.5.b Packet Pg. 1240 Attachment: Attachment A - Proposed Ordinance (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 1.5 PHYSICAL DESCRIPTION The project site is located within the Lely Canal Sub-basin. Run-off from the site is routed to the Davis Boulevard swale via an improved easement along the eastern boundary of the Shoppes at Santa Barbara PUD, and then southerly from the Davis Boulevard swale system along County Barn Road, around the Royal Wood Development to a canal which is tied to the Lely Canal. The current permitted, pumped discharge will be replaced by a system of interconnected lakes designed for water quality treatment and run-off attenuation to pre-development rates. A water management lake will be constructed by the Collier County Transportation Division on five acres located in the southwest comer of this project, which will serve Santa Barbara Boulevard (6-lanes), residential uses, EMS Station #1975, and Calusa Park Elementary School. An existing detention lake is located in the central area of the project on the elementary school site. Elevations within the project site range from 9.5 to 10.5 feet above mean sea level. The site is within Flood Zone "X" as shown on FEMA Firm Panel 120067 0415. The soils on this site are primarily Boca fine sand and Pineda fine sand and are modified by development of the site. 1.6 PROJECT DESCRIPTION The Bembridge ESC CFPUD and RPUD project is a multi-use project. Major uses consist of residential uses, those related to public safety (emergency medical services), the existing Calusa Park Elementary School and related auxiliary school facilities, and water management facilities which will serve these facilities and Santa Barbara Boulevard. 1.7 SHORT TITLE This Ordinance shall be known and cited as the “Bembridge ESC Community Facility CFPUD and RPUD Ordinance”. 6 9.A.5.b Packet Pg. 1241 Attachment: Attachment A - Proposed Ordinance (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 SECTION II PROJECT DEVELOPMENT REQUIREMENTS 2.1 PURPOSE The purpose of this Section is to delineate and generally describe the project plan of development, relationships to applicable County ordinances, and the respective land uses of the tracts included in the project, as well as other project relationships. 2.2 GENERAL A. Regulations for development of the Bembridge ESC CFPUD and RPUD shall be in accordance with the contents of this Document, the CFPUD and RPUD Planned Unit Development District and other applicable sections and parts of the Collier County LDC and GMP in effect at the time of building permit application. Where these regulations fail to provide developmental standards, then the provisions of the most similar district in the County LDC shall apply to the ESC Tracts "A", “A-1” and "B”. Tract "C", Calusa Park Elementary School and auxiliary facilities are subject to the Interlocal Agreement between the Collier County School District and Board of County Commissioners adopted in May 2003. B. Unless otherwise noted, the definitions of all terms in this Document have the same meaning as the definitions set forth in Collier County LDC. C. All conditions imposed and all graphic material presented depicting restrictions for the development of the Bembridge ESC CFPUD and RPUD shall become part of the regulations that govern the manner in which the Bembridge ESC CFPUD and RPUD site shall be developed. D. The provisions of Section 10.02.03.A.3.a. and b. of the Collier County LDC and the Interlocal Agreement (Adopted May 2003), where applicable, remain in full force and effect with respect to the development of the land which comprises the Bembridge ESC CFPUD and RPUD. E. The Master Plan is illustrated graphically as Exhibit A. The location, size and configuration of the individual water management features and development tracts shall be determined at the time of final site development plan approval with minor adjustments at the time of final plan approval, in accordance with Section 10.02.03 of the LDC. 2.3 DESCRIPTION OF PROJECT PLAN AND PROPOSED LAND USES A. The layout of streets and use of land for the various tracts is illustrated graphically by Exhibit A, the Master Plan. There shall be two three land use tracts (Tracts "A", “A-1” and "C") with necessary water management lakes, street rights-of-way, the general configuration of which is also illustrated by Exhibit A. Tract “A” represents the future residential area and Emergency Management Services building and related facilities. Tract “A-1” represents a future residential area on 3.77-acres and a Master County Pump Station on 1.33-acres, for a total 7 9.A.5.b Packet Pg. 1242 Attachment: Attachment A - Proposed Ordinance (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 site area of 5.1-acres. Tract "C" represents the existing Calusa Park Elementary School. An additional development tract, Tract "B" represents the lake and lake expansion area which will provides detention for stormwater runoff for this project and the Santa Barbara Boulevard road improvements. B.In addition to the various areas and specific items shown on Exhibit A, such easements as necessary (utility, private, semi-public, etc.) shall be established within or along the various tracts as may be necessary. 2.4 DESCRIPTION OF PROJECT DENSITY OR INTENSITY OF LAND USE The EMS Station #1975 shall not exceed 7,000 square feet. Ancillary uses, such as heating, cooling, air conditioning mechanical equipment buildings and radio tower equipment areas, do not count towards this building area allocation. The gross residential project density shall be a maximum of 6.0 16.0 units per acre, based upon the undeveloped portion total site area of Tract A-1 only, subject to an Affordable Housing Density Bonus Agreement between the Developer and Collier County. (16.0 DU/A x 5.1-acres = 82 maximum residential units) 2.5 RELATED PROJECT PLAN APPROVAL REQUIREMENTS A.Final plans for all required improvements shall receive approval of the appropriate Collier County governmental agency to insure compliance with the Bembridge ESC CFPUD Master Plan, the Collier County Subdivision Code, and the platting laws of the State of Florida. B.Exhibit A, the Master Plan, constitutes the required PUD development plan. C.The provisions of Section 10.02.03 of the Collier County LDC, when applicable, shall apply to the development of all platted tracts, or parcels of land as provided in said Section prior to the issuance of a building permit or other development order. D.Appropriate instruments shall be provided at the time of infrastructural improvements regarding any dedications and method for providing perpetual maintenance of common facilities. 2.6 AMENDMENTS TO PUD DOCUMENT OR PUD MASTER PLAN Amendments may be made to the CFPUD and RPUD as provided in the Collier County LDC, Section 10.02.13.E. 8 9.A.5.b Packet Pg. 1243 Attachment: Attachment A - Proposed Ordinance (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 SECTION III COMMUNITY FACILITIES PLAN 3.1 PURPOSE The purpose of this Section is to identify permitted uses and development standards for areas so designated on Exhibit A, Bembridge ESC CFPUD Master Plan. 3.2 GENERAL DESCRIPTION The CFPUD and RPUD provides for a maximum of 7,000 square feet of building area for permitted and accessory emergency operations uses, limited to an EMS use, as well as the existing Calusa Park Elementary School and a residential area, on 39.82± acres. Ancillary uses, such as HVAC and radio tower equipment areas, do not count towards this building area allocation. 3.3 PERMITTED USES AND STRUCTURES No building or structure, or part thereof, shall be erected, altered or used, or land used, in whole or part, for other than the following: A.Permitted Principal Uses and Structures: 1.Educational plants (Tract "C") 2.Emergency medical services (Tract "A") 3.Residential units that are one-family and two-family dwellings, townhouse dwellings, garden apartment dwellings, and multi-family dwellings limited to 6 16 units per acre on Tract "A-1" only 4.Essential Services, inclusive of a Master County Pump Station (Tract “A-1”) B.Uses Accessory to Permitted Uses: 1.Accessory uses and structures customarily associated with the principal uses including carports, garages, and utility buildings for residential uses within Tract A-1. 2.Residential and commercial uses of an accessory nature which are incidental and customarily associated with support of a principal use. 3.Accessories for residential use such as recreational uses and facilities including swimming pools, tennis courts, children's playground areas, tot lots, walking paths, picnic areas, recreation buildings/clubhouses, and basketball/shuffle board courts for residential uses within Tract A-1. 4.Temporary use of the site for public purposes in accordance with Section 10.02.06.G. the LDC. 5.Parking facilities (Tract “A”, Tract “A-1” and “C”). 6.HVAC plants and other like facilities (Tract “A”, Tract “A-1” and “C”). 7.Major maintenance and service facilities (Tract “A”, Tract “A-1” and “C”) 9 9.A.5.b Packet Pg. 1244 Attachment: Attachment A - Proposed Ordinance (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 3.4 COMMUNITY FACILITIES DEVELOPMENT STANDARDS A. Minimum Lot Area: None required. B. Minimum Lot Width: None required. C. Minimum Yards: 1. Principal and Accessory Structures a. Perimeter of CFPUD Fifty (50) feet or ½ the building height, abutting residentially whichever is greater. zoned property b. Perimeter of CFPUD Twenty-five (25) feet or ½ the building height, abutting non residentially whichever is greater. zoned property. c. Waterfront Zero (0) feet to bulkhead or rip-rap at top or of Bank, otherwise 20 feet. D. Distance Between Principal Structures on the Same Parcel: A minimum 15 feet or one-half sum of the building heights as measured by the closest exterior building walls, whichever is greater. E. Distance Between Accessory Structures on the Same Parcel: A minimum of 10 feet between detached accessory structures and between accessory structures and principal structures. F. Maximum Building Height 1. Principal buildings shall not exceed 40 feet in height nor 3 stories, whichever is less. 2. Accessory structures shall not exceed 30 feet in height. 10 9.A.5.b Packet Pg. 1245 Attachment: Attachment A - Proposed Ordinance (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 3.5 RESIDENTIAL USE DEVELOPMENT STANDARDS A. Minimum Yards: 1. Yards along Santa Barbara Boulevard: Seventy (70) Fifty (50) feet for one (1) and two (2) story structures and one hundred fifty (150) feet for three story structures. 2. Yards from on-site lakes: twenty (20) feet 3. Yards for internal tracts (principal structures): Front - 30 feet or half the building height Side / Rear – 20 feet 4. Yards for internal tracts (accessory structures): Front - 10 feet Side/Rear - 5 feet B. Minimum Floor Area (residential units): 1. One bedroom units - six hundred (600) square feet. 2. Two bedroom units - eight hundred fifty (850) square feet. 3. Three bedroom units - eleven hundred (1100) square feet. 4. Four bedroom units - one thousand three hundred fifty (1350) square feet. C. Distance Between Principal Structures: 1. Between one (1) story structures - Ten (10) feet. 2. Between one (1) story and two (2) story structures - Fifteen (15) feet. 3. Between one (1) story and three (3) story structures - Twenty (20) feet. 4. Between two (2) story structures - Twenty (20) feet. 5. Between two (2) story and three (3) story structures - Twenty-five (25) feet. 6. Between three (3) story structures - thirty (30) feet. 7. Principal to accessory structures – ten (10) feet. D. Maximum Building Height: 1. Principal buildings shall not exceed 40 feet in height or 3 stories, whichever is less. 2. Accessory structures shall not exceed the height restrictions of the LDC. 3.6 PROVISIONS FOR OFF-SITE REMOVAL OF EARTHEN MATERIAL The excavation and stockpiling of earthen material in preparation of water management facilities or to otherwise develop water bodies is hereby permitted. Off-site disposal is also hereby permitted subject to the following conditions: A. Excavation activities shall comply with "clear and fill” application requirements pursuant to Subsection 4.06.04.A.1.a.iii of the LDC. Off-site removal shall be limited to 10% of the total 11 9.A.5.b Packet Pg. 1246 Attachment: Attachment A - Proposed Ordinance (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 volume excavated, but not to exceed 20,000 cubic yards as set forth in the Collier County Code of Laws and Ordinances. B.All other provisions of the Collier County Code of Laws and Ordinances, shall apply. 3.7 LANDSCAPE BUFFERS, BERMS, FENCES, AND WALLS The following standards shall apply: A.Landscape berms shall have the following maximum side slopes: 1.Grassed berms 4:1 2.Ground cover berms Perimeter 3:1 Internal to project 3:1 3.Structural walled berms-vertical B.Landscape buffers, berms, gates, fences and walls may be constructed within the landscape buffer tract along the perimeter of the Bembridge ESC CFPUD boundary prior to preliminary subdivision plat and site development plan submittal. Sidewalks shall meet the requirements of Section 4.06.02.D.4 of the LDC. Landscape and irrigation plans shall be submitted to Collier County Community Development and Environmental Services (CDES) for approval prior to construction. C.Pedestrian sidewalks and/or bike paths, water management systems, drainage structures, and utilities may be allowed in landscape buffers as permitted by Section 4.06.02.D.4. of the LDC. D.A 15’ Type “D” buffer shall be provided along Santa Barbara Boulevard for the portion of Tract “A-1” that is developed with residential uses. 3.8 DESIGN GUIDELINES AND STANDARDS The Bembridge ESC CFPUD is intended to encourage ingenuity, innovation and imagination in the planning, design and development or redevelopment of relatively large tracts of land as set forth in Section 2.03.06. of the LDC. 3.9 GENERAL PERMITTED USES Certain uses shall be considered general permitted uses throughout the Bembridge ESC CFPUD. General permitted uses are those uses which generally serve the facilities. A.General Permitted Uses: 1.Essential services as set forth under Section 2.01.03 of the LDC. 2.Water management facilities and related structures. 3.Lakes, including lakes with bulkheads or other architectural or structural bank treatments. 4.Guardhouses, gatehouses, and access control structures. 12 9.A.5.b Packet Pg. 1247 Attachment: Attachment A - Proposed Ordinance (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 5. Temporary construction and administrative offices for authorized contractors and consultants, including necessary access ways, parking areas and related uses. 3.10 SIGNAGE All signs shall be in accordance with Section 5.06.00 of the LDC with the exclusion of signs for Calusa Park Elementary School which are subject to the provisions of Section 10.02.03.A.3.a. and b. of the Collier County LDC and the Interlocal Agreement of May 2003. Two entry signs for the Calusa Park Elementary School shall be permitted, if one is a marquee sign (see 4.13.F 4.12.1). 3.11 SIDEWALKS/BIKEPATHS A. Pursuant to Section 6.06.02 of the LDC and Section 3.6 and 4.9 of the Bembridge ESC CFPUD, sidewalks/bikepaths shall be permitted as follows: 1. An internal sidewalk shall be permitted within drainage easements. 2. Sidewalks may be located outside platted rights-of-way when located within a separate sidewalk easement. 3. Sidewalks may be located within landscape buffers and/or easements. 13 9.A.5.b Packet Pg. 1248 Attachment: Attachment A - Proposed Ordinance (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 SECTION IV GENERAL DEVELOPMENT COMMITMENTS 4.1 PURPOSE The purpose of this Section is to set forth the development commitments for the Bembridge Emergency Services Complex CFPUD. 4.2 GENERAL All facilities shall be constructed in strict accordance with final site development plans and all applicable State and local laws, codes, and regulations applicable to this CFPUD in effect at the time of site plan submittal with the exclusion of Calusa Park Elementary School which is subject to the requirements in Section 10.02.03.A.3.a. and b. of the LDC and the lnterlocal Agreement of May 2003. Except where specifically noted or stated otherwise, the standards and specifications of Chapter 4 of the LDC shall apply to this project. The developer, its successor and assigns, shall be responsible for the commitments outlined in this Document. The developer, its successor or assignee, shall follow the Master Plan and the regulations of the CFPUD as adopted, and any other conditions or modifications as may be agreed to in the rezoning of the property. In addition, any successor or assignee in title to the developer, is bound by the commitments within this Document. Issuance of a development permit by a county does not in any way create any rights on the part of the applicant to obtain a permit from a state or federal agency and does not create any liability on the part of the county for issuance of the permit if the applicant fails to obtain requisite approvals or fulfill the obligations imposed by a state or federal agency or undertakes actions that result in a violation of state or federal law.” (Section 125.022, FS) 4.3 CFPUD MASTER PLAN A. The Bembridge ESC CFPUD Master Plan (Exhibit A) is an illustration of the conceptual development plan. Tracts and boundaries shown on the plan are conceptual and shall not be considered final. Actual tract boundaries shall be determined at the time of site development plan approval. B. All necessary easements, dedications, or other instruments shall be granted to insure the continued operation and maintenance of all service utilities and all common areas in the project. 4.4 SCHEDULE OF DEVELOPMENT/MONITORING REPORT AND SUNSET PROVISION A. Sunsetting. The Bembridge ESC CFPUD shall be subject to the sunset provisions of Section 10.02.13.D of the LDC, as amended. B. Monitoring Report: An annual PUD monitoring report shall be submitted pursuant to Section 10.02.13.F of the LDC. 14 9.A.5.b Packet Pg. 1249 Attachment: Attachment A - Proposed Ordinance (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 A. One entity (hereinafter the Managing Entity) shall be responsible for PUD monitoring until close-out of the PUD, and this entity shall also be responsible for satisfying all PUD commitments until close-out of the PUD. At the time of this PUD approval, the Managing Entity is Collier County. Should the Managing Entity desire to transfer the monitoring and commitments to a successor entity, then it must provide a copy of a legally binding document that needs to be approved for legal sufficiency by the County Attorney. After such approval, the Managing Entity will be released of their/its obligations upon written approval of the transfer by County staff, and the successor entity shall become the Managing Entity. As Owner and Developer sell off tracts, the Managing Entity shall provide written notice to County that includes an acknowledgement of the commitments required by the PUD by the new owner and the new owner’s agreement to comply with the Commitments through the Managing Entity, but the Managing Entity shall not be relieved of its responsibility under this Section. When the PUD is closed-out, then the Managing Entity is no longer responsible for the monitoring and fulfillment of PUD commitments. 4.5 ENGINEERING A. All project development shall be consistent with the LDC. 4.6 UTILITIES A. Water distribution, sewage collection, and transmission systems shall be constructed throughout the project by the developer. Potable water and sanitary sewer facilities constructed within platted rights-of-way or within dedicated County utility easements shall be conveyed to Collier County, pursuant to Collier County Ordinance 04-31, as may be amended. B. Upon completion of the utility facilities, the facilities shall be tested to insure they meet Collier County utility construction requirements in effect at the time construction plans are approved. 4.7 WATER MANAGEMENT A. A SFWMD surface water management permit shall be obtained prior to approval of the site development plan. B. An excavation permit shall be required for the proposed lakes in accordance with the Collier County Code of Laws and Ordinances. All lake dimensions shall be approved at the time of excavation permit approval. 4.8 ENVIRONMENTAL A. A minimum of sixty (60) thirty (30) percent open space of the PUD’s gross area of the portion of the site that is developed for residential purposes, as described in Section 4.02.01.B.2. of the LDC, shall be provided. 15 9.A.5.b Packet Pg. 1250 Attachment: Attachment A - Proposed Ordinance (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 B. An exotic vegetation removal, monitoring and maintenance plan for the site, with emphasis on the preserve/open space areas, shall be submitted to the Department of Environmental Services Staff for review and approval prior to final site plan/construction plan approval. C. This CFPUD shall be consistent with the Environmental Sections of the Collier County GMP and the Collier County LDC in effect at the time of final development order approval. D. Environmental permitting shall be in accordance with the State of Florida Environmental Resource· Permit Rules and be subject to review and approval by the Environmental Services Review Staff. Removal of exotic vegetation shall not be counted towards mitigation for impacts to Collier County jurisdictional wetlands. E. All approved agency (SFWMD, ACOE, FPWCC) permits shall be submitted prior to final plan/construction plan approval. F. The preservation requirement for Tract “A-1” shall be 15% of the existing native vegetation on-site and can be provided off-site per LDC Section 3.05.07 H.f.iii. (0.82-acres x 15% = 0.12- acres required) 4.9 TRANSPORTATION A. All traffic control devices, signs, pavement markings and design criteria shall be in accordance with Florida Department of Transportation (FDOT) Manual of Uniform Minimum Standards ( MUMS), current edition, FDOT Design Standards, current edition, and the Manual On Uniform Traffic Control Devices MUTCD), current edition. All other improvements shall meet the requirements of the Collier County LDC. B. Arterial level street lighting shall be provided at all access points. Access lighting shall be in place prior to the issuance of the first certificate of occupancy (CO). C. All work within Collier County rights-of-way or public easements shall require a rights-of-way permit. D. The development shall be designed to promote the safe travel of all roadway users including bicyclists and shall provide for the safety of pedestrians crossing said roadways. Sidewalks shall be separated from vehicular traffic in accordance with recognized standards and safe practices, as determined by Collier County Transportation Services Staff. A. The maximum total daily trip generation for ‘Tract A-1 Residential’ shall not exceed 50 two- way PM peak hour net trips based on the use codes in the ITE Manual on trip generation rates in effect at the time of application for SDP/SDPA or subdivision plat approval.” 16 9.A.5.b Packet Pg. 1251 Attachment: Attachment A - Proposed Ordinance (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 4.10 ACCESSORY STRUCTURES Accessory structures shall be constructed simultaneously with or following the construction of the principal structure, except for a construction site administrative office. 4.1211 LANDSCAPING FOR OFF-STREET PARKING AREAS All landscaping for off-street parking areas shall be in accordance with Section 4.06.00 of the LDC in effect at time of building permit application. 4.1312 DEVIATIONS FROM LAND DEVELOPMENT CODE A.Deviation withdrawn B.Deviation withdrawn C.Deviation withdrawn D.Deviation withdrawn E.Deviation withdrawn F. 1. Subsection 5.06.00 the LDC – Signs Deviation from Subsection 5.06.06.C.1 of the LDC, which limits the number of signs to one ground sign or one pole sign. Calusa Park Elementary School shall be permitted two entry signs with one being a marquee sign. G.Deviation withdrawn 2.Deviation #2 seeks relief from LDC section 4.06.02 C.4., “Type D Landscape Buffer,” which requires a 20-foot Type “D” landscape buffer along rights-of-way for developments of 15 acres or more, to instead allow a 15-foot wide Type “D” buffer on Tracts “A” and “A-1- Residential” along Santa Barbara Boulevard. 3.Deviation #3 seeks relief from LDC Section 4.06.02 C., “Landscape Buffers,” which requires a 15’ Type ‘B’ buffer between multi-family residential and a community facility, to instead allow a 7’ Type ‘B’ buffer along the eastern property line of Tract “A-1-Residential”. 4.Deviation #4 seeks relief from LDC Section 4.05.04. G., “Parking Space Requirements,” which requires parking spaces for offices/clubhouses to be parked at 50% normal requirements and accessory recreational facilities for multi-family projects, to instead require a total of four (4) parking spaces for the office/clubhouse and no additional parking spaces for the accessory recreational facilities on Tract “A-1”. 5.Deviation #5 seeks relief from LDC Section 4.06.02. C.4., “Type D Landscape Buffer,” which requires a 20-foot Type ’D’ landscape buffer along rights-of-way for developments of 15 acres or more, to instead allow a 10-foot wide Type ‘D’ buffer along Santa Barbara Boulevard and along the Roadway Easement for Tract B. 6.Deviation #6 seeks relief from LDC Section 4.05.02 Exhibit ‘A’, “Off-Street Parking Design Standards,” which permits a 2’ vehicular overhang into any landscape buffer that is 10’ or greater in width, to instead allow vehicular overhang into the 7’ Type ‘B’ buffer along the eastern boundary of Tract “A-1-Residential”. 4.13 AFFORDABLE HOUSING A.As documented in the Affordable Housing Density Bonus Agreement, the Developer has agreed to construct 13 rental units for residents in or below the very low income category (50% or less of the County median income), 50 rental units for residents in the low income category (51 to 60% of the County median income) and 19 rental units for residents in the low to moderate income category (61 to 80% of the County median income). 17 9.A.5.b Packet Pg. 1252 Attachment: Attachment A - Proposed Ordinance (13384 : PL20200000564 Bembridge PUDA) SANTA BARBARA BLVD(160' PUBLIC RIGHT-OF-WAY) ZONING: SHOPPES AT SANTA BARBARA PUD LAND USE: VACANT COMMERCIAL "TRACT B" EXISTING LAKE "TRACT C" CALUSA PARK ELEMENTARY SCHOOL "TRACT A-1" COUNTY PUMP STATION 15' TYPE "D" LANDSCAPE BUFFER ZONING: NEW HOPE MPUD LAND USE: RESIDENTIAL ZONING: BERKSHIRE LAKES PUD LAND USE: GOLF COURSE/RESIDENTIAL "TRACT A" EMS STATION ZONING: SANTA BARBARA LANDINGS RPUD LAND USE: PRESERVE ZONING: PLANTATION PUD LAND USE: RESIDENTIAL 15' TYPE "B" LANDSCAPE BUFFER 15' TYPE "B" LANDSCAPE BUFFER ZONING: WILDWOOD ESTATES PUD LAND USE: RESIDENTIAL 15' TYPE "B" LANDSCAPE BUFFER PEDESTRIAN INTERCONNECT PEDESTRIAN INTERCONNECT RIGHT-IN / RIGHT-OUT PARCEL BOUNDARY PARCEL BOUNDARY PUD BOUNDARY PUD BOUNDARY PUD BOUNDARY ROADWAY EASEMENT O.R. BOOK 1701, PAGE 600-601 0.12 ACRE PRESERVE "TRACT A-1" RESIDENTIAL 10' TYPE "D" LANDSCAPE BUFFER 10' TYPE "D" LANDSCAPE BUFFER 15' TYPE "D" LANDSCAPE BUFFER 1 4 3 25 5 6 4365 Radio Road, Suite 201 Naples, Florida 34104 P: 239.434.6060 Company Cert. of Authorization No. 00009496 NBEMBRIDGE EMERGENCY SERVICES COMPLEX CFPUD AND RPUD EXHIBIT A: PUD MASTER PLAN PAGE 1 OF 2 REVISIONS 1. REV. PER CC RAI COMMENTS - 7/13/2020 2. REV. PER CC RAI COMMENTS - 8/24/2020 3. REV. PER CC RAI COMMENTS - 10/12/202018 9.A.5.b Packet Pg. 1253 Attachment: Attachment A - Proposed Ordinance (13384 : PL20200000564 Bembridge PUDA) 4365 Radio Road, Suite 201 Naples, Florida 34104 P: 239.434.6060 Company Cert. of Authorization No. 00009496 CURRENT ZONING: BEMBRIDGE EMERGENCY SERVICES COMPLEX CFPUD AND RPUD PROPOSED ZONING: BEMBRIDGE EMERGENCY SERVICES COMPLEX CFPUD AND RPUD CURRENT LAND USE: COMMUNITY FACILITIES/ESSENTIAL SERVICES/WATER MANAGEMENT PROPOSED LAND USE: COMMUNITY FACILITIES/ESSENTIAL SERVICES/WATER MANAGEMENT/RESIDENTIAL FUTURE LAND USE: URBAN RESIDENTIAL SUBDISTRICT PLANNING NOTES:OPEN SPACE SUMMARY REQUIRED OPEN SPACE (39.82 AC X 30% = 11.95 AC) ·OPEN SPACE TO BE DETERMINED AT TIME OF SDP PERMITTING. DEVIATIONS 1.SUBSECTION 5.06.00 THE LDC - SIGNS DEVIATION FROM SUBSECTION 5.06.06.C.1 OF THE LDC, WHICH LIMITS THE NUMBER OF SIGNS TO ONE GROUND SIGN OR ONE POLE SIGN. CALUSA PARK ELEMENTARY SCHOOL SHALL BE PERMITTED TWO ENTRY SIGNS WITH ONE BEING A MARQUEE SIGN. 2.DEVIATION #2 SEEKS RELIEF FROM LDC SECTION 4.06.02 C.4., “TYPE D LANDSCAPE BUFFER,” WHICH REQUIRES A 20-FOOT TYPE “D” LANDSCAPE BUFFER ALONG RIGHTS-OF-WAY FOR DEVELOPMENTS OF 15 ACRES OR MORE, TO INSTEAD ALLOW A 15-FOOT WIDE TYPE “D” BUFFER ON TRACTS “A” AND “A-1-RESIDENTIAL” ALONG SANTA BARBARA BOULEVARD. 3.DEVIATION #3 SEEKS RELIEF FROM LDC SECTION 4.06.02 C.2., “TYPE B LANDSCAPE BUFFER,” WHICH REQUIRES A 15' TYPE 'B' BUFFER BETWEEN MULTI-FAMILY RESIDENTIAL AND A COMMUNITY FACILITY, TO INSTEAD ALLOW A 7' TYPE 'B' BUFFER ALONG THE EASTERN PROPERTY LINE OF TRACT “A-1-RESIDENTIAL”. 4.DEVIATION #4 SEEKS RELIEF FROM LDC SECTION 4.05.04. G., “PARKING SPACE REQUIREMENTS,” WHICH REQUIRES PARKING SPACES FOR OFFICES/CLUBHOUSES TO BE PARKED AT 50% NORMAL REQUIREMENTS AND ACCESSORY RECREATIONAL FACILITIES FOR MULTI-FAMILY PROJECTS, TO INSTEAD REQUIRE A TOTAL OF FOUR (4) PARKING SPACES FOR THE OFFICE/CLUBHOUSE AND NO ADDITIONAL PARKING SPACES FOR THE ACCESSORY RECREATIONAL FACILITIES ON TRACT “A-1”. 5.DEVIATION #5 SEEKS RELIEF FROM LDC SECTION 4.06.02. C.4., “TYPE D LANDSCAPE BUFFER,” WHICH REQUIRES A 20-FOOT TYPE 'D' LANDSCAPE BUFFER ALONG RIGHTS-OF-WAY FOR DEVELOPMENTS OF 15 ACRES OR MORE, TO INSTEAD ALLOW A 10-FOOT WIDE TYPE 'D' BUFFER ALONG SANTA BARBARA BOULEVARD AND ALONG THE ROADWAY EASEMENT FOR TRACT B. 6.DEVIATION #6 SEEKS RELIEF FROM LDC SECTION 4.05.02 EXHIBIT 'A', “OFF-STREET PARKING DESIGN STANDARDS,” WHICH PERMITS A 2' VEHICULAR OVERHANG INTO ANY LANDSCAPE BUFFER THAT IS 10' OR GREATER IN WIDTH, TO INSTEAD ALLOW VEHICULAR OVERHANG INTO THE 7' TYPE 'B' BUFFER ALONG THE EASTERN BOUNDARY OF TRACT “A-1-RESIDENTIAL”. TRACT A (EMS STATION): 7,000 SF FOR PRINCIPAL STRUCTURE TRACT A-1 (RESIDENTIAL): 82 RESIDENTIAL UNITS NOTE: REMAINING TRACTS ARE NOT SUBJECT TO A MAXIMUM DEVELOPMENT INTENSITY MAXIMUM DEVELOPMENT INTENSITY: 15% OF EXISTING NATIVE VEGETATION = 0.15 * 0.82 AC = 0.12 AC PER LDC SECTION 3.05.07 H.f.iii., PRESERVE REQUIREMENT MAY BE PROVIDED OFF-SITE. PRESERVE CALCULATION (TRACT 'A-1'): BEMBRIDGE EMERGENCY SERVICES COMPLEX CFPUD AND RPUD EXHIBIT A: PUD MASTER PLAN PAGE 2 OF 2 REVISIONS 1. REV. PER CC RAI COMMENTS - 7/13/2020 2. REV. PER CC RAI COMMENTS - 8/24/2020 3. REV. PER CC RAI COMMENTS - 10/12/202019 9.A.5.b Packet Pg. 1254 Attachment: Attachment A - Proposed Ordinance (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1255Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1256Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1257Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1258Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1259Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1260Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1261Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1262Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1263Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1264Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1265Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1266Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1267Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1268Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1269Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1270Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1271Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1272Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1273Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1274Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1275Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1276Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1277Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1278Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1279Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 9.A.5.cPacket Pg. 1280Attachment: Attachment B - Affordable Housing Agreement (13384 : PL20200000564 Bembridge PUDA) 2800 NORTH HORSESHOE DRIVE NAPLES, FLORIDA 34104 COLLIER COUNTY GOVERNMENT GROWTH MANAGEMENT DEPARTMENT www.collierĐŽƵŶƚǇ͘ŐŽǀ (239) 252-2400 FAX: (239) 252-6358 0DUFK Page 1 of 11 Application for a Public Hearing for PUD Rezone, Amendment to PUD or PUD to PUD Rezone PETITION NO PROJECT NAME DATE PROCESSED PUD Rezone (PUDZ): LDC subsection 10.02.13 A.-F., Ch. 3 G. 1 of the Administrative Code Amendment to PUD (PUDA): LDC subsection 10.02.13 E. and Ch. 3 G. 2 of the Administrative Code PUD to PUD Rezone (PUDR): LDC subsection 10.02.13 A.-F. APPLICANT CONTACT INFORMATION Name of Property Owner(s): _________________________________________________________ Name of Applicant if different than owner: _____________________________________________ Address: _________________________City: _______________ State: _________ ZIP: ___________ Telephone: _______________________ Cell: ______________________ Fax: __________________ E-Mail Address: ____________________________________________________________________ Name of Agent: ____________________________________________________________________ Firm: _____________________________________________________________________________ Address: ____________________________City: _______________ State: _______ ZIP: __________ Telephone: ____________________ Cell: ____________________ Fax: _______________________ E-Mail Address: ____________________________________________________________________ Be aware that Collier County has lobbyist regulations. Guide yourself accordingly and ensure that you are in compliance with these regulations. To be completed by staff Collier County, a Political Subdivision of the State of Florida and McDowell Housing Partners, LLC 601 Brickell Key Drive, Suite 700 Miami FL 33131 786-257-2767 cshear@mcdhousing.com Jessica Harrelson, AICP Davidson Engineering, Inc. 4365 Radio Rd, Suite 201 Naples FL 34104 239.434.6060 jessica@davidsonengineering.com 9.A.5.d Packet Pg. 1281 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 2800 NORTH HORSESHOE DRIVE NAPLES, FLORIDA 34104 COLLIER COUNTY GOVERNMENT GROWTH MANAGEMENT DEPARTMENT ǁǁǁ͘ĐŽůůŝĞƌĐŽƵŶƚǇ͘ŐŽǀ (239) 252-2400 FAX: (239) 252-6358 0DUFK Page 2 of 11 REZONE REQUEST This application is requesting a rezone from: _________________________ Zoning district(s) to the ________________________________ zoning district(s). Present Use of the Property: _________________________________________________________ Proposed Use (or range of uses) of the property: _________________________________________ Original PUD Name: ________________________________________________________________ Ordinance No.: ____________________________________________________________________ PROPERTY INFORMATION On a separate sheet attached to the application, provide a detailed legal description of the property covered by the application: x If the request involves changes to more than one zoning district, the applicant shall include a separate legal description for property involved in each district; x The applicant shall submit 4 copies of a recent survey (completed within the last six months, maximum 1" to 400' scale), if required to do so at the pre-application meeting; and x The applicant is responsible for supplying the correct legal description. If questions arise concerning the legal description, an engineer's certification or sealed survey may be required. Section/Township/Range: / / Lot: Block: Subdivision: ___________________________________________________ Metes & Bounds Description: _________________________________________________________ Plat Book: Page #: Property I.D. Number: ____________________________________ Size of Property: _______ ft. x _______ ft. = ________ Total Sq. Ft. Acres: _________ Address/ General Location of Subject Property: __________________________________________ __________________________________________________________________________________ PUD District (refer to LDC subsection 2.03.06 C): Commercial Residential Community Facilities Industrial Mixed Use Other: ________________ CFPUD and RPUD CFPUD & RPUD Calusa Park Elementary, EMS Station and Undeveloped Addition of Affordable Housing Bembridge Emergency Services Complex CFPUD and RPUD 2005-46 45026 See attached survey and legal description 00400246406 varies varies 222,591.6 5.1 Located on the east side of Santa Barbara Boulevard, west of Calusa Park Elementary, north of EMS Station #75 9.A.5.d Packet Pg. 1282 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 2800 NORTH HORSESHOE DRIVE NAPLES, FLORIDA 34104 COLLIER COUNTY GOVERNMENT GROWTH MANAGEMENT DEPARTMENT ǁǁǁ͘ĐŽůůŝĞƌĐŽƵŶƚǇ͘ŐŽǀ (239) 252-2400 FAX: (239) 252-6358 0DUFK Page 3 of 11 ADJACENT ZONING AND LAND USE Zoning Land Use N S E W If the owner of the subject property owns contiguous property please provide a detailed legal description of the entire contiguous property on a separate sheet attached to the application. Section/Township/Range: / / Lot: Block: Subdivision: ___________________________________________________ Plat Book: Page #: Property I.D. Number: ____________________________________ Metes & Bounds Description: _________________________________________________________ ASSOCIATIONS Required: List all registered Home Owner Association(s) that could be affected by this petition. Provide additional sheets if necessary. Information can be found on the Board of County Commissioner’s website at http://www.colliergov.net/Index.aspx?page=774. Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ Santa Barbara Landings RPUD Developed & Undeveloped Residential Shoppes at Santa Barbara PUD / New Hope MPUD Undeveloped & Developed Residential (Legacy) Wildwood Estates PUD Developed Residential ROW / Berkshire Lakes PUD Santa Barbara Blvd / Developed Residential & Golf Course Countryside Master Association, Inc. 600 Countryside Drive Naples FL 34104 Plantation Homeowners' Association of Collier County Inc. c/o Gulf Breeze Mngt Services, LLC 8910 Terrence Ct, Suite 200 Bonita Springs FL 34135 Legacy Naples,LLC 25101 Chagrin Blvd, Suite 300 Beachwood OH 44122 The Enclave Homeowners' Association, Inc. 27180 Bay Landing Drive, Suite 4 Bonita Springs FL 34135 9.A.5.d Packet Pg. 1283 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 2800 NORTH HORSESHOE DRIVE NAPLES, FLORIDA 34104 COLLIER COUNTY GOVERNMENT GROWTH MANAGEMENT DEPARTMENT ǁǁǁ͘ĐŽůůŝĞƌĐŽƵŶƚǇ͘ŐŽǀ (239) 252-2400 FAX: (239) 252-6358 0DUFK Page 4 of 11 EVALUATION CRITERIA Pursuant to LDC subsections 10.02.13 B, 10.02.08 F and Chapter 3 G. of the Administrative Code, staff’s analysis and recommendation to the Planning Commission, and the Planning Commission’s recommendation to the Board of County Commissioners shall be based upon consideration of the applicable criteria. On a separate sheet attached to the application, provide a narrative statement describing the rezone request with specific reference to the criteria below. Include any backup materials and documentation in support of the request. a. The suitability of the area for the type and pattern of development proposed in relation to physical characteristics of the land, surrounding areas, traffic and access, drainage, sewer, water, and other utilities. b. Adequacy of evidence of unified control and suitability of any proposed agreements, contract, or other instruments, or for amendments in those proposed, particularly as they may relate to arrangements or provisions to be made for the continuing operation and maintenance of such areas and facilities that are not to be provided or maintained at public expense. Findings and recommendations of this type shall be made only after consultation with the county attorney. c. Conformity of the proposed PUD with the goals, objectives and policies of the Growth Management Plan. (This is to include identifying what Sub-district, policy or other provision allows the requested uses/density, and fully explaining/addressing all criteria or conditions of that Sub-district, policy or other provision.) d. The internal and external compatibility of proposed uses, which conditions may include restrictions on location of improvements, restrictions on design, and buffering and screening requirements. e. The adequacy of usable open space areas in existence and as proposed to serve the development. f. The timing or sequence of development for the purpose of assuring the adequacy of available improvements and facilities, both public and private. g. The ability of the subject property and of surrounding areas to accommodate expansion. h. Conformity with PUD regulations, or as to desirable modifications of such regulations in the particular case, based on determination that such modifications of justified as meeting public purposes to a degree at least equivalent to literal application of such regulations. Deed Restrictions: The County is legally precluded from enforcing deed restrictions; however, many communities have adopted such restrictions. You may wish to contact the civic or property owners association in the area for which this use is being requested in order to ascertain whether or not the request is affected by existing deed restrictions. ^ĞĞĂƚƚĂĐŚŵĞŶƚ͘ 9.A.5.d Packet Pg. 1284 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 2800 NORTH HORSESHOE DRIVE NAPLES, FLORIDA 34104 COLLIER COUNTY GOVERNMENT GROWTH MANAGEMENT DEPARTMENT ǁǁǁ͘ĐŽůůŝĞƌĐŽƵŶƚǇ͘ŐŽǀ (239) 252-2400 FAX: (239) 252-6358 0DUFK Page 5 of 11 Previous land use petitions on the subject property: To your knowledge, has a public hearing been held on this property within the last year? If so, what was the nature of that hearing? __________________________________________________________________________________ __________________________________________________________________________________ Official Interpretations or Zoning Verifications: To your knowledge, has there been an official interpretation or zoning verification rendered on this property within the last year? Yes No if so please provide copies. PUBLIC NOTICE REQUIREMENTS This land use petition requires a Neighborhood Information Meeting (NIM), pursuant to Chapter 3 E. of the Administrative Code and LDC section 10.03.06. Following the NIM, the applicant will submit a written summary and any commitments that have been made at the meeting. Refer to Chapter 8 B. of the Administrative Code for the NIM procedural requirements. Chapter 8 of the Administrative Code requires that the applicant must remove their public hearing advertising sign(s) after final action is taken by the Board of County Commissioners. Based on the Board's final action on this item, please remove all public hearing advertising sign(s) immediately. RECORDING OF DEVELOPER COMMITMENTS Within 30 days of adoption of the Ordinance, the owner or developer (specify name) at their expense shall record in the Public Records of Collier County a Memorandum of Understanding of Developer Commitments or Notice of Developer Commitments that contains the legal description of the property that is the subject of the land use petition and contains each and every commitment of the owner or developer specified in the Ordinance. The Memorandum or Notice shall be in form acceptable to the County and shall comply with the recording requirements of Chapter 695, FS. A recorded copy of the Memorandum or Notice shall be provided to the Collier County Planned Unit Development Monitoring staff within 15 days of recording of said Memorandum or Notice. LDC subsection 10.02.08 D This application will be considered “open” when the determination of “sufficiency” has been made and the application is assigned a petition processing number. The application will be considered “closed” when the petitioner withdraws the application through written notice or ceases to supply necessary information to continue processing or otherwise actively pursue the rezoning, amendment or change, for a period of 6 months. An application deemed “closed” will not receive further processing and an application “closed” through inactivity shall be deemed withdrawn. An application deemed “closed” may be re-opened by submission of a new application, repayment of all application fees and the grant of a determination of “sufficiency”. Further review of the request will be subject to the then current code. N/A 9.A.5.d Packet Pg. 1285 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 2800 NORTH HORSESHOE DRIVE NAPLES, FLORIDA 34104 COLLIER COUNTY GOVERNMENT GROWTH MANAGEMENT DEPARTMENT ǁǁǁ͘ĐŽůůŝĞƌĐŽƵŶƚǇ͘ŐŽǀ (239) 252-2400 FAX: (239) 252-6358 0DUFK Page 6 of 11 STATEMENT OF UTILITY PROVISIONS FOR PUD REZONE REQUEST APPLICANT CONTACT INFORMATION Name of Applicant(s): _______________________________________________________________ Address: _________________________________ City: ___________ State: ________ ZIP: _______ Telephone: ____________________ Cell: _____________________ Fax: ______________________ E-Mail Address: ____________________________________________________________________ Address of Subject Property (If available): ______________________________________________ City: _________________ State: ________ ZIP: _________ PROPERTY INFORMATION Section/Township/Range: / / Lot: Block: Subdivision: ___________________________________________________ Metes & Bounds Description: _________________________________________________________ Plat Book: Page #: Property I.D. Number: ____________________________________ TYPE OF SEWAGE DISPOSAL TO BE PROVIDED Check applicable system: a. County Utility System b. City Utility System c. Franchised Utility System Provide Name: __________________________ d. Package Treatment Plant (GPD Capacity): _________________________ e. Septic System TYPE OF WATER SERVICE TO BE PROVIDED Check applicable system: a. County Utility System b. City Utility System c. Franchised Utility System Provide Name: __________________________ d. Private System (Well) Total Population to be Served: ________________________________________________________ Peak and Average Daily Demands: A. Water-Peak: _________ Average Daily: __________ B. Sewer-Peak: _________ Average Daily: __________ If proposing to be connected to Collier County Regional Water System, please provide the date service is expected to be required: ____________________________________________________ McDowell Housing Partners 601 Brickell Key Drive, Suite 700 Miami FL 33131 786.257.2767 cshear@mcdhousing.com N/A Naples FL 45026 N/A See Survey 00400246406 X Collier County X Collier County 205 38,745 28,700 27,675 20,500 2/2021 9.A.5.d Packet Pg. 1286 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 2800 NORTH HORSESHOE DRIVE NAPLES, FLORIDA 34104 COLLIER COUNTY GOVERNMENT GROWTH MANAGEMENT DEPARTMENT ǁǁǁ͘ĐŽůůŝĞƌĐŽƵŶƚǇ͘ŐŽǀ (239) 252-2400 FAX: (239) 252-6358 0DUFK Page 7 of 11 Narrative statement: Provide a brief and concise narrative statement and schematic drawing of sewage treatment process to be used as well as a specific statement regarding the method of affluent and sludge disposal. If percolation ponds are to be used, then percolation data and soil involved shall be provided from tests prepared and certified by a professional engineer. __________________________________________________________________________________ __________________________________________________________________________________ __________________________________________________________________________________ Collier County Utility Dedication Statement: If the project is located within the service boundaries of Collier County’s utility service system, a notarized statement shall be provided agreeing to dedicate the water distribution and sewage collection facilities within the project area to the Collier County Utilities. This shall occur upon completion of the construction of these facilities in accordance with all applicable County ordinances in effect at that time. This statement shall also include an agreement that the applicable system development charges and connection fees will be paid to the County Utilities Division prior to the issuance of building permits by the County. If applicable, the statement shall contain an agreement to dedicate the appropriate utility easements for serving the water and sewer systems. __________________________________________________________________________________ __________________________________________________________________________________ __________________________________________________________________________________ Statement of Availability Capacity from other Providers: Unless waived or otherwise provided for at the pre-application meeting, if the project is to receive sewer or potable water services from any provider other than the County, a statement from that provider indicating adequate capacity to serve the project shall be provided. N/A ACKNOWLEDGED. 9.A.5.d Packet Pg. 1287 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1288 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1289 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 2800 NORTH HORSESHOE DRIVE NAPLES, FLORIDA 34104 COLLIER COUNTY GOVERNMENT GROWTH MANAGEMENT DEPARTMENT ǁǁǁ͘ĐŽůůŝĞƌĐŽƵŶƚǇ͘ŐŽǀ (239) 252-2400 FAX: (239) 252-6358 0DUFK Page 9 of 11 Final Submittal Requirement Checklist for: PUD Rezone- Ch. 3 G. 1 of the Administrative Code Amendment to PUD- Ch. 3 G. 2 of the Administrative Code PUD to PUD Rezone- Ch. 3 G. 1 of the Administrative Code The following Submittal Requirement checklist is to be utilized during the Pre-Application Meeting and at time of application submittal. At final submittal, the checklist is to be completed and submitted with an up-to-date application. Please provide the submittal items in the exact order listed below, with cover sheets attached to each section. Incomplete submittals will not be accepted. A Model PUD Document is available online at http://www.colliercountyfl.gov/Home/ShowDocument?id=76983 . REQUIREMENTS # OF COPIES REQUIRED NOT REQUIRED Cover Letter with Narrative Statement including a detailed description of why amendment is necessary 1 Completed Application with required attachments (download latest version) 1 Pre-application meeting notes 1 Affidavit of Authorization, signed and notarized 1 Property Ownership Disclosure Form 1 Notarized and completed Covenant of Unified Control 1 Completed Addressing Checklist 1 Warranty Deed(s) 1 List Identifying Owner and all parties of corporation 1 Signed and sealed Boundary Survey 1 Architectural Rendering of proposed structures 1 Current Aerial Photographs (available from Property Appraiser) with project boundary and, if vegetated, FLUCFCS Codes with legend included on aerial. 1 Statement of Utility Provisions 1 Environmental Data Requirements pursuant to LDC section 3.08.00 1 Environmental Data Requirements collated into a single Environmental Impact Statement (EIS) packet at time of public hearings. Coordinate with project planner at time of public hearings. Listed or Protected Species survey, less than 12 months old. Include copies of previous surveys. 1 Traffic Impact Study 1 Historical Survey 1 School Impact Analysis Application, if applicable 1 Electronic copy of all required documents 1 Completed Exhibits A-F (see below for additional information)+ List of requested deviations from the LDC with justification for each (this document is separate from Exhibit E) Checklist continues on next page X X X X X X X X X 1X X X X X X X X 9.A.5.d Packet Pg. 1290 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 2800 NORTH HORSESHOE DRIVE NAPLES, FLORIDA 34104 COLLIER COUNTY GOVERNMENT GROWTH MANAGEMENT DEPARTMENT ǁǁǁ͘ĐŽůůŝĞƌĐŽƵŶƚǇ͘ŐŽǀ (239) 252-2400 FAX: (239) 252-6358 0DUFK Page 10 of 11 Revised Conceptual Master Site Plan 24” x 36”and One 8 ½” x 11” copy Original PUD document/ordinance, and Master Plan 24” x 36” – Only if Amending the PUD Revised PUD document with changes crossed thru & underlined 1 Copy of Official Interpretation and/or Zoning Verification 1 *If located in Immokalee or seeking affordable housing, include an additional set of each submittal requirement +The following exhibits are to be completed on a separate document and attached to the application packet: Exhibit A: List of Permitted Uses Exhibit B: Development Standards Exhibit C: Master Plan- See Chapter 3 E. 1. of the Administrative Code Exhibit D: Legal Description Exhibit E: List of Requested LDC Deviations and justification for each Exhibit F: List of Development Commitments If located in RFMU (Rural Fringe Mixed Use) Receiving Land Areas Pursuant to LDC subsection 2.03.08.A.2.a.2.(b.)i.c., the applicant must contact the Florida Forest Service at 239- 690-3500 for information regarding “Wildfire Mitigation & Prevention Plan.” PLANNERS – INDICATE IF THE PETITION NEEDS TO BE ROUTED TO THE FOLLOWING REVIEWERS: School District (Residential Components): Amy Lockheart Conservancy of SWFL: Nichole Johnson Utilities Engineering: Eric Fey Parks and Recreation: Barry Williams (Director) Emergency Management: Dan Summers Immokalee Water/Sewer District: City of Naples: Robin Singer, Planning Director Other: City of Naples Utilities Other: ASSOCIATED FEES FOR APPLICATION Pre-Application Meeting: $500.00 PUD Rezone: $10,000.00* plus $25.00 an acre or fraction of an acre PUD to PUD Rezone: $8,000.00* plus $25.00 an acre or fraction of an acre PUD Amendment: $6,000.00* plus $25.00 an acre or fraction of an acre Comprehensive Planning Consistency Review: $2,250.00 Environmental Data Requirements-EIS Packet (submittal determined at pre-application meeting): $2,500.00 Listed or Protected Species Review (when an EIS is not required): $1,000.00 Transportation Review Fees: o Methodology Review: $500.00 *Additional fees to be determined at Methodology Meeting. o Minor Study Review: $750.00 o Major Study Review $1,500.00 X X X X ✔ ✔ ✔ ✔ 9.A.5.d Packet Pg. 1291 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 2800 NORTH HORSESHOE DRIVE NAPLES, FLORIDA 34104 (239) 252-2400 FAX: (239) 252-6358 0DUFK Page 11 of 11 COLLIER COUNTY GOVERNMENT GROWTH MANAGEMENT DEPARTMENT ǁǁǁ͘ĐŽůůŝĞƌĐŽƵŶƚǇ͘ŐŽǀ Legal Advertising Fees: o CCPC: $1,125.00 o BCC: $500.00 School Concurrency Fee, if applicable: o Mitigation Fees, if application, to be determined by the School District in coordination with the County Fire Code Plans Review Fees are not listed, but are collected at the time of application submission and those fees are set forth by the Authority having jurisdiction. The Land Development Code requires Neighborhood Notification mailers for Applications headed to hearing, and this fee is collected prior to hearing. All checks payable to: Board of County Commissioners. As the authorized agent/applicant for this petition, I attest that all of the information indicated on this checklist is included in this submittal package. I understand that failure to include all necessary submittal information may result in the delay of processing this petition. *Additional fee for the 5th and subsequent re-submittal will be accessed at 20% of the original fee. ___________________________________ _____________ Signature of Petitioner or Agent Date ___________________________________ Printed named of signing party Jessica Harrelson, AICP 6.18.2020 ✔ 9.A.5.d Packet Pg. 1292 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA - PL20200000564 August 5, 2020 1 www.davidsonengineering.com BBEMBRIDGE EMERGENCY SERVICES COMPLEX - PUDA NARRATIVE AND EVALUATION CRITERIA PROJECT NARRATIVE: The Bembridge Emergency Services Complex Community Facilities Planned Unit Development (CFPUD) and Residential Planned Unit Development (RPUD) totals ±39.82 acres and is located on the east side of Santa Barbara, south of Radio Road and north of Davis Boulevard. The intent of the Planned Unit Development Amendment (PUDA) is to request an increase in residential density from 6 units per acre to 16 units per acre, using the Affordable Housing Density Bonus, for a maximum of 82 residential units within the Bembridge Emergency Services Complex CFPUD/RPUD. The subject County-owned parcel (folio #00400246406) is ±5.1-acres, now designated as Tract “A-1” on the updated PUD Master Plan. Of the parcel’s total site area, 3.77-acres is allocated for the proposed Affordable Housing Development (Tract ‘A-1 Residential’) and the remaining 1.33-acres is allocated for the development of a future Master County Pump Station (Tract ‘A-1 Master County Pump Station’). Density is calculated utilizing the site’s total area of 5.1-acres (16 DU/A x 5.1 = 82 units). Via a public-private partnership and a 99-year land lease, the future apartments (to be known as The Harmony on Santa Barbara) will be developed by McDowell Housing Partners, while the County maintains ownership of the 5.1-acre parcel. The apartment community will serve Collier County residents earning between 30 and ϴϬ percent of the County’s area median income (AMI). The Developer agrees to target and market at least 10% of units for seniors, veterans, or special needs populations. The community will provide one, two- and three-bedroom apartments along with accessory recreational facilities. Please refer to the Collier County Long-Term Lease Agreement included for reference. The request complies the County’s Growth Management Policies that encourage the development of affordable housing such as, “The goal of the Housing Element of the Collier County Growth Management Plan is ‘to create an adequate supply of decent, safe, sanitary, and affordable housing for all residents of Collier County’. The development of private housing in Collier County is driven by an expensive housing stock; effectively excluding low-income and working-class families from the housing market. Thus, there is a need for the County to find way to encourage the provision of affordable-workforce housing for these families.” Additional updates to the PUD are outlined below: 1. Updated ‘Residential Use Development Standards’ (PUD Section 3.5) 2. Redesignate portions of the existing “Tract A” to Tract “A-1 Residential” and Tract “A-1 County Pump Station” 3. Addition of Developer Commitments (PUD Sections 4.2 and 4.4) 4. Updated Open Space Requirement (30% of the PUD’s gross area), per LDC Section 4.02.01.B.2. (PUD Section 4.8) 5. Addition of Preservation Requirement for Tract “A-1” (PUD Section 4.8) 6. Addition of Maximum Trip Generation for Tract “A-1 Residential” (PUD Section 4.9) 9.A.5.d Packet Pg. 1293 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA - PL20200000564 August 5, 2020 2 www.davidsonengineering.com 7. Addition of Deviations pertaining to Landscape Buffers and Parking Requirements (PUD Section 4.12) EVALUATION CRITERIA: The following criteria have been addressed by the applicant to evaluate the proposed PUDR application: a. The suitability of the area for the type and pattern of development proposed in relation to physical characteristics of the land, surrounding areas, traffic and access, drainage, sewer, water, and other utilities. Response: Bembridge Emergency Services Complex is an existing CFPU & RPUD and is located within an established area of Collier County; therefore, does not contribute to urban sprawl. Existing ingress and egress points are located along Santa Barbara Blvd. One additional Access point along Santa Barbara Blvd. into Tract “A-1 Residential” is proposed; refer to Conceptual Master Plan. The PUD is and will continue to be served by Collier County Public Utilities; refer the Statement of Utility Provision. A Traffic Impact Statement has been prepared to outline the projects impacts to area roadway networks, while the PUD further addresses the development’s maximum AM and PM peak-hour trips. Stormwater has been conceptually reviewed and will be finalized at time of Site Development Plan permitting. An Environmental Resource Permit Modification, through the South Florida Water Management District, will be also obtained at time of SDP permitting. b. Adequacy of evidence of unified control and suitability of any proposed agreements, contract, or other instruments, or for amendments in those proposed, particularly as they may relate to arrangements or provisions to be made for the continuing operation and maintenance of such areas and facilities that are not to be provided or maintained at public expense. Findings and recommendations of this type shall be made only after consultation with the county attorney. Response: Evidence of Unified Control has been provided. The applicant/developer will be responsible for the provision and maintenance of all facilities on-site. Please refer to the recorded warranty deeds and the Collier County Long-Term Lease Agreement. c. Conformity of the proposed PUD with the goals, objectives and policies of the Growth Management Plan. (This is to include identifying what Sub-district, policy or other provision allows the requested uses/density, and fully explaining/addressing all criteria or conditions of that Sub-district, policy or other provision.) Response: The subject PUD is located within the Urban Residential Subdistrict, per the Future Land Use Map. Permitted uses within the existing PUD are consistent with the County’s Growth Management Plan. The density being requested of 9.A.5.d Packet Pg. 1294 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA - PL20200000564 August 5, 2020 3 www.davidsonengineering.com 16 units per acre is being achieved through an Affordable Housing Density Bonus Agreement between the Developer and Collier County (4 base units + 12 affordable housing density bonus units = 16 DU/A). d. The internal and external compatibility of proposed uses, which conditions may include restrictions on location of improvements, restrictions on design, and buffering and screening requirements. Response: The Bembridge Emergency Services Complex has been designed to be compatible with adjacent developments. e. The adequacy of usable open space areas in existence and as proposed to serve the development. Response: The PUD will continue to meet and/or exceed required open space requirements. f. The timing or sequence of development for the purpose of assuring the adequacy of available improvements and facilities, both public and private. Response: Please refer to the Transportation Impact Statement and Level of Service Analysis included within this PUDA request. The development, as proposed, will not have a negative impact upon existing private and public facilities. g. The ability of the subject property and of surrounding areas to accommodate expansion. Response: The subject properties are surrounded by rights-of-way, single-family residential and agricultural facilities. Expansion beyond the proposed PUD boundary is not feasible as currently proposed. h. Conformity with PUD regulations, or as to desirable modifications of such regulations in the particular case, based on determination that such modifications of justified as meeting public purposes to a degree at least equivalent to literal application of such regulations. Response: The proposed PUD Amendment complies with all applicable regulations set forth within the PUD and the Collier County Land Development Code. 9.A.5.d Packet Pg. 1295 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA - PL20200000564 August 5, 2020 4 www.davidsonengineering.com Future Land Use Element Provisions Policy 5.3 All rezonings must be consistent with the Growth Management Plan. For properties that are zoned inconsistent with the Future Land Use Designation Description Section but have nonetheless been determined to be consistent with the Future Land Use Element, as provided for in Policies 5.9 through 5.13, the following provisions apply: a. For such commercially-zoned properties, zoning changes will be allowed provided the new zoning district is the same or a lower intensity commercial zoning district as the existing zoning district, and provided the overall intensity of commercial land use allowed by the existing zoning district, except as allowed by Policy 5.11, is not exceeded in the new zoning district. The foregoing notwithstanding, such commercial properties may be approved for the addition of residential uses, in accordance with the Commercial Mixed-Use Subdistrict, though an increase in overall intensity may result. A zoning change of such commercial-zoned properties to a residential zoning district is allowed as provided for in the Density Rating System of this Future Land Use Element and as provided for in the Bayshore/Gateway Triangle Redevelopment Overlay. b. For such industrially-zoned properties, zoning changes will be allowed provided the new zoning district is the same or a lower intensity industrial, or commercial, zoning district as the existing zoning district, and provided the overall intensity of industrial land use allowed by the existing zoning district is not exceeded in the new zoning district. c. For such residentially-zoned properties, zoning changes will be allowed provided the authorized number of dwelling units in the new zoning district does not exceed that authorized by the existing zoning district, and provided the overall intensity of development allowed by the new zoning district does not exceed that allowed by the existing zoning district, except as provided for in the Bayshore/Gateway Triangle Redevelopment Overlay. d. For property deemed to be consistent with this Element pursuant to one or more of policies 5.9 through 5.13, said property may be combined and developed with other property, whether such other property is deemed consistent via those same policies or is deemed consistent with the Future Land Use Designation Description Section. For residential and mixed use developments only, the accumulated density between these properties may be distributed throughout the project, as provided for in the Density Rating System or the Commercial Mixed Use Subdistrict, as applicable. e. Overall intensity of development shall be determined based upon a comparison of public facility impacts as allowed by the existing zoning district and the proposed zoning district. Response: The subject PUD is an existing Community Facilities PUD and Residential PUD. The Amendment is requesting an increase in residential density, which will be achieved through an Affordable Housing Density Bonus Agreement between the Developer and Collier County. Public facilities are available to accommodate the proposed project. 9.A.5.d Packet Pg. 1296 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA - PL20200000564 August 5, 2020 5 www.davidsonengineering.com Policy 5.6: New developments shall be compatible with, and complementary to, the surrounding land uses, as set forth in the Land Development Code (Ordinance 04-41, adopted June 22, 2004 and effective October 18, 2004, as amended). Response: The Bembridge Emergency Services Complex CFPUD/RPUD is an existing PUD and has been designed to be compatible with adjacent developments. Policy 7.1 The County shall encourage developers and property owners to connect their properties to fronting collector and arterial roads, except where no such connection can be made without violating intersection spacing requirements of the Land Development Code. Response: The Bembridge Emergency Services Complex CFPUD/RPUD has existing access points along Santa Barbara Boulevard. One additional access, directly to the Bembridge Apartments site along Santa Barbara Blvd. is also proposed. Please refer to the Conceptual Mater Plan for access locations. Policy 7.2 The County shall encourage internal accesses or loop roads in an effort to help reduce vehicle congestion on nearby collector and arterial roads and minimize the need for traffic signals. The Bembridge Apartments, “Tract A-1 Residential” will be developed with internal vehicular drive aisles and circulation. Policy 7.3 All new and existing developments shall be encouraged to connect their local streets and their interconnection points with adjoining neighborhoods or other developments regardless of land use type. Tract “A-1 Residential” abuts Calusa Park Elementary’ s access road along the north and due to bus traffic and parent pick-up/drop off stacking, a vehicular interconnection is not feasible. A pedestrian interconnect for the students will be provided and coordination with CCPS regarding sidewalk extensions/striping is underway. The site abuts a proposed pump station “Tract A-1 Master County Pump Station” to the south and water management to the east. Policy 7.4 The County shall encourage new developments to provide walkable communities with a blend of densities, common open spaces, civic facilities and a range of housing prices and types. The Bembridge Apartments, proposed on “Tract A-1 Residential”, will be designed with sidewalks throughout the site and a sidewalk connection to Santa Barbara Blvd will be constructed to encourage a walkable community. 9.A.5.d Packet Pg. 1297 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA - PL20200000564 August 5, 2020 6 www.davidsonengineering.com Conservation & Coastal Management Element CCME GOAL 6: TO IDENTIFY, PROTECT, CONSERVE AND APPROPRIATELY USE NATIVE VEGETATIVE COMMUNITIES AND WILDLIFE HABITAT. OBJECTIVE 6.1: Protect native vegetative communities through the application of minimum preservation requirements… Per Collier County, the native vegetation requirement is 15% of the existing native vegetation, 0.82 acres. 0.82 * .15 = 0.12 acres. The project is proposing to preserve 0.12 acres of wetlands. See Figure 4 within the Environmental Report. Offsite mitigation is proposed to offset wetland impacts. CCME GOAL 7: TO PROTECT AND CONSERVE THE COUNTY’S FISHERIES AND WILDLIFE. OBJECTIVE 7.1: Direct incompatible land uses are directed away from listed species and their habitats… No listed species have been identified on the Subject Property, which is completely surrounded by roadways and development. See Appendix C, Protected Species Survey. A Wood Stork Foraging Analysis and Florida Bonneted Bat Tree Cavity Survey will be provided during permitting, if warranted. 9.A.5.d Packet Pg. 1298 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 BEMBRIDGE EMERGENCY SERVICES COMPLEX A COMMUNITY FACILITIES AND RESIDENTIAL PLANNED UNIT DEVELOPMENT REGULATIONS AND SUPPORTING MASTER PLAN GOVERNING BEMBRIDGE EMERGENCY SERVICES COMPLEX, A COMMUNITY FACILITIES PLANNED UNIT DEVELOPMENT PURSUANT TO PROVISIONS OF THE COLLIER COUNTY LAND DEVELOPMENT CODE PREPARED FOR: COLLIER COUNTY BOARD OF COMMISSONERS And McDowell Housing Partners 601 Brickell Key Drive, Suite 700 Miami, FL 33131 PREPARED BY: Coastal Engineering Consultants, Inc. 3106 South Horseshoe Drive Naples, FL 34104 Jessica Harrelson, AICP Davidson Engineering, Inc. 4365 Radio Road, Suite 201 Naples, FL 34104 DATE REVIEWD BY CCPC DATE APPROVED BY BCC 9-13-2005 ORDINANCE NUMBER 2005-46 AMENDMENTS AND REPEAL 1998-06 EXHIBIT A Revised September 19, 2005 1 9.A.5.d Packet Pg. 1299 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 TABLE OF CONTENTS PAGE LIST OF EXHIBITS………………………………………………………………………………………………3 STATEMENT OF COMPLIANCE………………………………………………………………….………4 SECTION I PROPERTY OWNERSHIP AND DESCRIPTION……………………………...……..5 SECTION II PROJECT DEVELOPMENT REQUIREMENTS……………………………...………7 SECTION III COMMUNITY FACILITIES AREAS PLAN………………………………….………109 SECTION IV GENERAL DEVELOPMENT COMMITMENTS…………………………...…….1514 2 9.A.5.d Packet Pg. 1300 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 LIST OF EXHIBITS EXHIBIT A PUD MASTER PLAN 3 9.A.5.d Packet Pg. 1301 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 STATEMENT OF COMPLIANCE The development of approximately 39.82± acres of property in Collier County, as a Community Facilities Planned Unit Development to be known as Bembridge Emergency Services Complex Community Facilities Planned Unit Development (Bembridge ESC CFPUD and RPUD) shall be in compliance with the goals, objectives and policies of Collier County as set forth in the Growth Management Plan (GMP), and implementing land development regulations. The Calusa Park Elementary School and auxiliary school facilities are subject to the Interlocal Agreement adopted in May 2003. The Calusa Park Elementary School and existing facilities shall also be considered consistent with the Growth Management Plan. The land uses of the CFPUD and the RPUD will be consistent with the growth policies, land development regulations and applicable comprehensive planning objectives of each of the elements of the GMP for the following reasons: 1. The subject property is within the Urban Mixed Use, Urban Residential Subdistrict Land Use Designation and located just north of Activity Center #6 as identified on the Future Land Use Map. Residential uses, government facilities and essential services are permitted within this designation. 2. The subject property is located within the residential density band of Mixed Use Activity Center Number 6 located at the intersection of Davis Boulevard and Santa Barbara Boulevard. As such, the subject property is eligible for 3 additional dwelling units per acre (DU/A). The projected density of 6 16 DU/A shall be calculated using Tract A-1’s total site area of 5.1-acres and is in compliance with the FLUE of the GMP based on the following relationships to required criteria: Base Density (Based on FLUE Density Rating System) 4.0 DU/A Bonus Density, proximate to an Activity Center 3.0 DU/A Affordable Housing Density Bonus 12.0 DU/A Total Permitted Density for Tract “A-1 Residential” 7.0 16.0 DU/A RPUD Density (calculated on undeveloped portion of Tract A only) 6.0 DU/A 16.0 DU/A x 5.1-acres = 82 maximum residential units 3. The subject property's location in relation to existing or proposed community facilities and services permits the development's intensity as required in Objective 2 of the Future Land Use Element (FLUE). 4. The project development is compatible and complementary to existing and future surrounding land uses as required in Policy 5.4 of the FLUE. 4.5. The project development will result in an efficient and economical extension of community facilities and services. 5.6. All final local development orders for this project are subject to Sections 6.02.00 and 10.02.07 of the Collier County Land Development Code (LDC). 6.7. The Bembridge ESC CFPUD and RPUD project is compatible with and complementary to existing and future surround land uses and is considered to be consistent with Policy 5.4 of the FLUE. 4 9.A.5.d Packet Pg. 1302 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 SECTION I PROPERTY OWNERSHIP AND DESCRIPTION 1.1 PURPOSE The purpose of this Section is to set forth the location and ownership of the property, and to describe the existing conditions of the property proposed to be developed under the project name of the Bembridge ESC CFPUD and RPUD. 1.2 LEGAL DESCRIPTION The subject property is currently known as the Bembridge PUD, which is approximately 39.82± acres, located in Section 4, Township 50 South, and Range 26 East, and described as follows: The Northwest 1/4 of the Southwest 1/4 of Section 4, Township 50 South, Range 26 East, Collier County, Florida. Tax Folio Numbers: 00399840007, 00400246406, 00400246309 and 00400248006 1.3 PROPERTY OWNERSHIP The subject property is currently under the ownership of Collier County, 3301 Tamiami Trail East, Naples, FL 34112, and the Collier County School District, 5775 Osceola Trail, Naples, FL 34109. 1.4 GENERAL DESCRIPTION OF PROPERTY AREA A. The project is located on the east side of Santa Barbara Boulevard approximately 2,906 feet south of Radio Road and 1,396 feet north of Davis Boulevard. B. The zoning classification of the subject property prior to the effective date of this approved CFPUD Document was Planned Unit Development (PUD). That PUD was approved by the Board of County Commissioners in 1998 (Ordinance 98-86) for residential and church use with a nursing home. Prior to that date it was designated Agricultural. C. Collier County Public Schools purchased 39.82± acres of the Bembridge PUD in January 2000 to build the Calusa Park Elementary School. In 2001 and 2002, Collier County purchased a 5.998± acre parcel and a 7± acre parcel from the School District of Collier County to build the ESC Center and EMS Station #1975 and water management lakes. D. The property has received the following approvals: 1. SDP approval for EMS Station #1975 (SDP-2003-AR-4786), May, 2004. 5 9.A.5.d Packet Pg. 1303 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 1.5 PHYSICAL DESCRIPTION The project site is located within the Lely Canal Sub-basin. Run-off from the site is routed to the Davis Boulevard swale via an improved easement along the eastern boundary of the Shoppes at Santa Barbara PUD, and then southerly from the Davis Boulevard swale system along County Barn Road, around the Royal Wood Development to a canal which is tied to the Lely Canal. The current permitted, pumped discharge will be replaced by a system of interconnected lakes designed for water quality treatment and run-off attenuation to pre-development rates. A water management lake will be constructed by the Collier County Transportation Division on five acres located in the southwest comer of this project, which will serve Santa Barbara Boulevard (6-lanes), residential uses, EMS Station #1975, and Calusa Park Elementary School. An existing detention lake is located in the central area of the project on the elementary school site. Elevations within the project site range from 9.5 to 10.5 feet above mean sea level. The site is within Flood Zone "X" as shown on FEMA Firm Panel 120067 0415. The soils on this site are primarily Boca fine sand and Pineda fine sand and are modified by development of the site. 1.6 PROJECT DESCRIPTION The Bembridge ESC CFPUD and RPUD project is a multi-use project. Major uses consist of residential uses, those related to public safety (emergency medical services), the existing Calusa Park Elementary School and related auxiliary school facilities, and water management facilities which will serve these facilities and Santa Barbara Boulevard. 1.7 SHORT TITLE This Ordinance shall be known and cited as the “Bembridge ESC Community Facility CFPUD and RPUD Ordinance”. 6 9.A.5.d Packet Pg. 1304 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 SECTION II PROJECT DEVELOPMENT REQUIREMENTS 2.1 PURPOSE The purpose of this Section is to delineate and generally describe the project plan of development, relationships to applicable County ordinances, and the respective land uses of the tracts included in the project, as well as other project relationships. 2.2 GENERAL A. Regulations for development of the Bembridge ESC CFPUD and RPUD shall be in accordance with the contents of this Document, the CFPUD and RPUD Planned Unit Development District and other applicable sections and parts of the Collier County LDC and GMP in effect at the time of building permit application. Where these regulations fail to provide developmental standards, then the provisions of the most similar district in the County LDC shall apply to the ESC Tracts "A", “A-1” and "B”. Tract "C", Calusa Park Elementary School and auxiliary facilities are subject to the Interlocal Agreement between the Collier County School District and Board of County Commissioners adopted in May 2003. B. Unless otherwise noted, the definitions of all terms in this Document have the same meaning as the definitions set forth in Collier County LDC. C. All conditions imposed and all graphic material presented depicting restrictions for the development of the Bembridge ESC CFPUD and RPUD shall become part of the regulations that govern the manner in which the Bembridge ESC CFPUD and RPUD site shall be developed. D. The provisions of Section 10.02.03.A.3.a. and b. of the Collier County LDC and the Interlocal Agreement (Adopted May 2003), where applicable, remain in full force and effect with respect to the development of the land which comprises the Bembridge ESC CFPUD and RPUD. E. The Master Plan is illustrated graphically as Exhibit A. The location, size and configuration of the individual water management features and development tracts shall be determined at the time of final site development plan approval with minor adjustments at the time of final plan approval, in accordance with Section 10.02.03 of the LDC. 2.3 DESCRIPTION OF PROJECT PLAN AND PROPOSED LAND USES A. The layout of streets and use of land for the various tracts is illustrated graphically by Exhibit A, the Master Plan. There shall be two three land use tracts (Tracts "A", “A-1” and "C") with necessary water management lakes, street rights-of-way, the general configuration of which is also illustrated by Exhibit A. Tract “A” represents the future residential area and Emergency Management Services building and related facilities. Tract “A-1” represents a future residential area on 3.77-acres and a Master County Pump Station on 1.33-acres, for a total 7 9.A.5.d Packet Pg. 1305 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 site area of 5.1-acres. Tract "C" represents the existing Calusa Park Elementary School. An additional development tract, Tract "B" represents the lake and lake expansion area which will provides detention for stormwater runoff for this project and the Santa Barbara Boulevard road improvements. B. In addition to the various areas and specific items shown on Exhibit A, such easements as necessary (utility, private, semi-public, etc.) shall be established within or along the various tracts as may be necessary. 2.4 DESCRIPTION OF PROJECT DENSITY OR INTENSITY OF LAND USE The EMS Station #1975 shall not exceed 7,000 square feet. Ancillary uses, such as heating, cooling, air conditioning mechanical equipment buildings and radio tower equipment areas, do not count towards this building area allocation. The gross residential project density shall be a maximum of 6.0 16.0 units per acre, based upon the undeveloped portion total site area of Tract A-1 only, subject to an Affordable Housing Density Bonus Agreement between the Developer and Collier County. (16.0 DU/A x 5.1-acres = 82 maximum residential units) 2.5 RELATED PROJECT PLAN APPROVAL REQUIREMENTS A. Final plans for all required improvements shall receive approval of the appropriate Collier County governmental agency to insure compliance with the Bembridge ESC CFPUD Master Plan, the Collier County Subdivision Code, and the platting laws of the State of Florida. B. Exhibit A, the Master Plan, constitutes the required PUD development plan. C. The provisions of Section 10.02.03 of the Collier County LDC, when applicable, shall apply to the development of all platted tracts, or parcels of land as provided in said Section prior to the issuance of a building permit or other development order. D. Appropriate instruments shall be provided at the time of infrastructural improvements regarding any dedications and method for providing perpetual maintenance of common facilities. 2.6 AMENDMENTS TO PUD DOCUMENT OR PUD MASTER PLAN Amendments may be made to the CFPUD and RPUD as provided in the Collier County LDC, Section 10.02.13.E. 8 9.A.5.d Packet Pg. 1306 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 SECTION III COMMUNITY FACILITIES PLAN 3.1 PURPOSE The purpose of this Section is to identify permitted uses and development standards for areas so designated on Exhibit A, Bembridge ESC CFPUD Master Plan. 3.2 GENERAL DESCRIPTION The CFPUD and RPUD provides for a maximum of 7,000 square feet of building area for permitted and accessory emergency operations uses, limited to an EMS use, as well as the existing Calusa Park Elementary School and a residential area, on 39.82± acres. Ancillary uses, such as HVAC and radio tower equipment areas, do not count towards this building area allocation. 3.3 PERMITTED USES AND STRUCTURES No building or structure, or part thereof, shall be erected, altered or used, or land used, in whole or part, for other than the following: A. Permitted Principal Uses and Structures: 1. Educational plants (Tract "C") 2. Emergency medical services (Tract "A") 3. Residential units that are one-family and two-family dwellings, townhouse dwellings, garden apartment dwellings, and multi-family dwellings limited to 6 16 units per acre on Tract "A-1" only 4. Essential Services, inclusive of a Master County Pump Station (Tract “A-1”) B. Uses Accessory to Permitted Uses: 1. Accessory uses and structures customarily associated with the principal uses including carports, garages, and utility buildings for residential uses within Tract A-1. 2. Residential and commercial uses of an accessory nature which are incidental and customarily associated with support of a principal use. 3. Accessories for residential use such as recreational uses and facilities including swimming pools, tennis courts, children's playground areas, tot lots, walking paths, picnic areas, recreation buildings/clubhouses, and basketball/shuffle board courts for residential uses within Tract A-1. 4. Temporary use of the site for public purposes in accordance with Section 10.02.06.G. the LDC. 5. Parking facilities (Tract “A”, Tract “A-1” and “C”). 6. HVAC plants and other like facilities (Tract “A”, Tract “A-1” and “C”). 7. Major maintenance and service facilities (Tract “A”, Tract “A-1” and “C”) 9 9.A.5.d Packet Pg. 1307 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 3.4 COMMUNITY FACILITIES DEVELOPMENT STANDARDS A. Minimum Lot Area: None required. B. Minimum Lot Width: None required. C. Minimum Yards: 1. Principal and Accessory Structures a. Perimeter of CFPUD Fifty (50) feet or ½ the building height, abutting residentially whichever is greater. zoned property b. Perimeter of CFPUD Twenty-five (25) feet or ½ the building height, abutting non residentially whichever is greater. zoned property. c. Waterfront Zero (0) feet to bulkhead or rip-rap at top or of Bank, otherwise 20 feet. D. Distance Between Principal Structures on the Same Parcel: A minimum 15 feet or one-half sum of the building heights as measured by the closest exterior building walls, whichever is greater. E. Distance Between Accessory Structures on the Same Parcel: A minimum of 10 feet between detached accessory structures and between accessory structures and principal structures. F. Maximum Building Height 1. Principal buildings shall not exceed 40 feet in height nor 3 stories, whichever is less. 2. Accessory structures shall not exceed 30 feet in height. 10 9.A.5.d Packet Pg. 1308 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 3.5 RESIDENTIAL USE DEVELOPMENT STANDARDS A. Minimum Yards: 1. Yards along Santa Barbara Boulevard: Seventy (70) Fifty (50) feet for one (1) and two (2) story structures and one hundred fifty (150) feet for three story structures. 2. Yards from on-site lakes: twenty (20) feet 3. Yards for internal tracts (principal structures): Front - 30 feet or half the building height Side / Rear – 20 feet 4. Yards for internal tracts (accessory structures): Front - 10 feet Side/Rear - 5 feet B. Minimum Floor Area (residential units): 1. One bedroom units - six hundred (600) square feet. 2. Two bedroom units - eight hundred fifty (850) square feet. 3. Three bedroom units - eleven hundred (1100) square feet. 4. Four bedroom units - one thousand three hundred fifty (1350) square feet. C. Distance Between Principal Structures: 1. Between one (1) story structures - Ten (10) feet. 2. Between one (1) story and two (2) story structures - Fifteen (15) feet. 3. Between one (1) story and three (3) story structures - Twenty (20) feet. 4. Between two (2) story structures - Twenty (20) feet. 5. Between two (2) story and three (3) story structures - Twenty-five (25) feet. 6. Between three (3) story structures - thirty (30) feet. 7. Principal to accessory structures – ten (10) feet. D. Maximum Building Height: 1. Principal buildings shall not exceed 40 feet in height or 3 stories, whichever is less. 2. Accessory structures shall not exceed the height restrictions of the LDC. 3.6 PROVISIONS FOR OFF-SITE REMOVAL OF EARTHEN MATERIAL The excavation and stockpiling of earthen material in preparation of water management facilities or to otherwise develop water bodies is hereby permitted. Off-site disposal is also hereby permitted subject to the following conditions: A. Excavation activities shall comply with "clear and fill” application requirements pursuant to Subsection 4.06.04.A.1.a.iii of the LDC. Off-site removal shall be limited to 10% of the total 11 9.A.5.d Packet Pg. 1309 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 volume excavated, but not to exceed 20,000 cubic yards as set forth in the Collier County Code of Laws and Ordinances. B. All other provisions of the Collier County Code of Laws and Ordinances, shall apply. 3.7 LANDSCAPE BUFFERS, BERMS, FENCES, AND WALLS The following standards shall apply: A. Landscape berms shall have the following maximum side slopes: 1. Grassed berms 4:1 2. Ground cover berms Perimeter 3:1 Internal to project 3:1 3. Structural walled berms-vertical B. Landscape buffers, berms, gates, fences and walls may be constructed within the landscape buffer tract along the perimeter of the Bembridge ESC CFPUD boundary prior to preliminary subdivision plat and site development plan submittal. Sidewalks shall meet the requirements of Section 4.06.02.D.4 of the LDC. Landscape and irrigation plans shall be submitted to Collier County Community Development and Environmental Services (CDES) for approval prior to construction. C. Pedestrian sidewalks and/or bike paths, water management systems, drainage structures, and utilities may be allowed in landscape buffers as permitted by Section 4.06.02.D.4. of the LDC. D. A 15’ Type “D” buffer shall be provided along Santa Barbara Boulevard for the portion of Tract “A-1” that is developed with residential uses. 3.8 DESIGN GUIDELINES AND STANDARDS The Bembridge ESC CFPUD is intended to encourage ingenuity, innovation and imagination in the planning, design and development or redevelopment of relatively large tracts of land as set forth in Section 2.03.06. of the LDC. 3.9 GENERAL PERMITTED USES Certain uses shall be considered general permitted uses throughout the Bembridge ESC CFPUD. General permitted uses are those uses which generally serve the facilities. A. General Permitted Uses: 1. Essential services as set forth under Section 2.01.03 of the LDC. 2. Water management facilities and related structures. 3. Lakes, including lakes with bulkheads or other architectural or structural bank treatments. 4. Guardhouses, gatehouses, and access control structures. 12 9.A.5.d Packet Pg. 1310 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 5. Temporary construction and administrative offices for authorized contractors and consultants, including necessary access ways, parking areas and related uses. 3.10 SIGNAGE All signs shall be in accordance with Section 5.06.00 of the LDC with the exclusion of signs for Calusa Park Elementary School which are subject to the provisions of Section 10.02.03.A.3.a. and b. of the Collier County LDC and the Interlocal Agreement of May 2003. Two entry signs for the Calusa Park Elementary School shall be permitted, if one is a marquee sign (see 4.13.F 4.12.1). 3.11 SIDEWALKS/BIKEPATHS A. Pursuant to Section 6.06.02 of the LDC and Section 3.6 and 4.9 of the Bembridge ESC CFPUD, sidewalks/bikepaths shall be permitted as follows: 1. An internal sidewalk shall be permitted within drainage easements. 2. Sidewalks may be located outside platted rights-of-way when located within a separate sidewalk easement. 3. Sidewalks may be located within landscape buffers and/or easements. 13 9.A.5.d Packet Pg. 1311 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 SECTION IV GENERAL DEVELOPMENT COMMITMENTS 4.1 PURPOSE The purpose of this Section is to set forth the development commitments for the Bembridge Emergency Services Complex CFPUD. 4.2 GENERAL All facilities shall be constructed in strict accordance with final site development plans and all applicable State and local laws, codes, and regulations applicable to this CFPUD in effect at the time of site plan submittal with the exclusion of Calusa Park Elementary School which is subject to the requirements in Section 10.02.03.A.3.a. and b. of the LDC and the lnterlocal Agreement of May 2003. Except where specifically noted or stated otherwise, the standards and specifications of Chapter 4 of the LDC shall apply to this project. The developer, its successor and assigns, shall be responsible for the commitments outlined in this Document. The developer, its successor or assignee, shall follow the Master Plan and the regulations of the CFPUD as adopted, and any other conditions or modifications as may be agreed to in the rezoning of the property. In addition, any successor or assignee in title to the developer, is bound by the commitments within this Document. Issuance of a development permit by a county does not in any way create any rights on the part of the applicant to obtain a permit from a state or federal agency and does not create any liability on the part of the county for issuance of the permit if the applicant fails to obtain requisite approvals or fulfill the obligations imposed by a state or federal agency or undertakes actions that result in a violation of state or federal law.” (Section 125.022, FS) 4.3 CFPUD MASTER PLAN A. The Bembridge ESC CFPUD Master Plan (Exhibit A) is an illustration of the conceptual development plan. Tracts and boundaries shown on the plan are conceptual and shall not be considered final. Actual tract boundaries shall be determined at the time of site development plan approval. B. All necessary easements, dedications, or other instruments shall be granted to insure the continued operation and maintenance of all service utilities and all common areas in the project. 4.4 SCHEDULE OF DEVELOPMENT/MONITORING REPORT AND SUNSET PROVISION A. Sunsetting. The Bembridge ESC CFPUD shall be subject to the sunset provisions of Section 10.02.13.D of the LDC, as amended. B. Monitoring Report: An annual PUD monitoring report shall be submitted pursuant to Section 10.02.13.F of the LDC. 14 9.A.5.d Packet Pg. 1312 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 A. One entity (hereinafter the Managing Entity) shall be responsible for PUD monitoring until close-out of the PUD, and this entity shall also be responsible for satisfying all PUD commitments until close-out of the PUD. At the time of this PUD approval, the Managing Entity is Collier County. Should the Managing Entity desire to transfer the monitoring and commitments to a successor entity, then it must provide a copy of a legally binding document that needs to be approved for legal sufficiency by the County Attorney. After such approval, the Managing Entity will be released of their/its obligations upon written approval of the transfer by County staff, and the successor entity shall become the Managing Entity. As Owner and Developer sell off tracts, the Managing Entity shall provide written notice to County that includes an acknowledgement of the commitments required by the PUD by the new owner and the new owner’s agreement to comply with the Commitments through the Managing Entity, but the Managing Entity shall not be relieved of its responsibility under this Section. When the PUD is closed-out, then the Managing Entity is no longer responsible for the monitoring and fulfillment of PUD commitments. 4.5 ENGINEERING A. All project development shall be consistent with the LDC. 4.6 UTILITIES A. Water distribution, sewage collection, and transmission systems shall be constructed throughout the project by the developer. Potable water and sanitary sewer facilities constructed within platted rights-of-way or within dedicated County utility easements shall be conveyed to Collier County, pursuant to Collier County Ordinance 04-31, as may be amended. B. Upon completion of the utility facilities, the facilities shall be tested to insure they meet Collier County utility construction requirements in effect at the time construction plans are approved. 4.7 WATER MANAGEMENT A. A SFWMD surface water management permit shall be obtained prior to approval of the site development plan. B. An excavation permit shall be required for the proposed lakes in accordance with the Collier County Code of Laws and Ordinances. All lake dimensions shall be approved at the time of excavation permit approval. 4.8 ENVIRONMENTAL A. A minimum of sixty (60) thirty (30) percent open space of the PUD’s gross area of the portion of the site that is developed for residential purposes, as described in Section 4.02.01.B.2. of the LDC, shall be provided. 15 9.A.5.d Packet Pg. 1313 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 B. An exotic vegetation removal, monitoring and maintenance plan for the site, with emphasis on the preserve/open space areas, shall be submitted to the Department of Environmental Services Staff for review and approval prior to final site plan/construction plan approval. C. This CFPUD shall be consistent with the Environmental Sections of the Collier County GMP and the Collier County LDC in effect at the time of final development order approval. D. Environmental permitting shall be in accordance with the State of Florida Environmental Resource· Permit Rules and be subject to review and approval by the Environmental Services Review Staff. Removal of exotic vegetation shall not be counted towards mitigation for impacts to Collier County jurisdictional wetlands. E. All approved agency (SFWMD, ACOE, FPWCC) permits shall be submitted prior to final plan/construction plan approval. F. The preservation requirement for Tract “A-1” shall be 15% of the existing native vegetation on-site and can be provided off-site per LDC Section 3.05.07 H.f.iii. (0.82-acres x 15% = 0.12- acres required) 4.9 TRANSPORTATION A. All traffic control devices, signs, pavement markings and design criteria shall be in accordance with Florida Department of Transportation (FDOT) Manual of Uniform Minimum Standards ( MUMS), current edition, FDOT Design Standards, current edition, and the Manual On Uniform Traffic Control Devices MUTCD), current edition. All other improvements shall meet the requirements of the Collier County LDC. B. Arterial level street lighting shall be provided at all access points. Access lighting shall be in place prior to the issuance of the first certificate of occupancy (CO). C. All work within Collier County rights-of-way or public easements shall require a rights-of-way permit. D. The development shall be designed to promote the safe travel of all roadway users including bicyclists and shall provide for the safety of pedestrians crossing said roadways. Sidewalks shall be separated from vehicular traffic in accordance with recognized standards and safe practices, as determined by Collier County Transportation Services Staff. A. The maximum total daily trip generation for ‘Tract A-1 Residential’ shall not exceed 50 two- way PM peak hour net trips based on the use codes in the ITE Manual on trip generation rates in effect at the time of application for SDP/SDPA or subdivision plat approval.” 16 9.A.5.d Packet Pg. 1314 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-20200000564 October 12, 2020 4.10 ACCESSORY STRUCTURES Accessory structures shall be constructed simultaneously with or following the construction of the principal structure, except for a construction site administrative office. 4.1211 LANDSCAPING FOR OFF-STREET PARKING AREAS All landscaping for off-street parking areas shall be in accordance with Section 4.06.00 of the LDC in effect at time of building permit application. 4.1312 DEVIATIONS FROM LAND DEVELOPMENT CODE A. Deviation withdrawn B. Deviation withdrawn C. Deviation withdrawn D. Deviation withdrawn E. Deviation withdrawn F. 1. Subsection 5.06.00 the LDC – Signs Deviation from Subsection 5.06.06.C.1 of the LDC, which limits the number of signs to one ground sign or one pole sign. Calusa Park Elementary School shall be permitted two entry signs with one being a marquee sign. G. Deviation withdrawn 2. Deviation #2 seeks relief from LDC section 4.06.02 C.4., “Type D Landscape Buffer,” which requires a 20-foot Type “D” landscape buffer along rights-of-way for developments of 15 acres or more, to instead allow a 15-foot wide Type “D” buffer on Tracts “A” and “A-1- Residential” along Santa Barbara Boulevard. 3. Deviation #3 seeks relief from LDC Section 4.06.02 C., “Landscape Buffers,” which requires a 15’ Type ‘B’ buffer between multi-family residential and a community facility, to instead allow a 7’ Type ‘B’ buffer along the eastern property line of Tract “A-1-Residential”. 4. Deviation #4 seeks relief from LDC Section 4.05.04. G., “Parking Space Requirements,” which requires parking spaces for offices/clubhouses to be parked at 50% normal requirements and accessory recreational facilities for multi-family projects, to instead require a total of four (4) parking spaces for the office/clubhouse and no additional parking spaces for the accessory recreational facilities on Tract “A-1”. 5. Deviation #5 seeks relief from LDC Section 4.06.02. C.4., “Type D Landscape Buffer,” which requires a 20-foot Type ’D’ landscape buffer along rights-of-way for developments of 15 acres or more, to instead allow a 10-foot wide Type ‘D’ buffer along Santa Barbara Boulevard and along the Roadway Easement for Tract B. 6. Deviation #6 seeks relief from LDC Section 4.05.02 Exhibit ‘A’, “Off-Street Parking Design Standards,” which permits a 2’ vehicular overhang into any landscape buffer that is 10’ or greater in width, to instead allow vehicular overhang into the 7’ Type ‘B’ buffer along the eastern boundary of Tract “A-1-Residential”. 4.13 AFFORDABLE HOUSING A. As documented in the Affordable Housing Density Bonus Agreement, the Developer has agreed to construct 13 rental units for residents in or below the very low income category (50% or less of the County median income), 50 rental units for residents in the low income category (51 to 60% of the County median income) and 19 rental units for residents in the low to moderate income category (61 to 80% of the County median income). 17 9.A.5.d Packet Pg. 1315 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) ZONING: SHOPPES ATSANTA BARBARA PUDLAND USE: VACANT COMMERCIAL"TRACT B"EXISTING LAKE"TRACT C"CALUSA PARK ELEMENTARY SCHOOL"TRACTA-1"COUNTYPUMPSTATION15' TYPE "D" LANDSCAPE BUFFERZONING: NEW HOPE MPUDLAND USE: RESIDENTIALZONING: BERKSHIRE LAKES PUDLAND USE: GOLF COURSE/RESIDENTIAL"TRACT A"EMS STATIONZONING: SANTA BARBARALANDINGS RPUDLAND USE: PRESERVEZONING: PLANTATION PUDLAND USE: RESIDENTIAL15' TYPE "B" LANDSCAPE BUFFER15' TYPE "B" LANDSCAPE BUFFERZONING: WILDWOOD ESTATES PUDLAND USE: RESIDENTIAL15' TYPE "B" LANDSCAPE BUFFERPEDESTRIAN INTERCONNECTPEDESTRIAN INTERCONNECTRIGHT-IN / RIGHT-OUTPARCELBOUNDARYPARCELBOUNDARYPUDBOUNDARYPUDBOUNDARYPUDBOUNDARYROADWAYEASEMENTO.R. BOOK 1701,PAGE 600-6010.12 ACRE PRESERVE"TRACT A-1"RESIDENTIAL10' TYPE "D" LANDSCAPE BUFFER10' TYPE "D" LANDSCAPE BUFFER15' TYPE "D" LANDSCAPE BUFFER14325564365 Radio Road, Suite 201Naples, Florida 34104P: 239.434.6060Company Cert. of AuthorizationNo. 00009496NBEMBRIDGE EMERGENCYSERVICES COMPLEXCFPUD AND RPUDEXHIBIT A: PUD MASTER PLANPAGE 1 OF 2REVISIONS1. REV. PER CC RAI COMMENTS - 7/13/20202. REV. PER CC RAI COMMENTS - 8/24/20203. REV. PER CC RAI COMMENTS - 10/12/2020 1 9.A.5.d Packet Pg. 1316 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 4365 Radio Road, Suite 201Naples, Florida 34104P: 239.434.6060Company Cert. of AuthorizationNo. 00009496CURRENT ZONING: BEMBRIDGE EMERGENCY SERVICES COMPLEXCFPUD AND RPUDPROPOSED ZONING: BEMBRIDGE EMERGENCY SERVICES COMPLEXCFPUD AND RPUDCURRENT LAND USE: COMMUNITY FACILITIES/ESSENTIALSERVICES/WATER MANAGEMENTPROPOSED LAND USE: COMMUNITY FACILITIES/ESSENTIALSERVICES/WATER MANAGEMENT/RESIDENTIALFUTURE LAND USE: URBAN RESIDENTIAL SUBDISTRICTPLANNING NOTES:OPEN SPACE SUMMARYREQUIRED OPEN SPACE (39.82 AC X 30% = 11.95 AC)xOPEN SPACE TO BE DETERMINED AT TIME OF SDP PERMITTING.DEVIATIONS1.SUBSECTION 5.06.00 THE LDC - SIGNS DEVIATION FROM SUBSECTION 5.06.06.C.1 OFTHE LDC, WHICH LIMITS THE NUMBER OF SIGNS TO ONE GROUND SIGN OR ONE POLESIGN. CALUSA PARK ELEMENTARY SCHOOL SHALL BE PERMITTED TWO ENTRY SIGNSWITH ONE BEING A MARQUEE SIGN.2.DEVIATION #2 SEEKS RELIEF FROM LDC SECTION 4.06.02 C.4., “TYPE D LANDSCAPEBUFFER,” WHICH REQUIRES A 20-FOOT TYPE “D” LANDSCAPE BUFFER ALONGRIGHTS-OF-WAY FOR DEVELOPMENTS OF 15 ACRES OR MORE, TO INSTEAD ALLOW A15-FOOT WIDE TYPE “D” BUFFER ON TRACTS “A” AND “A-1-RESIDENTIAL” ALONGSANTA BARBARA BOULEVARD.3.DEVIATION #3 SEEKS RELIEF FROM LDC SECTION 4.06.02 C.2., “TYPE B LANDSCAPEBUFFER,” WHICH REQUIRES A 15' TYPE 'B' BUFFER BETWEEN MULTI-FAMILYRESIDENTIAL AND A COMMUNITY FACILITY, TO INSTEAD ALLOW A 7' TYPE 'B' BUFFERALONG THE EASTERN PROPERTY LINE OF TRACT “A-1-RESIDENTIAL”.4.DEVIATION #4 SEEKS RELIEF FROM LDC SECTION 4.05.04. G., “PARKING SPACEREQUIREMENTS,” WHICH REQUIRES PARKING SPACES FOR OFFICES/CLUBHOUSES TO BEPARKED AT 50% NORMAL REQUIREMENTS AND ACCESSORY RECREATIONAL FACILITIESFOR MULTI-FAMILY PROJECTS, TO INSTEAD REQUIRE A TOTAL OF FOUR (4) PARKINGSPACES FOR THE OFFICE/CLUBHOUSE AND NO ADDITIONAL PARKING SPACES FOR THEACCESSORY RECREATIONAL FACILITIES ON TRACT “A-1”.5.DEVIATION #5 SEEKS RELIEF FROM LDC SECTION 4.06.02. C.4., “TYPE D LANDSCAPEBUFFER,” WHICH REQUIRES A 20-FOOT TYPE 'D' LANDSCAPE BUFFER ALONGRIGHTS-OF-WAY FOR DEVELOPMENTS OF 15 ACRES OR MORE, TO INSTEAD ALLOW A10-FOOT WIDE TYPE 'D' BUFFER ALONG SANTA BARBARA BOULEVARD AND ALONG THEROADWAY EASEMENT FOR TRACT B.6.DEVIATION #6 SEEKS RELIEF FROM LDC SECTION 4.05.02 EXHIBIT 'A', “OFF-STREETPARKING DESIGN STANDARDS,” WHICH PERMITS A 2' VEHICULAR OVERHANG INTO ANYLANDSCAPE BUFFER THAT IS 10' OR GREATER IN WIDTH, TO INSTEAD ALLOWVEHICULAR OVERHANG INTO THE 7' TYPE 'B' BUFFER ALONG THE EASTERN BOUNDARYOF TRACT “A-1-RESIDENTIAL”.TRACT A (EMS STATION): 7,000 SF FOR PRINCIPAL STRUCTURETRACT A-1 (RESIDENTIAL): 82 RESIDENTIAL UNITSNOTE: REMAINING TRACTS ARE NOT SUBJECT TO A MAXIMUM DEVELOPMENT INTENSITYMAXIMUM DEVELOPMENT INTENSITY:15% OF EXISTING NATIVE VEGETATION = 0.15 * 0.82 AC = 0.12 ACPER LDC SECTION 3.05.07 H.f.iii., PRESERVE REQUIREMENT MAY BE PROVIDED OFF-SITE.PRESERVE CALCULATION (TRACT 'A-1'):BEMBRIDGE EMERGENCYSERVICES COMPLEXCFPUD AND RPUDEXHIBIT A: PUD MASTER PLANPAGE 2 OF 2REVISIONS1. REV. PER CC RAI COMMENTS - 7/13/20202. REV. PER CC RAI COMMENTS - 8/24/20203. REV. PER CC RAI COMMENTS - 10/12/2020 1 9.A.5.d Packet Pg. 1317 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 1 of 26 This space for recording AGREEMENT AUTHORIZING AFFORDABLE HOUSING DENSITY BONUS AND IMPOSING COVENANTS AND RESTRICTIONS ON REAL PROPERTY THIS AGREEMENT is made as of the day of , 2020, by and between McDowell Housing Partners, LLC (the "Developer") and the Collier County Board of County Commissioners (the "Commission"), collectively, the "Parties". RECITALS: A. The Developer is the contract purchaser of a tract of real property described in Exhibit "A" attached hereto and incorporated herein (The "Property"). It is the Developer's intent to construct a maximum of 82 residential units (the "Units") at a density of 16 units per gross acre on the Property. The gross acreage of Property is 5.1 acres. The number of affordable Units constructed by Developer shall be 82, representing 100% percent of the total number of residential Units approved in the development. B. In order to construct the Units, the Developer must obtain a density bonus from the Commission for the Property as provided for in the Collier County Affordable 9.A.5.d Packet Pg. 1318 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 2 of 26 Housing Density Bonus Ordinance No. 90-89, now codified by Ordinance 04-41, as Land Development Code (LDC) § 2.06.00 et seq., which density bonus can only be granted by the Commission and utilized by the Developer in accordance with the strict limitations and applicability of said provisions. C. The Commission is willing to grant a density bonus to the Developer authorizing the construction of 61.32 bonus Units on the Property, if the Developer agrees to construct affordable Units as specified in this Agreement. NOW, THEREFORE, in consideration of the approval and grant of the density bonus of 12 units per acre requested by the Developer and the benefits conferred thereby on the Property, and for other good and valuable consideration, the receipt and sufficiency of which are hereby acknowledged, the Developer and the Commission hereby covenant and agree as follows: 1. Recitals. The above Recitals are true and correct and are incorporated herein by reference. 2. Developer Agreements. The Developer hereby agrees that he shall construct 82 affordable Units which Units shall be sold or rented in accordance with the terms and conditions of this Agreement and as specified by the attached Appendices A & B, Exhibits A, B, and C, and Appendix C, and attached hereto. a. The following provisions shall be applicable to the affordable Units: (1) Defined terms: In the event of a conflict between terms as defined in the LDC or in Ordinance No. 90-89, Section 4, the definitions of the LDC will control when applying or interpreting this Agreement. In addition to these defined terms and the applicability of LDC § 2.06.04 "Phasing" shall mean: (a) the phased construction of buildings or structures in separate and distinct stages as shown on a PUD master plan, subdivision master plan or site development plan; or (b) in developments where phased construction is not depicted on a PUD master plan, subdivision master plan or site development plan, the construction of buildings or structures in a clearly defined series 9.A.5.d Packet Pg. 1319 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 3 of 26 of starts and finishes that are separate and distinct within the development. (2) Median Income. For the purposes of this Agreement, the median income of the area as defined by the U.S. Department of Housing and Urban Development (HUD) shall be the then current median income for the Naples Metropolitan Statistical Area, established periodically by HUD and published in the Federal Register, as adjusted for family size as shown on the tables attached hereto as Appendix A, Exhibit C, which Exhibit shall be adjusted from time to time in accordance with any adjustments that are authorized by HUD or any successor agency. In the event that HUD ceases to publish an established median income as aforesaid, the Parties hereto shall mutually agree to another reasonable and comparable method of computing adjustments in median income. (3) Eligibility and Qualification of Owner/Renter. Family income eligibility is a three-step process: 1) submittal of an application by a prospective Owner/Renter; 2) verification of family housing unit provided under the affordable density bonus program prior to being qualified at the appropriate level of income (low or moderate income) in accordance with this Section; 3) certification of eligible Owner/Renter by the Community and Human Services Division. The Developer shall be responsible for qualifying Owners/Renters by accepting applications, verifying income and obtaining income certification for all affordable units in the subject development. All applications, forms and other documentation required by this Agreement shall be provided to Community and Human Services Division. Qualification by the Developer of any persons as an eligible Owner/Renter family shall be subject to review and approval in accordance with the monitoring and enforcement program in LDC§§ 2.06.05 and 2.06.06, respectively. (a) Application. A potential owner/renter shall apply to the developer, owner, manager, or agent to qualify as a low or very low income family for the purpose of owning/renting and occupying an affordable housing unit pursuant to the affordable 9.A.5.d Packet Pg. 1320 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 4 of 26 housing density bonus program. The Preliminary Application for affordable housing unit shall be provided by Collier County Community and Human Services Division as shown in Appendix B, Exhibit A, attached to this Agreement and incorporated by reference herein. (b) Income Verification and Certification. No affordable housing unit in the development shall be sold/rented whose household income has not been verified and certified in accordance with this Agreement and LDC§ 2.06.05. (c) Income Verification. The Developer shall obtain written verification from the potential occupant (including the entire household) to verify all regular sources of income (including the entire household). The most recent year's federal income tax return for the potential occupants (including the entire household) may be used for the purpose of income verification, attached to the Affordable Housing Applicant Income Verification form, including a statement to release information, occupant verification of the return, and a signature block with the date of application. The verification shall be valid for up to one hundred eighty (180) days prior to occupancy. Upon expiration of the 180-day period, the information may be verbally updated from the original sources for an additional 30 days, provided it has been documented by the person preparing the original verification. After this time, a new verification form must be completed. The Affordable Housing Applicant Income Verification form shall be provided to the Community and Human Services Division as shown in Appendix B, Exhibit B, attached to this Agreement and incorporated by reference herein. (d) Income Certification. Upon receipt of the Preliminary Application for an affordable housing unit and Applicant Income Verification form, the Developer shall require that an income certification form be executed by the potential occupant (including the entire household) prior to occupancy of the affordable housing unit by the occupant. Income certification shall assure that the potential occupant has an appropriate household income which qualifies the potential occupant as eligible to 9.A.5.d Packet Pg. 1321 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 5 of 26 occupy an affordable housing unit under the affordable housing density bonus program. The Affordable Housing Applicant Income Certification form shall be provided by the Community and Human Services Division as shown in Appendix B, Exhibit C, is attached to this Agreement and is incorporated by reference herein. Random inspection of files containing required documentation to verify occupancy in accordance with this Agreement and LDC § 2.06.00, may be conducted by the Community and Human Services Division upon reasonable notice. (4) Annual Progress and Monitoring Report. The Developer shall provide the Community and Human Services Division an annual progress and monitoring report regarding the delivery of affordable housing units throughout the period of their construction and occupancy. The annual progress and monitoring report shall, at a minimum, provide any information reasonably required to insure compliance with LDC § 2.06.00, or subsequent amendments thereto. The report shall be filed on or before September 30 of each year and the report shall be submitted by the Developer to the Community and Human Services Division. Failure to complete and submit the monitoring report to the Community and Human Services Division within sixty (60) days from the due date shall result in a penalty of up to fifty dollars ($50.00) per day unless a written extension not to exceed thirty (30) days is requested prior to expiration of the sixty (60) day submission deadline. No more than one such extension may be granted in a single year. (5) Occupancy Restrictions. No affordable unit in any building or structure on the Property shall be occupied by the Developer, any person related to or affiliated with the Developer, or by a resident manager. 3. Density Bonus. The Commission hereby acknowledges that the Developer has met all required conditions to qualify for a density bonus, in addition to the base residential density of 4 units per acre, and is therefore granted a density bonus of 12 density bonus units per acre, for a total density (total = density bonus units per acre X 9.A.5.d Packet Pg. 1322 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 6 of 26 gross acreage) of 16 units/ac, pursuant to LDC § 2.06.00 The Commission further agrees that the Developer may construct thereon, in the aggregate a maximum number of 82 units on the Property provided the Developer is able to secure building permit(s) from Collier County. 4. Commission Agreement. During the term of this Agreement, the Commission acting through the Community and Human Services Division or its successor(s) covenants and agrees to prepare and make available to the Developer any general information that it possesses regarding income limitations and restrictions which are applicable to the affordable Unit. 5. Violations and Enforcement a. Violations. It shall be a violation of this Agreement and LDC § 2.06.00 to sell or occupy, or attempt to sell or occupy, an affordable housing unit provided under the affordable housing density bonus program except as specifically permitted by the terms of this Agreement; or to knowingly give false or misleading information with respect to any information required or requested by the Community and Human Services Division or by any other persons pursuant to the authority which is delegated to them by LDC § 2.06.00. Collier County or its designee shall have full power to enforce the terms of this Agreement. The method of enforcement for a breach or violation of this Agreement shall be at the option of the Commission by criminal enforcement pursuant to the provisions of Section 125.69, Florida Statutes, or by civil enforcement as allowed by law. b. Notice of Violation for Code Enforcement Board Proceedings. Whenever it is determined that there is a violation of this Agreement or of LDC § 2.06.00, that should be enforced before the Code Enforcement Board, then a Notice of Violation shall be issued and sent by the appropriate department by certified return- receipt requested U.S. Mail, or hand-delivery to the person or developer in violation. The Notice of Violation shall comply with the requirements for such Notices. 9.A.5.d Packet Pg. 1323 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 7 of 26 c. Certificate of Occupancy. In the event that the Developer fails to maintain the affordable units in accordance with this Agreement or LDC § 2.06.00, as amended, at the option of the Commission, building permits or certificates of occupancy, as applicable, may be withheld for any future planned or otherwise approved unit located or to be located upon the Property until the entire project is in full compliance with this Agreement and with LDC§ 2.06.00, as amended. 6. Assignment by Commission. The Commission may assign all or part of its obligations under this Agreement to any other public agency having jurisdiction over the Property provided that it gives the Developer thirty (30) days advance written notice thereof. The Developer may not assign, delegate or otherwise transfer all or part of its duties, obligations, or promises under this Agreement to any successor in interest to the Property without the express written consent of the Commission , which consent may be withheld for any reason whatsoever. Any attempt to assign the duties, obligations, or promises under this Agreement to any successor in interest to the Property without the express written consent of the Commission as required by this Section shall be void ab initio. 7. Severability. If any section, phrase, sentence or portion of this Agreement is for any reason held invalid or unconstitutional by any court of competent jurisdiction, such portion shall be deemed a separate, distinct, and independent provision, and all other provisions shall remain effective and binding on the Parties. 8. Notice. Any notices desired or required to be given under this Agreement shall be in writing and shall either be personally delivered or shall be sent by mail, postage prepaid, to the Parties at the following addresses: 9.A.5.d Packet Pg. 1324 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 8 of 26 To the Commission: To the Developer: Collier County Community and Human Services 3339 E Tamiami Trail Building H, Suite 211 Naples, Florida 34112 McDowell Housing Partners, LLC 601Brickell Key Drive, Suite 700 Miami, FL 33131 Any Party may change the address to which notices are to be sent by notifying the other Party of such new address in the manner set forth above. 9. Authority to Monitor. The Parties hereto acknowledge that the Collier County Community and Human Services Division or its designee, shall have the authority to monitor and enforce the Developer's obligations hereunder. 10. Indemnify. The Developer hereby agrees to protect, defend, indemnify and hold Collier County and its officers, employees, and agents harmless from and against any and all claims, penalties, damages, losses and expenses, professional fees, including, without limitation, reasonable attorney's fees and all costs of litigation and judgments arising out of any claim, willful misconduct or negligent act, error or omission, or liability of any kind made by Developer, its agents or employees, arising out of or incidental to the performance of this Agreement. 11. Covenants. The Developer agrees that all of its obligations hereunder shall constitute covenants, restrictions, and conditions which shall run with the land and shall be binding upon the Property and against every person then having any ownership interest at any time and from time to time until this Agreement is terminated in accordance with Section 14 below. However, the Parties agree that if Developer transfers or conveys the Property to another person or entity, Developer shall have no further obligation hereunder and any person seeking to enforce the terms hereof shall 9.A.5.d Packet Pg. 1325 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 9 of 26 look solely to Developer's successor in interest for the performance of said obligations. 12. Recording. This Agreement shall be recorded at County's expense in the official records of Collier County, Florida. 13. Entire Agreement. The Parties hereto agree that this Agreement constitutes the entire Agreement between the Parties hereto and shall inure to and be binding upon their respective heirs, successors, and assigns. 14. Termination. Each affordable housing unit shall be restricted to remain and be maintained as the required affordable housing as provided in the LDC §2.06.04. 15. Modification. This Agreement shall be modified or amended only by the written agreement of both Parties. 16. Discrimination. a. The Developer agrees that neither it nor its agents shall discriminate against any owner/renters or potential owner/renters because of said owners/renters race, color, religion, sex, national origin, familial status, or handicap. b. When the Developer advertises, sells or maintains the affordable housing unit, it must advertise sell, and maintain the same in a non-discriminatory manner and shall make available any relevant information to any person who is interested in purchasing such affordable housing unit. c. The Developer agrees to be responsible for payment of any real estate commissions and fees for which it is liable in the purchase and sale of affordable units. d. The affordable housing units shall be intermixed with, and not segregated from, the market rate dwelling units in the development. e. The square footage, construction and design of the affordable, and gap housing units shall be the same as market rate dwelling units in the development. All physical amenities in the dwelling units, as described in item number seven (7) of the Developer Application for Affordable Housing Density Bonus, Appendix C, shall be the 9.A.5.d Packet Pg. 1326 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 10 of 26 same for market rate units and affordable units. For developments where construction takes place in more than one phase, all physical amenities as described in item number seven (7) of the Developer Application for Affordable Housing Density Bonus, Appendix C, shall be the same in both the market rate units and the affordable units in each phase. Units in a subsequent phase may contain different amenities than units in a previous phase so long as the amenities for market rate units and affordable units are the same within each phase and provided that in no event may a market rate unit or affordable unit in any phase contain physical amenities less than those described in the Developer Application. 17. Phasing. The percentage of affordable housing units to which the Developer has committed for the total development shall be maintained in each phase and shall be constructed as part of each phase of the development on the Property. Developer commits to 100% percent affordable housing units for this project, with 100% percent of the units in each phase consisting of affordable units. 18. Disclosure. The developer shall not disclose to persons, other than the potential buyer, renter, or lender of the particular affordable housing unit or units, which units in the development are designated as affordable housing units. 19. Consistency. This Agreement and authorized development shall be consistent with the Growth Management Plan and land development regulations of Collier County that are in effect at the time of development. Subsequently adopted laws and policies shall apply to this Agreement and to the development to the extent that they are not in conflict with the number, type of affordable housing units and the amount of affordable housing density bonus approved for the development. 20. Affordable Housing Density Bonus Development Agreement. This Agreement is a distinct and separate agreement from "development agreements" as defined by Section 163.3220, Fla. Stat., as amended. 21. Preapplication. Developer has executed and submitted to the 9.A.5.d Packet Pg. 1327 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 11 of 26 Development Services Department the Developer Application for Affordable Housing Density Bonus, a copy of which is attached to this Agreement as Appendix C and incorporated by reference herein. 22. Governing Law. This Agreement shall be governed by and construed in accordance with the laws of the State of Florida. 23. Further Assurances. The Parties hereto shall execute and deliver, in recordable form if necessary, any and all documents, certificates, instruments, and agreements which may be reasonably required in order to effectuate the intent of the Agreement. Such documents shall include but not be limited to any document requested by the Developer to exhibit that this Agreement has terminated in accordance with the provisions of paragraph 14 above. IN WITNESS WHEREOF, the Parties hereto have caused this Agreement to be executed as of the day and year first above written. ATTEST: CRYSTAL K. KINZEL, Clerk BOARD OF COUNTY COMMISSIONERS COLLIER COUNTY, FLORIDA , DEPUTY CLERK By: BURT L. SAUNDERS , CHAIRMAN Approved as to form and legality: Jennifer A. Belpedio, Assistant County Attorney 9.A.5.d Packet Pg. 1328 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 12 of 26 DEVELOPER: Witnesses: By: Witness Printed Name Witness Printed Name ____________________ STATE OF _________________ COUNTY OF ________ The foregoing instrument was acknowledged before me by means of physical presence or online notarization this ____ day of ___________________, 2020, by ______________________________. Such person(s) Notary Public must check applicable box: are personally known to me. produced her current driver license. produced as identification. (Notary Seal) Notary Public __________________________ Printed Name of Notary: Commission Number: My Commission Expires: 9.A.5.d Packet Pg. 1329 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) ,"M M 5"13M M .0,"0M .$M 1"4'.-M M 5"14M *',"M .$M 4&"M 15M M (M.%M 1"3'.,M ,"M M % % 15M M < FJ </*,@7'FHJ 15M M J 9=#2J 8(J 25!J 28A#!J /5J >#A085J J A8G5>-/9J J >8BA-J =5+#J J #>AJ 822/#=J 8B5AIJ (28=0!J 5!J $/5+J 48=$J 9=A0C2=2IJ !$>=0$!J >J (8228G>J 844$5$J AJ A-$J G$>AJ :C=A$=J 8=5$=J 8)J >$A/85J J A8G5>-09J J >8BA.J =5+$J J $>AJ 822/#=J 8B5AIJ (28=0!J A-#5#J 5#J J (##AJ A8J A-#J #>AJ =0+-AJ 8(J GIJ 205#J 8(J >5AJ ==J 8B2#E=!J A.#5#J > # J 285+J >0!J #>AJ =/+-AJ 8(J GIJ 205#J J (##AJ A8J A-$J 9805AJ 8(J $+055/5+J A-$5$J 5$ J J ($$AJ A-$5$J > $ J J ($$AJ A.#5#J >GJ J (##AJ A-#5#J 5 G J JJ (##AJ A-#5#J >GJ J (##AJ A-#5#J 5 GJ JJ (##AJ A8J A-#J 9805AJ 8(J #+/55/5+ J 85A0505+J J >:C=#J (##AJ 8=J J =#>J 48=#J 8=J 2#>> J A-0>J />J 58AJ J >B=E#I %<06*?J <%J ?%"J 76J @,%J F%?@ 3/6&J 7'J @,&J ?7D@,F&?@J ;D<@&<J 7' ?& @076J J ?J &06*J 6J J F >B1$AJ A8J $>$4$5A>J =$>$=EA/85> 5!J =#>A=/A/85>J 8(J =#8=! 7FFLM "M 2LF:CM $DFM H=:M $>FBM )M /FD;:GG>DC7@M *7C9M 2IFJ:LDFM $ADF>97M :FH?;>87H:M ,D M M !7H:M 2?<C:9M ,DHM J7A>9M K?H=DIHM H=:M G><C7HIF:M 7C9M H=:M DF?<>C7@M F7>G:9M G:7AM D;M 7M $ADF?97M )>8:CG:9M 2IFJ:LDFM 7C9M +7EE:FM ,/*#1 M $*.0'!M /&.,#M M M %6M M M #M M M *M M #% % "%% $% % !% !"% % % %M % % % % Page 1 of 26 9.A.5.d Packet Pg. 1330 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 14 of 26 APPENDIX A, EXHIBIT A NUMBER OF AFFORDABLE HOUSING UNITS/MONTHLY BASE RENTS Of the 82 units proposed, 13 will be restricted to 2ZQHUV5HQWHUV earning less than 50% AMI (very low income), 50 will be restricted to tenants earning between 51% AMI to 60% AMI (low income), and the remaining 19 units will be restricted to tenants earning between 61% AMI to 80% AMI (low to moderate income). For rent and income levels, please see Appendix A, Exhibit C. (1)Base residential density allowed in this development 4 units/acre. (2)Gross acreage 5.1-acres (3)Maximum number of affordable housing density bonus units allowed in this development pursuant to LDC Section 2.06.00 12 units. (4)Gross residential density of this development (including affordable housing density bonus units) 16 units/acre. (5)Percentage of affordable housing units pledged by the developer (as a percent of the total number units in the development) 100% 9.A.5.d Packet Pg. 1331 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 15 of 26 APPENDIX A, EXHIBIT B AFFORDABLE HOUSING DENSITY BONUS RATING SYSTEM LDC § 2.06.03, provides for calculation of a density bonus for developers pledging to construct affordable units within their development. Included in this Exhibit B are instructions for and the tables with which to calculate the density bonus for a particular project. Exhibit C contains the current median income and acceptable rents for very low, low, moderate, and gap income households in Collier County. The affordable housing density bonus rating system shall be used to determine the amount of the affordable housing density bonuses which may be granted for a development based on household income level , type of affordable housing units (owner-occupied or rental, single-family or multi-family, where applicable and percentage of affordable housing units in the development. To use the affordable housing density bonus rating system, Table A, below, shall be used. Table A shall be reviewed and updated if necessary on an annual basis by the Board of County Commissioners or its designee. First, choose the household income level (very low, low, or moderate) of the affordable housing unit(s) proposed in the development, as shown in Table A. Next, determine the percent of that type of affordable housing unit(s) proposed in the development compared to the total number of dwelling units in the development. From this determination, Table A will indicate the maximum number of residential dwelling units per gross acre that may be added to the base density. These additional residential dwelling units per gross acre are the maximum affordable housing density bonus (AHDB) available to that development. Developments with percentages of affordable housing units which fall in between the percentages shown on Table A shall receive an affordable housing density bonus equal the lower of the two percentages it lies between plus 1/10th of a residential dwelling unit per gross acre for each additional percentage of affordable housing rental units in the development. For example, a development which has 24% of its total residential dwelling units as affordable housing units, and which has an affordable housing density bonus rating of "four" will receive an affordable housing density bonus (AHDB) of 4.4 residential dwelling units per gross acre for the development. In no event shall the affordable housing density bonus exceed twelve (12) dwelling units per gross acre. 9.A.5.d Packet Pg. 1332 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 16 of 26 APPENDIX A, EXHIBIT B AFFORDABLE HOUSING DENSITY BONUS RATING SYSTEM Please calculate your density bonus in the space provided below. Attach additional pages if necessary. otal Allowable Density = Base Density + Affordable Housing Density Bonus. In no event shall the maximum gross density exceed that which is allowed pursuant to the GMP. 2 Developments with percentages of affordable housing units which fall in between the percentages shown on Table A shall receive an AHDB equal to the lower of the two percentages it lies between, plus 1/10 of a residential dwelling unit per gross acre for each additional percentage of affordable housing units in the development. 3 Where more than one type of affordable housing unit (based on level of income shown above) is proposed for a development , the AHDB for each type shall be calculated separately. After the AHDB calculations for each type of affordable housing unit have been completed, the AHDB for each type of unit shall be added to those for the other type(s) to determine the maximum AHDB available for the development. In no event shall the AHDB exceed 12 dwelling units per gross acre. 4 Owner-occupied only. 5 May only be used in conjunction with at least 20% at or below 120% MI. 9.A.5.d Packet Pg. 1333 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 17 of 26 APPENDIX A, EXHIBIT C INCOME AND RENT LEVELS FOR THE VERY LOW, LOW AND MODERATE INCOME. Pursuant Chapter 74, Section 74-402 (a)(l); Collier County Code of Laws and Ordinances, moderate income is 61% to 80% of the median income, low income is 51% to 60% of the median income and very low income is less than 50% of the median income. RECOMMENDED RENTAL RATES The Low-Income Rental Housing Tax Credit (LIHTC) rents utilized by The Florida Housing Finance Corporation (FHFC) are calculated based on HUD’s income limits. See income levels for 2020 below, followed by the rental rates applicable to this project. To calculate net rents, an utility allowance must be applied. The allowance is estimated based on an energy consumption study completed by a third-party consultant and approved by FHFC. COLLIER COUNTY MEDIAN INCOME 2020 RENTAL RATES BASED ON 30% AMI, 60%AMI and 80%AMI 1BR 2BR 3BR 30% AMI $463 $555 $642 60% AMI $927 $1,111 $1,284 80% AMI $1,236 $1,482 $1,712 ESTIMATED UTILITY ALLOWANCES IN COLLIER COUNTY 1BR: $131 2BR: $146 and 3BR: $161 9.A.5.d Packet Pg. 1334 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 18 of 26 APPENDIX B, EXHIBIT A PRELIMINARY APPLICATION FOR AFFORDABLE HOUSING UNIT (DRAFT) Date Occupancy Desired: Date of Application: Amt. Of Sec. Deposit: Your Name: Race/National Origin: Handicap: Yes_ No_ Co-Tenant Name Race/National Origin: Handicap: Yes_ No_ Present Address: Street City State Zip Telephone No. Name of Landlord How Long at this Address: Landlord ' s Address: Street City State Zip Telephone No. If you have resided at your present address less than 3 years, please state previous address: Street City State Zip Telephone No. Name of Previous Landlord Street APPLICANT: City State Zip Telephone No. Present Employers Name Address and Telephone No. How long with Present Employer: Job Title Gross Salary: Hourly$ Weekly$ Every 2 Weeks$ Monthly$ 9.A.5.d Packet Pg. 1335 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 19 of 26 Social Security Number Birth Date Previous Employers Name Address and Telephone No. How long with Previous Employer Job Title CO-TENANT: Present Employers Name Address and Telephone No. How long with Present Employer: Job Title Gross Salary: Hourly$ Weekly$ Every 2 Weeks $ Monthly$ Social Security Number Birth Date Previous Employers Name Address and Telephone No. How long with Previous Employer Job Title NAMES OF ALL WHO WILL OCCUPY APARTMENT BIRTH DATE SEX AGE SOCIAL SECURITY 1. -- -- ------- 2. 3. PERSONAL REFERENCES (Not Relatives) 1. Name: Address: How Long Known: 2. Name: Address: How Long Known: 9.A.5.d Packet Pg. 1336 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 20 of 26 APPENDIX B, EXHIBIT B AFFORDABLE HOUSING APPLICANT INCOME VERIFICATION (DRAFT) Date: Applicant's Name:SocialSecurityNumber Co-Tenant's Name:: Social Security Number Present Address: Street city state Zip Telephone No. I hereby make application for a single family unit at I hereby declare and reveal all of my sources of income. I am aware that to leave out, omit or fail to report my assets or forms of income from pensions, stocks, bonds, real property rent, sale or ownership is a fraudulent act punishable by law. Knowingly falsifying information on this form is cause for refusal of occupancy. I hereby certify that this will be my permanent residence and that I have no other assisted housing. I understand that this information is for the purpose of computing my annual income to determine my qualification to buy an affordable, workforce, or gap housing unit. I understand that I am not required to surrender my ownership or rights or claimed property, pensions or capital gains, etc. Applicant Co-Occupant Amount Frequency Amount Frequency Received of Pay Received of Pay Wages/Salary Bonuses Tips $ $ $ $ $ $ $ $ $ $ $ $ Commissions $ $ $ $ Interest Income $$$$ Trust Fund Income $ $ $ $ Unemployment $ $ $ $ Workman' s Compensation $ $ $ $ Welfare $ $ $ $ Food Stamps $ $ $ $ Social Security $ $ $ $ Social Security Disability $ $ $ $ Supplemental SSI $ $ $ $ Family Assistance $ $ $ $ Child Support $ $ $ $ $-- $ $-- $ $-- $ Veterans Benefits $ $ Widows Benefits $ $ Union Pension $ $ 9.A.5.d Packet Pg. 1337 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 21 of 26 Self-Employment Business, Silent Partner, etc. Private Insurance Pension $ $ ____ $ $ $______ $ $ $ TOTAL ANNUAL INCOME $ $ THE VERIFICATION HERE REQUESTED MAY TAKE THE FORM OF THE MOST RECENT YEAR'S INCOME TAX RETURN FOR EACH OCCUPANT WHO HAS FILED AND WILL OCCUPY THE AFFORDABLE, WORKFORCE, OR GAP UNIT. THE SAME MUST BE EXECUTED FOR EACH OCCUPANT OF THE HOUSEHOLD WHO CONTRIBUTED TO THE ANNUAL HOUSEHOLD INCOME. FAILURE TO REPORT ALL SOURCES OF HOUSEHOLD INCOME WILL RESULT IN DISQUALIFICATION FOR TENANCY IN AFFORDABLE, WORKFORCE, OR GAP HOUSING UNIT. 9.A.5.d Packet Pg. 1338 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 22 of 26 APPENDIX B, EXHIBIT C AFFORDABLE HOUSING APPLICANT INCOME CERTIFICATION (DRAFT) APPLICANT: Present Employer: Job Title: Address: Street City State Zip I, , hereby authorize the release of information requested (Applicant) on this certification form. Signature of Applicant STATE OF COUNTY OF The foregoing instrument was acknowledged before me by means of physical presence or online notarization this ____ day of ___________________, 2020, by ____________________________________. Such person(s) Notary Public must check applicable box: are personally known to me. produced her current driver license. produced as identification. (Notary Seal) Notary Public Printed Name of Notary: Commission Number: My Commission Expires: 9.A.5.d Packet Pg. 1339 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 23 of 26 EMPLOYER CERTIFICATION Applicant's Gross Annual Income or Rate or Pay: $ Number of Hours Worked (Weekly): . Frequency of Pay: Amount of Bonuses, Tips, or other Compensation Received: $ $ Monthly Annually Supervisor STATE OF COUNTY OF The foregoing instrument was acknowledged before me by means of physical presence or online notarization this ____ day of ___________________, 2020, by ____________________________________. Such person(s) Notary Public must check applicable box: are personally known to me. produced her current driver license. produced as identification. (Notary Seal) Notary Public Printed Name of Notary: Commission Number: My Commission Expires: 9.A.5.d Packet Pg. 1340 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 24 of 26 APPENDIXC DEVELOPER APPLICATION FOR AFFORDABLE HOUSING DENSITY BONUS Pursuant to LDC § 2.06.01 please complete this form and submit it with any accompanying documentation to the Community Development & Environmental Services Division, 2800 North Horseshoe Drive, Naples, Florida 34104. A copy must also be provided to the Collier County Community and Human Services Department. All items requested must be provided. 1. Please state what zoning districts are proposed by the applicant, if any, on the property and the acreage of each; Bembridge Emergency Services Complex CFPUD & RPUD 2. Has an application for rezoning been requested in conjunction with the affordable housing density bonus process? _X_ Yes __ No If yes, state date of application PUDA filed 6.24.2020.and if the request has been approved, state the Ordinance number N/A 3. Gross density of the proposed development. 16 units/ acre Gross acreage of the proposed development. 5.1- acres 4. Are affordable-workforce housing density bonus units sought in conjunction with an application for a planned unit development (PUD)? Yes x No. ____ If yes, please state name and location of the PUD and any other identifying information. Bembridge Emergency Services Complex CFPUD & RPUD 5. Name of applicant: Jessica Harrelson, AICP, Davidson Engineering, Inc. Name of land developer if not the same as Applicant: McDowell Housing Partners, LLC 9.A.5.d Packet Pg. 1341 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 25 of 26 6. Please state the number of units that will be rental and owner occupied, number of affordable housing units, and number of bedrooms the units will have. All 82 units will be renter occupied. See detailed unit mix below: 1BR @ 30% AMI: 4 1BR @ 60%AMI: 14 1BR @ 80% AMI: 4 2BR @ 30% AMI: 7 2BR @ 60% AMI: 29 2BR @ 80% AMI: 12 3BR @ 30% AMI: 2 3BR @ 60% AMI: 7 3BR @ 80% AMI: 3 7. Please provide a physical description of the affordable units by type of unit (very low income, low income , moderate income, gap income) and by number of bedrooms. Include in your description, for example, the square footage of each type of unit, floor coverings used throughout the unit (carpeting, tile, vinyl flooring); window treatments; appliances provided such as washer/dryer, dishwasher , stove, refrigerator; bathroom amenities, such as ceiling exhaust fans; and any other amenities as applicable. Attach additional pages as Exhibit "D" if needed. As shown above, the project will have 13 very low income units (50% AMI and below), 50 low income units (51% to 60% AMI) and 19 low to moderate income units (61% to 80% AMI). The unit size will be the following: 1BR – 700 SF, 2BR – 994 SF to 1,065 SF (corner unit) and 3BR – 1,336 SF. Units will feature solid surface countertops; plywood cabinets; ceramic and/or luxury vinyl tile flooring; impact windows, full-size energy star appliances including range, refrigerator microwave, and dishwasher; washer/dryer hookups in every unit; and LED lighting throughout. Project amenities will include a clubhouse (computer lab, billiards or ping-pong table, gathering room with media), fitness center and large heated pool. 9.A.5.d Packet Pg. 1342 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Page 26 of 26 8. Please supply any other information which would reasonably be needed to address this request for an affordable, workforce, and gap housing density bonus for this development. Attach additional pages if needed. N/A 9.A.5.d Packet Pg. 1343 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CPUD & RPUD PUDA- PL20200000564 Deviation Justifications October 12, 2020 BBEMBRIDGE EMERGENCY SERVICES COMPLEX DEVIATION JUSTIFICATIONS Deviation #2 seeks relief from LDC section 4.06.02 C.4., “Type D Landscape Buffer,” which requires a 20-foot Type “D” landscape buffer along rights-of-way for developments of 15 acres or more, to instead allow a 15-foot wide Type “D” buffer on Tracts “A” and “A-1- Residential” along Santa Barbara Boulevard. Justification: The existing EMS Station site, located on Tract A of the PUD, has an existing 15’ Type D buffer to remain. This deviation request will solidify the existing 15’ Type D buffer on the EMS Station’s site and allow Tract A-1 to provide the same buffer for consistency. In addition, the existing water management lake and required lake maintenance easement, located on Tract B, creates development restraints on Tract A-1 and a 20’ Type ‘D’ buffer requirement would further reduce developable area and restrict on-site circulation needed for emergency services. The request for a reduction in width does not result in any negative impacts to the surrounding area. All required plant material will still be installed within the proposed 15’ Type ‘D’ Landscape Buffer. Deviation #3 seeks relief from LDC Section 4.06.02 C.2., “Type B Landscape Buffer,” which requires a 15’ Type ‘B’ buffer between multi-family residential and a community facility, to instead allow a 7’ Type ‘B’ buffer along the eastern property line of Tract “A-1-Residential”. Justification: The existing water management lake and required lake maintenance easements, located within Tract B, creates development restraints for Tract “A-1 Residential”; therefore, a reduction in the required buffer width is being requested. In addition, the reduction in width of the landscape buffer will allow the site to be to be designed/constructed to accommodate emergency service vehicles to easily circulate the site. A 7’ Type B buffer provides sufficient width for plant materials to be installed and does not create a negative impact to the surrounding area. Deviation #4 seeks relief from LDC Section 4.05.04. G., “Parking Space Requirements,” which requires parking spaces for offices/clubhouses to be parked at 50% normal requirements and accessory recreational facilities for multi-family projects, to instead require a total of four (4) parking spaces for the office/clubhouse and no additional parking spaces for the accessory recreational facilities on Tract “A-1”. 9.A.5.d Packet Pg. 1344 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CPUD & RPUD PUDA- PL20200000564 Deviation Justifications October 12, 2020 Justification: Per the actual parking demand, a total of four (4) parking spaces is sufficient for the office/clubhouse component of the proposed affordable housing development. Additional parking for the accessory recreational facilities is not needed due to the small size of the site (3.77-acres) and the compact design of the project. Sidewalks will be provided throughout, making the project a walkable/pedestrian friendly community. Parking requirements for the dwelling units will be met, as required by the Collier County Land Development Code. Deviation #5 seeks relief from LDC Section 4.06.02. C.4., “Type D Landscape Buffer,” which requires a 20-foot Type ’D’ landscape buffer along rights-of-way for developments of 15 acres or more, to instead allow a 10-foot wide Type ‘D’ buffer along Santa Barbara Boulevard and along the Roadway Easement for Tract B. Justification: The above requested deviation is to solidify existing conditions along the western and southern PUD boundaries for Tract B (Lake Tract) and is consistent with the approved plans for the water management lake. Deviation #6 seeks relief from LDC Section 4.05.02 Exhibit ‘A’, “Off-Street Parking Design Standards,” which permits a 2’ vehicular overhang into any landscape buffer that is 10’ or greater in width, to instead allow vehicular overhang into the 7’ Type ‘B’ buffer along the eastern boundary of Tract “A-1-Residential”. Justification: Through coordination with South Florida Water Management District, on- site pavement/impervious areas for the proposed affordable housing development have been reduced to the extent possible. To create a site plan that is designed with more green space, parking spaces abutting the eastern buffer are being planned at 16’ in length rather than 18’. Providing parking spaces at this length prevents the opportunity to provide wheel stops, which would prevent vehicular overhang into the 7’ Type ‘B’ landscape buffer. There are no negative impacts created by this deviation request. 9.A.5.d Packet Pg. 1345 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1346 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1347 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1348 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1349 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1350 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1351 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1352 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1353 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1354 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1355 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1356 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1357 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1358 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1359 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1360 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1361 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1362 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1363 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1364 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1365 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1366 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1367 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1368 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1369 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1370 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1371 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1372 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1373 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1374 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1375 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1376 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) June 16, 2020 Nick Casalanguida Deputy County Manager 16%"1-9.A.5.d Packet Pg. 1377 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 16%"1-9.A.5.d Packet Pg. 1378 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 Created 9/28/2017 Page 1 of 3 PROPERTY OWNERSHIP DISCLOSURE FORM This is a required form with all land use petitions, except for Appeals and Zoning Verification Letters. Should any changes of ownership or changes in contracts for purchase occur subsequent to the date of application, but prior to the date of the final public hearing, it is the responsibility of the applicant, or agent on his behalf, to submit a supplemental disclosure of interest form. Please complete the following, use additional sheets if necessary. a.If the property is owned fee simple by an INDIVIDUAL, tenancy by the entirety, tenancy in common, or joint tenancy, list all parties with an ownership interest as well as the percentage of such interest: Name and Address % of Ownership b. If the property is owned by a CORPORATION, list the officers and stockholders and the percentage of stock owned by each: Name and Address % of Ownership c. If the property is in the name of a TRUSTEE, list the beneficiaries of the trust with the percentage of interest: Name and Address % of Ownership K>>/ZKhEdz͕WK>/d/>^h/s/^/KEK&d,^ddK&&>KZ/ KtE^d,^h:dWZ>;ϭϬϬйͿ 9.A.5.d Packet Pg. 1379 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 Created 9/28/2017 Page 2 of 3 d. If the property is in the name of a GENERAL or LIMITED PARTNERSHIP, list the name of the general and/or limited partners: Name and Address % of Ownership e. If there is a CONTRACT FOR PURCHASE, with an individual or individuals, a Corporation, Trustee, or a Partnership, list the names of the contract purchasers below, including the officers, stockholders, beneficiaries, or partners: Name and Address % of Ownership Date of Contract: ___________ f. If any contingency clause or contract terms involve additional parties, list all individuals or officers, if a corporation, partnership, or trust: Name and Address g. Date subject property acquired _______________ Leased: Term of lease ____________ years /months If, Petitioner has option to buy, indicate the following: 12.19.2001-Collier County Purchase ■99 MCDowell Housing Partners 9.A.5.d Packet Pg. 1380 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 Created 9/28/2017 Page 3 of 3 Date of option: _________________________ Date option terminates: __________________, or Anticipated closing date: ________________ AFFIRM PROPERTY OWNERSHIP INFORMATION Any petition required to have Property Ownership Disclosure, will not be accepted without this form. Requirements for petition types are located on the associated application form. Any change in ownership whether individually or with a Trustee, Company or other interest-holding party, must be disclosed to Collier County immediately if such change occurs prior to the petition’s final public hearing. As the authorized agent/applicant for this petition, I attest that all of the information indicated on this checklist is included in this submittal package. I understand that failure to include all necessary submittal information may result in the delay of processing this petition. The completed application, all required submittal materials, and fees shall be submitted to: Growth Management Department ATTN: Business Center 2800 North Horseshoe Drive Naples, FL 34104 ____________________________________________ ____________ Agent/Owner Signature Date ____________________________________________ Agent/Owner Name (please print) Jessica Harrelson, AICP 6.18.2020 9.A.5.d Packet Pg. 1381 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1382 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1383 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1384 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1385 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1386 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1387 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) §¨¦I-75 S §¨¦I-75 N -75 DAVIS BLVD RADIO RD/CR 856 COUNTY BARN RDSANTA BARBARA BLVDSANTA BARBARA BLVDDAVIDSON ENGINEERING, INC. 4365 RADIO ROAD, SUITE 201 NAPLES, FL 34104 PHONE: 239-434-6060 BEMBRIDGE EMERGENCY SERVICES COMPLEX LOCATION MAP SOURCES: COLLIER COUNTY GEOGRAPHIC INFORMATION SYSTEMS (2020 AERIAL) 010.5 Miles PUD BOUNDARY TRACT 'A-1' - 5.1 ACRES Legend ¯ 9.A.5.d Packet Pg. 1388 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) BEMBRIDGE PUD Environmental Data for PUDA SECTION 4, TOWNSHIP 50 SOUTH, RANGE 26 EAST COLLIER COUNTY, FLORIDA Prepared For: Prepared By: August 4, 2020 Collier County Growth Management Division 2800 North Horseshoe Drive Naples, FL 34104 Earth Tech Environmental, LLC 10600 Jolea Avenue Bonita Springs, FL 34135 239.304.0030 www.eteflorida.com 9.A.5.d Packet Pg. 1389 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Environmental Data for PUDA Earth Tech Environmental, LLC www.eteflorida.com EXHIBITS Figure 1 Location Map Figure 2 Aerial Map Figure 3 FLUCCS Map Figure 4 Site Plan Figure 5 Proposed Preserve APPENDICES APPENDIX A: Collier County PUDA Pre-App Notes APPENDIX B: Earth Tech Environmental Staff Qualifications APPENDIX C: Protected Species Survey APPENDIX D: Full Page Exhibits ǁŝƚŚǆŝƐƚŝŶŐEĂƚŝǀĞsĞŐĞƚĂƚŝŽŶ 9.A.5.d Packet Pg. 1390 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Environmental Data for PUDA Earth Tech Environmental, LLC www.eteflorida.com INTRODUCTION The purpose of this document is to satisfy the Environmental Data requirements (LDC Section 3.08.00) for a Planned Unit of Development Amendment (PUDA) for the Bembridge PUD property (Subject Property). This information is in response to the items in the PUDA Pre-Application Notes as provided by Collier County (see Appendix A). The Subject Property consists of a single parcel (Folio # 00400246406) totaling approximately 5.10 acres. The southern portion of the property contains a deed from Collier County for a proposed pump station, which totals 1.33 acres. The northern portion of the property is proposed to be developed as an affordable housing complex, which totals 3.77 acres. PROPERTY LOCATION The Bembridge parcel is located immediately east of Santa Barbara Boulevard and approximately 0.50 miles north of Davis Boulevard, in Collier County. See Figures 1 & 2 below for the property location. Figure 1. Location Map 3 9.A.5.d Packet Pg. 1391 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Environmental Data for PUDA Earth Tech Environmental, LLC www.eteflorida.com Figure 2. Aerial Map Environmental PUDZ-PUDA Checklist (non-RFMU) See pages 10-11 of Collier County Pre-App Notes 1. Is the project in the compliance with the overlays, districts and/ or zoning on the subject site and/ or the surrounding properties? (CON, ST, PUD, RLSA, RFMU, etc.) (LDC 2.03.05- 2.03.08; 4.08.00) Not in CV Library x Yes 2. Submit a current aerial photograph (available from the Property Appraiser’s office) and clearly delineate the subject site boundary lines. If the site is vegetated, provide FLUCFCS overlay and vegetation inventory identifying upland, wetland and exotic vegetation (Admin. Code Ch. 3 G.1. Application Contents #24). FLUCFCS Overlay -P627 x See Figure 3, FLUCCS Map below and associated descriptions. 4 9.A.5.d Packet Pg. 1392 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Environmental Data for PUDA Earth Tech Environmental, LLC www.eteflorida.com Figure 3. FLUCCS Map with Existing Native Vegetation TABLE 1. ACREAGE PER FLUCCS COMMUNITY FLUCCS CODE DESCRIPTION ACREAGE UPLANDS/WETLANDS EXISTING NATIVE VEGETATION? 513 Water (Ditch) 0.09 OTHER SURFACE WATERS No 619 Exotic Wetland Hardwoods 3.04 WETLANDS No 641-E2 Freshwater Marsh (26-50% Exotics) 0.82 WETLANDS Yes 740 Disturbed Lands 1.15 UPLANDS No Site Total: 5.10 E1 = Exotics <25% of total cover E2 = Exotics 26-50% of total cover E3 = Exotics 51-75% of total cover E4 = Exotics >75% of total cover UPLAND COMMUNITY DESCRIPTIONS FLUCCS 740, Disturbed Land This community consists of previously cleared areas which border the east and west property boundaries. They are heavily inundated with exotic vegetation including canopy level Brazilian pepper (Schinus terebinthifolia). Groundcover consists of ragweed (Ambrosia artimisifolia), dog fennel (Eupatorium capillifolium), Spanish needle (Bidens alba), balsam apple (Momordica charantia), and grapevine (Vitis rotundifolia). 5 9.A.5.d Packet Pg. 1393 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Environmental Data for PUDA Earth Tech Environmental, LLC www.eteflorida.com WETLAND COMMUNITY DESCRIPTIONS FLUCCS 619, Exotic Wetland Hardwoods This community is found throughout the majority of the property. It consists of dense Brazilian pepper with lesser amounts of earleaf acacia (Acacia auriculiformis) and scattered cabbage palm (Sabal palmetto). Groundcover consists of sedges (Cyperus spp.), dog fennel, balsam apple and a variety of vines, with cogon grass (Imperata cylindrica) and torpedograss (Panicum repens) along the edges. FLUCCS 641-E2, Freshwater Marsh (26-50% Exotics) This community is found in the southern portion of the property. It is largely void of canopy-level vegetation. The understory contains small earleaf acacia, Carolina willow (Salix caroliniana), sedges, golden rod (Solidago sempervirens), lobelia (Lobelia spp.), and cogon grass. Drift lines and bleaching were apparent within this community. OTHER SURFACE WATERS FLUCCS 513, Ditch A ditch is located parallel to the western property boundary. It contains standing water bordered by Carolina willow. 4. Provide calculations on site plan showing the appropriate acreage of native vegetation to be retained, the max. amount and rations permitted to be created on-site or mitigated off- site. Exclude vegetation located within utility and drainage easements from the preserve calculations (LDC 3.05.07.B-D; 3.05.07.F; 3.05.07.H.1.d-e). Preserve Calculation – P547 x Per Collier County, the native vegetation requirement is 15% of the existing native vegetation, 0.82 acres. 0.82 * .15 = 0.12 acres. The project is proposing to preserve 0.12 acres of wetlands. See Figure 4 above. Offsite mitigation is proposed to offset wetland impacts. See Figures 4 & 5 below. 6 9.A.5.d Packet Pg. 1394 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Environmental Data for PUDA Earth Tech Environmental, LLC www.eteflorida.com Figure 4. Site Plan Figure 5. Proposed Preserve 7 9.A.5.d Packet Pg. 1395 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Environmental Data for PUDA Earth Tech Environmental, LLC www.eteflorida.com 6. Retained preservation areas shall be selected based on criteria defined in LDC 3.05.07.A.3, include all 3 strata, be in the largest contiguous area possible and shall be interconnected within the site and to adjoining off-site preservation areas or wildlife corridors. (LDC 3.05.07.A.1-4) Preserve Selection- P550 x See #4 above. 9. Provide Environmental Data identifying author credentials, consistency determination with the GMPs, off-site preserves, seasonal and historic high water levels, and analysis of water quality. For land previously used for farm fields or golf course, provide soil sampling/ groundwater monitoring reports identifying any site contamination. (LDC 3.08.00) Environmental Data Required – P 522 x See Appendix B, Earth Tech Environmental Staff Qualifications. 10. PUD Document and Master Plan shall state the minimum acreage required to be preserved. (LDC 10.02.13.A.2) Master Plan Contents-P626 x See PUD Document and Master Plan. 13. PUD Document shall identify any listed species found on the site and/or describe any unique vegetative features that will be preserved on the site. (LDC 10.02.13.A.2.) Unique Features- P628 x No listed species have been identified on the property. ENVIRONMENTAL DATA CHECKLIST See pages 12-15 of Collier County Pre-App Notes 2. WHO AND WHAT COMPANY PREPARED THE ENVIRONMENTAL DATA REPORT? Preparation of Environmental Data. Environmental Data Submittal Requirements shall be prepared by an individual with academic credentials and experience in the area of environmental sciences or natural resource management. Academic credentials and experience shall be a bachelor’s or higher degree in one of the biological sciences with at least two years of ecological or biological professional experience in the State of Florida. Please include revision dates on resubmittals. x This Environmental Data Report was prepared by staff from Earth Tech Environmental, LLC. See Appendix B for qualifications. 7. Provide a wildlife survey for the nests of bald eagle and for listed species known to inhabit biological communities similar to those existing on the site. The survey shall be conducted in accordance with the guidelines or recommendations of the Florida Fish and Wildlife Conservation Commission (FFWCC) and the U.S. Fish and Wildlife Service (USFWS). Survey times may be reduced or waived where an initial habitat assessment by the environmental consultant indicates that the likelihood of listed species occurrence is low, as determined by the FFWCC and 8 9.A.5.d Packet Pg. 1396 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Environmental Data for PUDA Earth Tech Environmental, LLC www.eteflorida.com USFWS. Where an initial habitat assessment by the environmental consultant indicates that the likelihood of listed species occurrence is low, the survey time may be reduced or waived by the County Manager or designee, when the project is not reviewed or technical assistance not provided by the FFWCC and USFWS. Additional survey time may be required if listed species are discovered. x No bald eagles/nests or other listed species were identified on the Subject Property. See Appendix C for Protected Species Survey. 8. Provide a survey for listed plants identified in 3.04.03 x No listed plants were identified on the Subject Property. See Appendix C. 9. Wildlife habitat management and monitoring plans in accordance with 3.04.00 shall be required where listed species are utilizing the site or where wildlife habitat management and monitoring plans are required by the FFWCC or USFWS. These plans shall describe how the project directs incompatible land uses away from listed species and their habitats. Identify the location of listed species nests, burrows, dens, foraging areas, and the location of any bald eagle nests or nest protection zones on the native vegetation aerial with FLUCFCS overlay for the site. Wildlife habitat management plans shall be included on the SDP or final plat construction plans. Bald eagle management plans are required for sites containing bald eagle nests or nest protection zones, copies of which shall be included on the SDP or final plat construction plans. Note: Not required at time of Land use petitions except for Bald Eagle Management Plans. Staff requests management plans for other species are only provided at time of Plat or SDP. x N/A; no listed species were identified on the Subject Property. 11. Identify on a current aerial the acreage, location, and community types of all upland and wetland habitats on the project site, according to the Florida Land Use Cover and Forms Classification System (FLUCFCS), and provide a legend for each of the FLUCFCS Codes identified. Aerials and overlay information must be legible at the scale provided. a. Provide descriptions of each FLUCFCS code. Provide calculations for each acreage of native vegetation required to be retained on-site. a. Demonstrate on map. b. Provide a companion chart. Include the above referenced calculations and aerials on the SDP or final plat construction plans. x See Figure 3 and Table 1 above for a FLUCCS Map and corresponding descriptions. A deviation is being requested from the native vegetation requirement. See #4 above. 26. Is EAC Review (by CCPC) required? x To be determined at First Review. 9 9.A.5.d Packet Pg. 1397 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Environmental Data for PUDA Earth Tech Environmental, LLC www.eteflorida.com CCME GOAL 6: TO IDENTIFY, PROTECT, CONSERVE AND APPROPRIATELY USE NATIVE VEGETATIVE COMMUNITIES AND WILDLIFE HABITAT. OBJECTIVE 6.1: Protect native vegetative communities through the application of minimum preservation requirements… Per Collier County, the native vegetation requirement is 15% of the existing native vegetation, 0.82 acres. 0.82 * .15 = 0.12 acres. The project is proposing to preserve 0.12 acres of wetlands. See Figure 4 above. Offsite mitigation is proposed to offset wetland impacts. CCME GOAL 7: TO PROTECT AND CONSERVE THE COUNTY’S FISHERIES AND WILDLIFE. OBJECTIVE 7.1: Direct incompatible land uses are directed away from listed species and their habitats… No listed species have been identified on the Subject Property, which is completely surrounded by roadways and development. See Appendix C, Protected Species Survey. A Wood Stork Foraging Analysis and Florida Bonneted Bat Tree Cavity Survey will be provided during permitting, if warranted. 10 9.A.5.d Packet Pg. 1398 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Environmental Data for PUDA Earth Tech Environmental, LLC www.eteflorida.com APPENDIX A Collier County PUDA Pre-App Notes 9.A.5.d Packet Pg. 1399 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1400 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1401 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1402 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1403 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1404 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1405 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1406 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1407 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1408 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1409 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1410 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1411 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1412 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1413 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1414 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1415 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1416 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1417 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1418 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1419 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1420 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1421 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1422 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1423 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1424 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1425 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1426 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1427 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1428 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1429 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1430 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Environmental Data for PUDA Earth Tech Environmental, LLC www.eteflorida.com APPENDIX B Earth Tech Environmental Staff Qualifications 9.A.5.d Packet Pg. 1431 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 239.304.0030 | www.eteflorida.com Mr. Sterk has been an environmental consultant in Southwest Florida since 1994 and has worked on projects throughout Collier, Lee, Hendry, DeSoto, Glades, and Charlotte counties. His varied experience spans marine, upland, and estuarine habitats and includes extensive work with a wide variety of listed species. Relevant Experience In addition to authoring dozens of habitat and species management plans, in 2007, Jeremy co-authored the first habitat conservation plan (HCP) in the nation to address incidental take issues for both red cockaded woodpeckers (RCW) and Florida panther on the same property. In 1998, he wrote an ecological assessment computer model for the South Florida Water Management District as part of the South Lee County Watershed Study. Early in his career, Jeremy was the principal investigator of a field research project in the Bahamas that utilized telemetry tracking to study the swimming speed of sub-adult lemon sharks. Jeremy’s work experience includes: FWC Approved Shorebird Monitor Environmental Resource Permitting (ERP) USFWS Bald Eagle Monitor Turbidity Monitoring Vegetation & Habitat Mapping Wetland & Water Level Monitoring USFWS Section 7 & Section 10 Permitting Environmental Impact Statements (EIS) Water Use Monitoring & Compliance Project Management Preserve Management Plans GIS / GPS Mapping & Exhibits RCW Surveys & Habitat Evaluations Phase 1 Environmental Site Assessments Environmental Land Use Planning Phase II Environmental Site Assessments Native Vegetation Restoration Plans Lake Management Plans Site and Aerial Photography Due Diligence Reports Scrub Jay Surveys Wetland Jurisdictional Determinations Mangrove Assessments & Restorations Bonneted Bat Surveys Hard Bottom & Soft Bottom Benthic Surveys Seagrass Surveys Artificial Reef Deployments Manatee Observer Certifications/Credentials Certified Environmental Professional #1692037, Academy of Board Certified Environmental Professionals Florida Fish and Wildlife Conservation Commission Authorized Gopher Tortoise Agent (Permit No. GTA-09-00192) Florida Fish and Wildlife Conservation Commission Burrowing Owl Registered Agent (No. RAG-18-00080) PADI Research Diver Certified SSI Nitrox Diver Certified Florida Association of Environmental Professionals – member since January 1995; served on the Board of Directors for the Southwest Florida Chapter from (2008 – 2012). Past Secretary, Vice President, & President. State of Florida Real Estate License (2003 to Present) Appointed by the Collier County Board of County Commissioners to: x Conservation Collier Land Acquisition Advisory Committee, Chairman of the Lands Evaluation and Management Subcommittee. (2009 to 2014). x Collier County Development Services Advisory Committee (DSAC) (2015 to Present). x FWC Local Rule Review Committee (Manatee Protection Speed Zones) (2016). Publications Sundström, L.F., J. Sterk, & S.H. Gruber. 1998. Effects of a speed-sensing transmitter on the swimming speed of lemon sharks. Bahamas J. Sci. 6 (1): 12-22. JEREMY STERK, C.E.P. Partner \ Principal Ecologist e: jeremys@eteflorida.com t: 239.304.0030 m: 239.595.4929 Years Experience 26 years Education/Training B.S. Aquatic Biology St. Cloud State University (1994) Professional Affiliations Academy of Board Certified Environmental Professionals #16992037 Florida Association of Environmental Professionals (FAEP) 9.A.5.d Packet Pg. 1432 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 239.304.0030 | www.eteflorida.com Ms. Bobka joined Earth Tech Environmental, LLC (ETE) in 2016 as an Ecologist with more than 9 years of private and public sector experience in the environmental field. As an Ecologist, Jennifer fulfills duties in environmental consulting, wetland & wildlife monitoring, species surveys and management plans, Florida bonneted bat acoustic surveys, GIS mapping, and ERP permitting. Relevant Experience Jennifer has worked as a Naturalist for a non-profit in Collier County, a Manatee Research Intern with Florida Fish & Wildlife Conservation Commission in Palm Beach, and a Field Crew Leader for Montana Conservation Corps. Her varied experience spans coastal marine, shoreline and estuarine habitats, to upland forests and alpine environments. She has worked with a wide variety of native and invasive plants and wildlife, with a special interest in threatened and endangered species. She is also an experienced environmental educator and Florida Master Naturalist. Jennifer’s work experience includes: Vegetation and Habitat Mapping Wetland Determinations Bald Eagle Monitoring Monitoring Well Installation Shorebird Monitoring Water Level Monitoring Protected Species Surveys GIS Mapping Bat Acoustic Surveys Phase I ESAs Species Management Plans Environmental Resource Permitting (ERP) Submerged Resource Surveys Natural Resource Management Turbidity Monitoring Trail Maintenance Seagrass Surveys Mechanical and Manual Forest Fuel Reduction Wetland Preserve Monitoring Small Watercraft Operations Invasive and Exotic Species Mapping Ecological Restoration Wildfire Assessments Environmental Education & Outreach Relevant Certifications/Credentials CPR/First Aid/AED, American Safety & Health Institute, 2020 Florida Master Naturalist, UF/IFAS, 2019 Nitrox Certified SCUBA Diver, SCUBAdventures, 2018 Certified Interpretive Guide, National Association of Interpretation, 2016 PADI Open Water SCUBA Diver, SCUBA Outfitters of Naples, 2012 Wilderness First Responder, SOLO Schools, 2009 JENNIFER BOBKA Ecologist e: jenniferb@eteflorida.com t: 239.304.0030 m: 406.579.4616 Years’ Experience 9 years Education/Training B.A. Environmental Studies Montana State University (2009) Marine Biology & Coastal Ecology Study Abroad, Costa Rica (2007) Python Responder The Nature Conservancy (2015) Sawyer Training US Forest Service (2010) Professional Affiliations Florida Native Plant Society (FNPS) Florida Association of Environmental Professionals (FAEP) League of Environmental Educators of Florida (LEEF) 9.A.5.d Packet Pg. 1433 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Environmental Data for PUDA Earth Tech Environmental, LLC www.eteflorida.com APPENDIX C Protected Species Survey 9.A.5.d Packet Pg. 1434 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) BEMBRIDGE PUD Protected Species Survey SECTION 4, TOWNSHIP 50 SOUTH, RANGE 26 EAST COLLIER COUNTY, FLORIDA Prepared For: Prepared By: June 12, 2020 Davidson Engineering 4365 Radio Road, Suite 201 Naples, FL 34104 www.davidsonengineering.com Earth Tech Environmental, LLC 10600 Jolea Avenue Bonita Springs, FL 34135 239.304.0030 www.eteflorida.com 9.A.5.d Packet Pg. 1435 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Protected Species Survey Earth Tech Environmental, LLC www.eteflorida.com TABLE OF CONTENTS 1.0 INTRODUCTION............................................................................................................................. 5 2.0 PROPERTY LOCATION ................................................................................................................... 5 3.0 SPECIES SURVEY MATERIALS & METHODS ................................................................................... 5 4.0 EXISTING SITE CONDITIONS .......................................................................................................... 6 5.0 RESULTS ...................................................................................................................................... 10 6.0 SUMMARY................................................................................................................................... 16 7.0 REFERENCES ................................................................................................................................ 17 EXHIBITS Figure 1 Site Location Map Figure 2 Aerial Map Figure 3 FLUCCS Map with Aerial Figure 4 FLUCCS Map Figure 5 Transect Map & Field Results Figure 6 Florida Bonneted Bat Consultation Area Figure 7 Florida Panther Information Figure 8 Wood Stork Foraging Information Figure 9 Florida Black Bear Information Figure 10 Bald Eagle Information 9.A.5.d Packet Pg. 1436 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Protected Species Survey Earth Tech Environmental, LLC www.eteflorida.com 1.0 INTRODUCTION Earth Tech Environmental (ETE) conducted a search for listed species on the property referred to as Bembridge PUD (Subject Property) prior to development. This assessment was conducted by ETE on April 14, 2020 to evaluate the Subject Property for the potential presence of listed species of concern based on the determined Florida Land Use Cover and Forms Classification System (FLUCCS) vegetation. 2.0 PROPERTY LOCATION The Subject Property for this report consists of a single parcel (Folio # 00400246406). The Subject Property is located on the east side of Santa Barbra Boulevard, just north of Davis Boulevard in Collier County, Florida. According to the Collier County Property Appraiser’s website, the Subject Property totals approximately 5.11 acres. See Figure 1 below for a location map. FFigure 1. Site Location Map 3.0 SPECIES SURVEY MATERIALS & METHODS The species survey was conducted using a methodology similar to that discussed in the Florida Fish & Wildlife Conservation Commission (FWC) publication “Ecology and Habitat Protection Needs of Gopher Tortoise (Gopherus polyphemus) Populations Found on Lands Slated for Large-scale Development in Florida.” This methodology is as follows: Existing vegetation communities or land-uses on the subject site are delineated on a recent aerial photograph (Collier County 2020) using the Florida Land Use, Cover and Forms Classification System (FLUCCS). FLUCCS mapping for this property is detailed below in (Figures 3 & 4). The resulting FLUCCS codes are cross-referenced with a list of protected plant and animal species. The lists were obtained from two agency publications: 3 9.A.5.d Packet Pg. 1437 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Protected Species Survey Earth Tech Environmental, LLC www.eteflorida.com “Florida’s Endangered Species, Threatened Species & Species of Special Concern-Official Lists”, December 2018. “Notes on Florida’s Endangered and Threatened Plants”, Florida Department of Agriculture and Consumer Services, 2010. The result is a composite table that contains the names of the protected species which have the highest probability of occurring in each particular FLUCCS community. See Table 3 of this report for the species list that applies to the FLUCCS communities associated with the Subject Property. In the field, each FLUCCS community is searched for listed species or signs of listed species. This is accomplished using a series of transects throughout each vegetation community (see Figure 5). If necessary, transect integrity is maintained using a handheld GPS in track mode. Signs or sightings of all listed and non-listed species are then recorded, which are flagged in the field and marked by GPS. Based on the habitat types found on the Subject Property (see Table 3), particular attention was paid to the presence or absence wading birds. Florida bonneted bat, Florida black bear and Florida panther were also considered. Approximately three (3) man-hours were logged on the Subject Property during this species survey (see Table 1). 4.0 EXISTING SITE CONDITIONS Temperatures during the fieldwork for this survey were in the high 80’s. Cloud cover varied, but was mostly absent. The Subject Property is vacant and vegetated, with a combination of wetland and upland communities. Large amounts of exotic vegetation are present throughout the property. The property is surrounded by development on all sides, with Santa Barbra Boulevard running along the western property boundary. See Figure 2 below for an aerial map. The Subject Property has the following surrounding land uses: North Road Access/School East Pond/School South Fire Station/Commercial West Santa Barbra Boulevard TABLE 1. FIELD TIME SPENT ON THE SUBJECT PROPERTY DATE START TIME END TIME NO. ECOLOGISTS MAN HOURS TASK April 14, 2020 9:30 am 12:30 pm 1 3.0 Species Survey Fieldwork 4 9.A.5.d Packet Pg. 1438 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Protected Species Survey Earth Tech Environmental, LLC www.eteflorida.com Figure 2. Aerial Map Listed below are the FLUCCS communities identified on the site. The community descriptions correspond to the mappings on the FLUCCS maps below (Figures 3 and 4). See Florida Land Use, Cover and Forms Classification System (Department of Transportation, Surveying & Mapping Geographic Mapping Section, 1999) for definitions. The Florida Exotic Pest Plant Council’s (FLEPPC) list of invasive species contains Category I & II species that may be found on the Subject Property. Category I & II species are invasive exotics that are altering native plant communities by displacing native species, changing community structures or ecological functions, or hybridizing with natives (FLEPPC). A significant factor in mapping vegetative associations and local habitats is the invasion of these species such as Brazilian pepper, ear leaf acacia, melaleuca, Caesarweed, and air potato. Levels of exotic density were mapped by using field observations and photo interpretation as shown in Figure 3. Modifiers, or “E” designators, are appended to the FLUCCS codes to indicate the approximate density of exotics in the canopy and/or sub-canopy. TABLE 2. ACREAGE PER FLUCCS COMMUNITY FLUCCS CODE DESCRIPTION ACREAGE 513 Ditch 0.09 619 Exotic Wetland Hardwoods 3.04 641-E2 Freshwater Marsh (26-50% Exotics) 0.82 740 Disturbed Land 1.16 Site Total: 5.11 5 9.A.5.d Packet Pg. 1439 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Protected Species Survey Earth Tech Environmental, LLC www.eteflorida.com E1 = Exotics <25% of total cover E2 = Exotics 26-50% of total cover E3 = Exotics 51-75% of total cover E4 = Exotics >75% of total cover Figure 3. FLUCCS Map with Aerial 6 9.A.5.d Packet Pg. 1440 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Protected Species Survey Earth Tech Environmental, LLC www.eteflorida.com Figure 4. FLUCCS Map FLUCCS 513, Ditch A ditch is located parallel to the western property boundary. It contains standing water bordered by Carolina willow (Salix caroliniana). FLUCCS 619, Exotic Wetland Hardwoods This community is found throughout the majority of the property. It consists of dense Brazilian pepper (Schinus terebinthifolia) with lesser amounts of earleaf acacia (Acacia auriculiformis) and scattered cabbage palm (Sabal palmetto). Groundcover consists of sedges (Cyperus spp.), dog fennel (Eupatorium capillifolium), balsam apple (Momordica charantia) and a variety of vines, with cogon grass (Imperata cylindrica) and torpedograss (Panicum repens) along the edges. FLUCCS 641-E2, Freshwater Marsh (26-50% Exotics) This community is found in the southern portion of the property. It is largely void of canopy-level vegetation. The understory contains small earleaf acacia, Carolina willow, sedges, golden rod (Solidago sempervirens), lobelia (Lobelia spp.), and cogon grass. FLUCCS 740, Disturbed Land This community consists of previously cleared areas which border the east and west property boundaries. They are heavily inundated with exotic vegetation including canopy level Brazilian pepper. Groundcover consists of ragweed (Ambrosia artimisifolia), dog fennel, Spanish needle (Bidens alba), balsam apple (Momordica charantia), and grapevine (Vitis rotundifolia). 7 9.A.5.d Packet Pg. 1441 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Protected Species Survey Earth Tech Environmental, LLC www.eteflorida.com The various listed species which may occur in the corresponding FLUCCS communities are shown below in Table 3. TABLE 3. PROTECTED SPECIES LIST ACCORDING TO FLUCCS CATEGORY FLUCCS POTENTIAL LISTED SPECIES SCIENTIFIC NAME DESIGNATED STATUS FWC OR FDACS FWS 513 American Alligator Alligator mississippiensis SSC T(S/A) Everglades Mink Mustela vison evergladensis T - Little Blue Heron Egretta caerulea T - Reddish Egret Egretta rufescens T - Snail Kite Rorstrhamus sociabilis E E Tricolored Heron Egretta tricolor T - Wood Stork Mycteria americana T T 619 NONE - - - 641 American Alligator Alligator mississippiensis SSC T(S/A) Everglades Mink Mustela vison evergladensis T - Florida Bonneted Bat Eumops floridanus Florida Sandhill Crane Grus canadensis pratensis T - Little Blue Heron Egretta caerulea T - Reddish Egret Egretta rufescens T - Snail Kite Rorstrhamus sociabilis E E Tricolored Heron Egretta tricolor T - Wood Stork Mycteria americana T T 740 Burrowing Owl Speotyto cunicularia T - Gopher Tortoise Gopherus polyphemus T - 814 NONE - - - Abbreviations Agencies: Status: FDACS = Florida Department of Agriculture and Consumer Services CE = Commercially Exploited FWC = Florida Fish & Wildlife Conservation Commission E = Endangered FWS = United States Fish and Wildlife Service SSC = Species of Special Concern T = Threatened T(S/A) = Threatened/Similarity of Appearance 5.0 RESULTS All relevant species observed on the Subject Property are detailed in Table 4 and any listed species observed are specifically noted. See Figure 5 below for transects and field results. 8 9.A.5.d Packet Pg. 1442 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Protected Species Survey Earth Tech Environmental, LLC www.eteflorida.com Figure 5. Transect Map & Field Results TABLE 4. SPECIES OBSERVED ON THE SUBJECT PROPERTY COMMON NAME SCIENTIFIC NAME OBSERVATIONS LISTED SPECIES? STATUS BIRDS Mourning Dove Zenaida macroura DV N - MAMMALS Black Rat Rattus rattus DV N - Eastern Cottontail Sylvilagus floridanus DV N - REPTILES Brown Anole Anolis sagrei DV N - AMPHIBIANS NONE - - - - PLANTS NONE - - - - * = protected species Abbreviations Observations: Observations: Status: C = Cavity N = Nest CE = Commercially Exploited DB = Day Bed OH = Observed Hole/Burrow FE = Federally Endangered DV = Direct Visual OT = Observed Tracks FT = Federally Threatened HV = Heard Vocalization(s) R = Remains SE = State Endangered MT = Marked Tree S = Scat SSC = Species of Special Concern ST = State Threatened 9 9.A.5.d Packet Pg. 1443 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Protected Species Survey Earth Tech Environmental, LLC www.eteflorida.com The Subject Property does have community types in which listed species could reside. Below are discussions of listed species that could potentially utilize the site. During permitting, the following listed species concerns may be raised by the agencies: Figure 6. Florida Bonneted Bat Consultation Area Florida Bonneted Bat (Eumops floridana) (FBB) The Subject Property falls within the United States Fish & Wildlife (USFWS) Florida Bonneted Bat Consultation Area (see Figure 6 above). During the species survey, a tree to tree cavity survey was also conducted and no potential tree/bat cavities were observed. The Subject Property is surrounded by development on all sides. Prior to development or permitting activities, USFWS will likely not require acoustic surveys to further determine presence or absence of FBB roosts or foraging on the property. 10 9.A.5.d Packet Pg. 1444 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Protected Species Survey Earth Tech Environmental, LLC www.eteflorida.com Figure 7. Florida Panther Information Florida Panther (Felis concolor coryi) The Subject Property does not fall within the USFWS Florida Panther Habitat Zones or Consultation Area. See Figure 7 for Florida panther information as it relates to the Subject Property. Consultation with the USFWS will likely not be necessary for Florida panther. 11 9.A.5.d Packet Pg. 1445 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Protected Species Survey Earth Tech Environmental, LLC www.eteflorida.com Figure 8. Wood Stork Information Wood Stork (Mycteria americana) The Subject Property falls within the core foraging area (estimated at 18.6 miles) of at least one (1) wood stork colony in Collier County (see Figure 8). Consultation with USFWS may be necessary for wood stork and wood stork foraging if wetlands will be impacted on the property. 12 9.A.5.d Packet Pg. 1446 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Protected Species Survey Earth Tech Environmental, LLC www.eteflorida.com Figure 9. Florida Black Bear Information Florida Black Bear (Ursus americanus floridanus) The Subject Property falls within the Florida Fish & Wildlife Conservation Commission’s (FWC) mapped range for Florida black bear. Telemetry points from tagged bears have been documented in the vicinity of the Subject Property. See Figure 9 for black bear mappings as they relate to the Subject Property. The County may require the Client to implement FWC-approved bear-proof waste receptacles and education measures on the property. 13 9.A.5.d Packet Pg. 1447 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Protected Species Survey Earth Tech Environmental, LLC www.eteflorida.com Figure 10. Bald Eagle Information Bald Eagle (Haliaeetus leococephalus) The Subject Property does not fall within 0.50-miles of any FWC documented bald eagle nests. See Figure 10 for bald eagle mappings as they relate to the Subject Property. 6.0 SUMMARY No listed species or signs of listed species were observed on the Subject Property. The small size of the property and surrounding development likely preclude most wildlife usage. 14 9.A.5.d Packet Pg. 1448 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Protected Species Survey Earth Tech Environmental, LLC www.eteflorida.com 7.0 REFERENCES Atlas of Florida Plants. Institute for Systematic Botany. https://florida.plantatlas.usf.edu/ Ashton, Ray E. and Patricia S. “The Natural History and Management for the Gopher Tortoise.” Krieger Publishing Company. Malabar, Florida. 2008. Collier County Property Appraiser. http://www.collierappraiser.com Cox, James; Inkley, Douglas; and Kautz, Randy. “Ecology and Habitat Protection Needs of Gopher Tortoise (Gopherus polyphemus) Populations Found on Lands Slated for Large-Scale Development in Florida.” Nongame Wildlife Program Technical Report No. 4. December 1987. http://www.fwspubs.org/doi/suppl/10.3996/062015-JFWM-055/suppl_file/062015-jfwm- 055.s2.pdf?code=ufws-site FLEPPC 2019 List of Invasive Plant Species. Florida Exotic Pest Plant Council. https://www.fleppc.org/list/list.htm “Florida’s Endangered and Threatened Species”- Official List. Florida Fish and Wildlife Conservation Commission. Updated December 2018. http://myfwc.com/media/1515251/threatened-endangered-species.pdf http://myfwc.com/imperiledspecies/ Florida Land Use, Cover and Forms Classification (FLUCCS) Handbook. Florida Department of Transportation. January 1999. http://www.fdot.gov/geospatial/documentsandpubs/fluccmanual1999.pdf http://www.fdot.gov/geospatial/doc_pubs.shtm Weaver, Richard E. and Anderson, Patti J. “Notes on Florida’s Endangered and Threatened Plants.” Bureau of Entomology, Nematology and Plant Pathology – Botany Section. Contribution No. 38, 5th Edition. 2010. http://freshfromflorida.s3.amazonaws.com/fl-endangered-plants.pdf http://www.freshfromflorida.com/Divisions-Offices/Plant-Industry/Bureaus-and-Services/Bureau-of- Entomology-Nematology-Plant-Pathology/Botany/Florida-s-Endangered-Plants 15 9.A.5.d Packet Pg. 1449 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Environmental Data for PUDA Earth Tech Environmental, LLC www.eteflorida.com APPENDIX D Full Page Exhibits 9.A.5.d Packet Pg. 1450 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) HIALEAHORLANDOHOLLYWOODCLEARWATERCAPE CORALTALLAHASSEEJACKSONVILLECORAL SPRINGSPEMBROKE PINESSAINT PETERSBURGSANTA BARBARA BLVDDAVIS BLVDRADIO RDGOLDEN GATE PKYCOLLIER BLVD RATTLESNAKE HAMMOCK RDCOUNTY BARN RD LAKEWOOD BLVDTAMIAMI TRL EKINGS WAYPOLLY AVEWHITAKER RD39TH ST SW32ND AVE SW44TH ST SW 70TH ST SW68TH ST SWSANTA BARBARA BLVD25TH AVE SW24TH AVE SWALLEY KINGS LAKE BLVDCOMMERCIAL BLVD HAWAII B LVD 47 TH S T SW BELVILLE BLVDLAMBTON LNHOLLOW DRCAPE SABLE DR58TH ST SWDENT DRSABAL LAKE DR 28TH PL SWRADIO RDCOLLIER BLVDSUBJECT PROPERTYOCOLLIERCOUNTYG:\ETEnv Documents\PROJECTS\COLLIER\Bembridge PUD\GIS\8.5x11 Location Map.mxd / 10:43:12 AMSUBJECT PROPERTYEARTH TECH ENVIRONMENTAL, LLC 10600 JOLEA AVENUE BONITA SPRINGS, FLORIDA 34135 PHONE (239) 304-0030 FAX (239) 324-0054 WWW.ETEFLORIDA.COMEARTH TECH ENVIRONMENTAL, LLC 10600 JOLEA AVENUE BONITA SPRINGS, FLORIDA 34135 PHONE (239) 304-0030 FAX (239) 324-0054 WWW.ETEFLORIDA.COMBembridge PUDCollier County, FloridaProjectLocation MapMap Type06/10/20Date9.A.5.d Packet Pg. 1451 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) SANTA BARBARA BLVD015030075FeetSubject PropertyG:\ETEnv Documents\PROJECTS\COLLIER\Bembridge PUD\GIS\8.5x11 Aerial Map Horizontal.mxd / 4:08:46 PMONote:1. 2020 Aerial obtained from Collier County Property Appraiser2. Subject Property boundaryobtained from Davidson EngineeringEARTH TECH ENVIRONMENTAL, LLC 10600 JOLEA AVENUE BONITA SPRINGS, FLORIDA 34135 PHONE (239) 304-0030 FAX (239) 324-0054 WWW.ETEFLORIDA.COMEARTH TECH ENVIRONMENTAL, LLC 10600 JOLEA AVENUE BONITA SPRINGS, FLORIDA 34135 PHONE (239) 304-0030 FAX (239) 324-0054 WWW.ETEFLORIDA.COMBembridge PUDCollier County, FloridaProjectAerial MapMap Type7/30/20DateAffordable HousingDevelopment Area(3.77 Ac)Proposed CountyPump Station(1.33 Ac)9.A.5.d Packet Pg. 1452 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) SANTA BARBARA BLVD015030075FeetSubject PropertySite PlanG:\ETEnv Documents\PROJECTS\COLLIER\Bembridge PUD\GIS\8.5x11 Site Plan.mxd / 5:04:25 PMONote:1. 2020 Aerial obtained from Collier County Property Appraiser2. Subject Property boundaryobtained from Davidson EngineeringEARTH TECH ENVIRONMENTAL, LLC 10600 JOLEA AVENUE BONITA SPRINGS, FLORIDA 34135 PHONE (239) 304-0030 FAX (239) 324-0054 WWW.ETEFLORIDA.COMEARTH TECH ENVIRONMENTAL, LLC 10600 JOLEA AVENUE BONITA SPRINGS, FLORIDA 34135 PHONE (239) 304-0030 FAX (239) 324-0054 WWW.ETEFLORIDA.COMBembridge PUDCollier County, FloridaProjectSite PlanMap Type7/30/20Date9.A.5.d Packet Pg. 1453 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) SANTA BARBARA BLVD015030075FeetSubject PropertyPreserve (0.12 Ac)G:\ETEnv Documents\PROJECTS\COLLIER\Bembridge PUD\GIS\8.5x11 Preserve Map.mxd / 10:22:51 AMONote:1. 2020 Aerial obtained from Collier County Property Appraiser2. Subject Property boundaryobtained from Davidson EngineeringEARTH TECH ENVIRONMENTAL, LLC 10600 JOLEA AVENUE BONITA SPRINGS, FLORIDA 34135 PHONE (239) 304-0030 FAX (239) 324-0054 WWW.ETEFLORIDA.COMEARTH TECH ENVIRONMENTAL, LLC 10600 JOLEA AVENUE BONITA SPRINGS, FLORIDA 34135 PHONE (239) 304-0030 FAX (239) 324-0054 WWW.ETEFLORIDA.COMBembridge PUDCollier County, FloridaProjectPreserve Area MapMap Type8/3/20Date9.A.5.d Packet Pg. 1454 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1455 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1456 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1457 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1458 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1459 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1460 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1461 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1462 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1463 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1464 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1465 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1466 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1467 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1468 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1469 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1470 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1471 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1472 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1473 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1474 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1475 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1476 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1477 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1478 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1479 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1480 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1481 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Collier County School District School Impact Analysis Application Instructions: Submit one copy of completed application and location map for each new residential project requiring a determination of school impact to the Planning Department of the applicable local government. This application will not be deemed complete until all applicable submittal requirements have been submitted. Please be advised that additional documentation/information may be requested during the review process. For information regarding this application process, please contact the Facilities Management Department at 239-377-0267. Please check [¥] type of application request (one only): [ ] School Capacity Review [ ] Exemption Letter [ ] Concurrency Determination [ ] Concurrency Determination Amendment For descriptions of the types of review please see page 3, _________________________________________________________________________________________________________________________ I. Project Information: Project Name:___________________________________________ Municipality:_________________________________ Parcel ID#: (attach separate sheet for multiple parcels): _______________________________________________________ Location/Address of subject property: ____________________________________________________ (Attach location map) Closest Major Intersection: _______________________________________________________________________________ II. Ownership/Agent Information: Owner/Contract Purchaser Name(s): _____________________________________________________________________ Agent/Contact Person: ________________________________________________________________________________ (Please note that if agent or contact information is completed the District will forward all information to that person) Mailing address: _____________________________________________________________________________________ Telephone#: _____________________________ Fax: _________________________Email_________________________ I hereby certify the statements and/or information contained in this application with any attachments submitted herewith are true and correct to the best of my knowledge. _____________________________________________________ _____________________________ Owner or Authorized Agent Signature Date _________________________________________________________________________________________ III.Development Information Project Data (Unit Types defined on page 2 of application) Current Land Use Designation:Proposed Land Use Designation: Current Zoning:Proposed Zoning: Project Acreage: Unit Type:SF MF MH C G Total Units Currently Allowed by Type: Total Units Proposed by Type: Is this a phased project: Yes or No If yes, please complete page 2 of this application. Date/time stamp:___________________________ Bembridge Emergency Services Complex RPUD & CFPUD Collier County 00400246406 East Side of Santa Barbara Blvd (see attached location map) Davis Blvd/Santa Barbara Blvd Owner: Collier County, a Political Subdivision of the State of Florida Leaser: McDowell Housing Parters (99-Year Lease Agreement) Jessica Harrelson, AICP, Senior Planner, Davidson Engineering, Inc. 4365 Radio Rd, Suite 201, Naples, FL 34104 239.434.6060 N/A jessica@davidsonengineering.com 6.18.2020 Undeveloped Multi-Family Bembridge Emergency Services Complex CFPUD & RPUD No Change 32 82 ✔ 9.A.5.d Packet Pg. 1482 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Worksheet is required to be completed by the Applicant only if the project is to be phased: Unit Type Yr1 Yr2 Yr3 Yr4 Yr5 Yr6 Yr7 Yr8 Yr9 Yr10 Yr 11-20 20+ Years SF MF MH C G Totals by Yr Grand Total Grand Total Insert totals by unit type by years. Unit Types: SF = Single Family MF = Multi-Family/Apartments MH = Mobile Homes C = Condo/Co-Op G = Government EXAMPLE: Unit Type Yr1 Yr2 Yr3 Yr4 Yr5 Yr6 Yr7 Yr8 Yr9 Yr10 Yr 11-20 20+ Years SF 25 25 25 25 -- -- -- -- -- -- -- -- MF 50 0 0 0 -- -- -- -- -- -- -- -- MH N/A CN/A GN/A Totals by Yr 75 25 25 25 -- -- -- -- -- -- -- -- Grand Total 150 . 2 82 82 9.A.5.d Packet Pg. 1483 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Types of Reviews: School Impact Analysis: This review should be divided into two categories: -School Capacity Review (land use and rezonings), and; -Concurrency Determinations (site plans and subdivisions). School Capacity Review is the review of a project in the land use and rezoning stage of development. It is a review of the impact of the development on school capacity and is considered long range planning. This may be a review resulting in mitigation being required. In situations where the applicant may be required to mitigate, capacity may be reserved dependent on the type of mitigation. Concurrency Determination is the review of residential site plans and subdivisions to determine whether there is available capacity. When capacity is determined to be available a School Capacity Determination Letter (SCADL) will be issued verifying available capacity to the applicant and the local government. If a project exceeds the adopted level of service standards, the applicant is afforded the option of a negotiation period that may or may not result in an executed/recorded mitigation agreement Mitigation at this stage is expressed as a Proportionate Share Mitigation Agreement. For those residential developments that may have an impact but are otherwise exempt from concurrency, an exemption letter will be prepared for the applicant upon request. For those residential developments that are determined to not have an impact, a letter of no impact will be prepared for the applicant upon request. Exemption Letter: An applicant may request an Exemption Letter as documentation for the local government. These are projects that would be exempt from school concurrency review or projects that do not impact the public schools. Exemptions from school concurrency are limited to existing single family or mobile home lots of record; amendments to previously approved site plans or plats that do not increase the number of dwelling units or change the dwelling unit type; age restricted communities with no permanent residents under the age of 18; or residential site plans or plats or amendments to site plans or plats that generate less than one student; or are authorized as a Development of Regional Impact (Chapter 380, F.S.) as of July 1, 2005. Concurrency Determination Amendment: An applicant may request an amendment to a previously issued School Concurrency Determination or to an application being processed. This review may require additional staff time beyond the initial concurrency determination review and results in a modified determination being issued. An amendment could result in a negotiation period and/or a mitigation agreement being issued or a previously approved determination being modified and reissued. 3 9.A.5.d Packet Pg. 1484 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) §¨¦I-75 S §¨¦I-75 N -75 DAVIS BLVD RADIO RD/CR 856 COUNTY BARN RDSANTA BARBARA BLVDSANTA BARBARA BLVDDAVIDSON ENGINEERING, INC. 4365 RADIO ROAD, SUITE 201 NAPLES, FL 34104 PHONE: 239-434-6060 BEMBRIDGE EMERGENCY SERVICES COMPLEX LOCATION MAP SOURCES: COLLIER COUNTY GEOGRAPHIC INFORMATION SYSTEMS (2020 AERIAL) 010.5 Miles PUD BOUNDARY TRACT 'A-1' - 5.11 ACRES Legend ¯ 9.A.5.d Packet Pg. 1485 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-PL20200000564 June 18, 2020 1 www.davidsonengineering.com PPUBLIC FACILITIES LEVEL OF SERVICE (LOS) ANALYSIS The Bembridge Emergency Services Complex CFPUD and RPUD is an existing PUD and comprises approximately ±39.82-acres. The PUD is located on the east side of Santa Barbara Boulevard, south of Radio Road and north of Davis Boulevard. The purpose of PUD Amendment is to request an increase in residential density from 6 units per acre to 16 units per acre, using the Affordable Housing Density Bonus, for a maximum of 82 residential units. For this comparative analysis, the site will be conceptually developed to the maximum standards using the proposed zoning. Summary for Existing Use: Calusa Park Elementary School Collier County EMS Station #79 Summary for Proposed Change in Use: Multi-Family Residential (Apartments): 82 Units The Capital Improvement Element of the Growth Management Plan establishes Levels of Service for the following: Arterial and Collector Roads Surface Water Management Systems Potable Water Systems Sanitary Sewer Systems Solid Waste Disposal Facilities Parks and Recreation Facilities Public School Facilities Each of the areas will be examined for the development in this summary report. Arterial and Collector Roads See included Traffic Impact Statement for Level of Service. The level of service is not significantly or adversely impacted by the proposed build-out. There is adequate and sufficient roadway capacity to accommodate the proposed development’s generated trips without adversely affecting the adjacent roadway network level of service. 9.A.5.d Packet Pg. 1486 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-PL20200000564 June 18, 2020 2 www.davidsonengineering.com Surface Water Management Systems Currently the site’s surface water management system is designed within a master stormwater system that is already in place and permitted. During the time of any development order permitting, the site’s stormwater management system will be designed in accordance with LDC section 6.5.01. The stormwater management system for the site has been approved by South Florida Water Management District under Permit No. 11-02037-P. Therefore, no level of service issues will be created by the proposed site build-out conditions with respect to surface water management. Potable Water and Sanitary Sewer Systems Water service to the project is and will be continued to be provided by Collier County Public Utilities via an existing 16” water main within the Santa Barbara Blvd. R.O.W. The future water service line size and fire protection mains will be determined during the time of SDP permitting and whether it is necessary to account for potable/irrigation. Wastewater treatment is and will be continued to be provided via existing 4” force mains located within the Santa Barbara Blvd right-of-way. The future connection size for the 5.11-acre development will be determined during time of SDP permitting. Table 1 – Previously Approved Level of Service for 5.11-acre parcel Project Capacity - RESIDENTIAL A = Type of Unit B = Number of Units C = Population per Unit D = Total Population (B x C) E = Per Capita Flow (gpd) F = Total Average Daily Flow (gpd) (D x E) G = Peak hour flow (gpm) Residence* 32 2.5 80 100 8,000 23.7 *100 gal/day per person and 2.5 people per household = 250 GPD per residential unit per Collier County Design Criteria, Part 2 "Wastewater Collection and Transmission Systems" 9.A.5.d Packet Pg. 1487 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex CFPUD & RPUD PUDA-PL20200000564 June 18, 2020 3 www.davidsonengineering.com Build-out conditions are shown in the table of calculations below. Table 2 – Proposed Conceptual Development Level of Service Project Capacity - RESIDENTIAL A = Type of Unit B = Number of Units C = Population per Unit D = Total Population (B x C) E = Per Capita Flow (gpd) F = Total Average Daily Flow (gpd) (D x E) G = Peak hour flow (gpm) Residence* 82 2.5 205 100 20,500 59.0 *100 gal/day per person and 2.5 people per household = 250 GPD per residential unit per Collier County Design Criteria, Part 2 "Wastewater Collection and Transmission Systems" 9.A.5.d Packet Pg. 1488 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 4365 Radio Road • Suite 201 • Naples, FL 34104 • P: 239.434.6060 • www.davidsonengineering.com Civil Engineering • Planning • Permitting D esigningE xcellence M E M O R A N D U M September 14, 2020 To: Timothy Finn, AICP, Principal Planner, Collier County Zoning Division From: Sean Sammon, Planner Reviewed By: Jessica Harrelson, AICP, Senior Planner RE: Bembridge PUDA – Neighborhood Information Meeting Summary Davidson Engineering conducted a Neighborhood Information Meeting regarding the Bembridge Emergency Services Complex Planned Unit Development Amendment on Thursday, September 10, 2020, at 5:30pm. The meeting was held at New Hope Ministries, located at 7675 Davis Boulevard, Naples, FL 34104 on the second floor of the Event Center (Room 212). The meeting was also offered on-line, via Zoom. There was a total of 6 in-person attendees from the public, and two individuals from the public that participated virtually. The list of individuals below, associated with the project, also participated in the meeting: - Jessica Harrelson, Davidson Engineering (in-person) - Sean Sammon, Davidson Engineering (in-person) - Timothy Finn, Collier County (in-person) - Ariana Brendle, McDowell Housing (Zoom) - Chuck Hollis, McDowell Housing (Zoom) Jessica Harrelson, Agent for the Applicant, began the presentation at approximately 5:30pm and reviewed the details of the PUD Amendment request. (A PDF copy of the PowerPoint Presentation is attached for reference). During and following the presentation, attendees asked questions and gave comments. The following list is a summary of the questions and comments along with responses given by the agent in bold. 9.A.5.d Packet Pg. 1489 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 2 x Roy Anderson: “The whole area was designated an Emergency Services Complex?” Response: It’s called the Bembridge Emergency Services Complex, it’s designated and permitted currently for residential and community facilities uses. x Roy Anderson: “So how does it come about that part of the Emergency Services Complex land was given up for residential project?” Response: It’s a residential and community facilities PUD, it’s both, that portion of the project has always been designated for residential uses. x Angelo Quieto: “So they wanted to go from 6 per unit acre, to go for how many up to? What was the original?” Response: Right, we’re going from 6 units per acre up to 16 units per acre on the 5.1-acre lot. x Angelo Quieto: “How many units would it have been in the original what it was?” Response: It would have been 30 – 31 units, now to 82 units. x Angelo Quieto: “Is that Bembridge or the County’s request?” Response: This is a County initiated project, and the County has entered into a long-term lease agreement with McDowell Housing Partners to develop this as affordable housing community. x Angelo Quieto: “Who’s idea, if you know, like I mean, if they wanted to go from the 30 to the 80?” Response: There’s a need for affordable housing in Collier County and they initiated this project, and we’re taking advantage of the density bonus units that are available for the property to maximize what is needed in the County. x Roy Anderson: “[Setbacks] Is that to the edge of the pavement or the edge of the Right-of- Way, the 50 feet?” Response: It should be from the back of the curb. Along the Right-of-Way, yes. x Angelo Quieto: “[reduction in width for Landscape Buffer along eastern boundary] So you’re saying that supposed to be 15 feet and they’re changing that to 7?” Response: 7, yes, and this is adjacent to the existing lake tract. x Angelo Quieto: “All of the deviations, how do you find that, has this gone before the County and has that been approved yet for that?” Response: We haven’t been to hearing yet, we have gone through 2 reviews at Staff Level and we have received approval from all reviewers, the next step is to be scheduled for hearings. x Angelo Quieto: “Now will they have to go before the Planning Board?” Response: It will go before the CCPC and the BCC. And if you were notified via letter about tonight’s meeting you will be notified by the County about the Hearing dates as well. x Roy Anderson: “This has to go before the Planning Board, the Planning Commission as well as the BCC? Response: Correct. 9.A.5.d Packet Pg. 1490 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 3 x Ann Quieto: “They know to track it between the school, and the ambulances how far those setbacks have to be? And then have another place for where the children come out [of school]?” Response: Well we are constructing a turn lane to allow people to get off the main road and turn into the site. x Ann Quieto: “They can’t if the ambulance is coming, it’s a red light, and if they stop to let the school traffic out, that’s another thing. I live this far down, the traffic goes way past where the tower…[traffic concerns on Santa Barbara]” x Response: Off of Santa Barbara? You’re still noticing traffic issues with the increments that have been in, where the ambulance comes out? This project has no negative impact on this roadway network. We’ll make note of your concerns. x Angelo Quieto: “’Been fine with the 30 units rather than the 80’, commented about the neighborhood with other areas of similar developments and the impacts to traffic lights to a Wal-Mart near the Habitat…” Response: The Habitat development, I believe is owner-occupied, whereas this is going to be a rental community. x Ann Quieto: “There’s not enough rental communities around…” Response: The County has done a study and has determined a need for affordable housing in this County. x Roy Anderson: “I’m from Countryside and I’ve heard a lot of complaints about the Emergency Facility across the way with the Fire engine going off, and has impacts to our neighborhood, we’ve been seriously impacted by that facility, we hear this size of the facility is now tripled, there’s going to be turning impacts, 80-100 cars in the site. There’s a 50’ setback from Santa Barabara, and a 20’ buffer, what is that about? Response: There’s a 20’ setback on the internal boundaries, we decrease the road setback from 75’ to 50’. x Roy Anderson: “We’re not very pleased to hear of the increase on height, there will be some visual impact…” Response: I’ll be glad to email many of you our Traffic Impact Statement that was prepared by our Traffic Engineer that states that the roads will be continuing to be operating at their adopted Level of Service. x Carlos Blanci: “I know it was discussed that they’re were going to put something on the wooded area on the side of the northern boundary of the [entrance of the school] development, there’s 6 acres” Response: That’s not part of this development. x Anita Blanci: “6 months ago we’re at a meeting at the CAT station for affordable housing that will be put there, we thought that that was this meeting was for.” Response: That’s the school’s entrance right there, the PUD boundary stops right there. 9.A.5.d Packet Pg. 1491 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 4 x Carlos Blanci: “My fear is that they’re going to build this one then you’ll go to the other side of the street/driveway…” Response: Not sure if there’s a development going in there, I can look into it for you and let you know. x Roy Anderson: “What was the reason for increasing it from 31 units to 80 units?” Response: To meet the County’s need for affordable housing. x Roy Anderson: “So you’re going for the max that’s allowed for zoning? Without any consideration on the impact to the neighborhood?” Response: Yes. We did do an evaluation of compatibility and consistency with the neighborhood, that’s why we’re going through this process. x William Cannon: “How long is the commitment to maintain this affordable housing? Whose commitment is that? Will they manage that property?” Response: I believe it’s 30 years, but I can double check. That would be McDowell Housing, they’re the developer. The County’s going to maintain ownership of the land. McDowell owns the building. x William Cannon: “Where’s the nearest CAT bus stop?” Response: There’s several bus stops along Santa Barbara, I don’t know where the exact proximity of the stops is, but I can get that information to you. x William Cannon: “How many parking spaces do you have per unit?” Response: We have 163 spaces on site. This is parking requirements, we’re required to have 159, we’re providing 163 spaces. x Roy Anderson: “Will there be a turning lane for entering into the area, and a loading area so the street will be redesigned?” Response: Yes, there will be a right turn lane constructed on Santa Barbara into the site. x Carlos Blanci: “Will there be a left turn lane when you leave the complex to go south or do they have to take a right?” Response: It’s going to be a right, right in, right out, yes. x Anita Blanci: “I think the biggest concern would be you have all the young children walking along Santa Barbara to Calusa Elementary with more cars coming in and out of the project” Response: Sidewalks will be constructed and reconstructed, and a pedestrian interconnect will be provided from our site into Calusa park. The school will construct a sidewalk from their bus loop all the way to our project. They don’t promote children walking across Santa Barbara, they likely take a bus from the western developments. x Roy Anderson: “Will there be another separate entrance and exit off of Santa Barbara for this project?” Response: Yes, I’ll show you. It will be just south of the school’s entrance. Our turn lane will connect into the turn lane entrance for the school. x Roy Anderson: “Is there going to be a conflict with the Fire Department getting pretty close to their location?” 9.A.5.d Packet Pg. 1492 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 5 Response: No conflict. x Carlos Blanci: “What is the pump station?” Response: It’s part of the County’s utility infrastructure. It will serve the greater area, more than just our project. I can get more information on the pump station plans for you. This has already been planned for some time as part of a master system. Wastewater station, yes. x William Cannon: “Flood elevation question regarding heights?” Response: I can provide the information to you from our engineers, that is an engineering question. The site will be permitted through South Florida Water Management District. I will get all of you that information as long as you left your email and phone number. x Angelo Quieto: “This is actually the first meeting you have had on this particular project?” Response: Yes, this is the one and only required NIM that we’re required to have prior to hearing. All property owners within 500’ of the project were notified and could participate virtually, so if they live out-of-state, they could participate via Zoom, we gave everyone an equal opportunity to participate. x Roy Anderson: “What stage is the project now? In preliminary planning or it’s not in final design stage?” Response: We’re not in final design stage, we do have an engineer, our firm is working on those plans now, and we just submitted for our first SDP with Collier County, but we can’t move forward with SDP permits until the PUD is approved. x William Davis (ONLINE): “What is the County’s Median Income?” Response: The County’s Median Income is $82,300. The developer has agreed to construct 13 rental units that are in or below the very low income level, 50 rental units for low income, and 19 for the low-moderate income level, based on household size and the rent limits (table provided). x Roy Anderson: “It’s too bad that there wasn’t a meeting public before the decision was made before the development was decided to max out the units.” Response: That’s why we’re here today, to get everyone’s concerns/input, we haven’t been to hearing yet. x Carlos Blanci: “It seems like affordable housing is going in one area of the county, you would think it would spread out a little bit.” Response: The private developers and Collier County are looking at other areas. x William Cannon: “Comment about affordable housing in the county…” Response: If you want, I can send you information on base flood elevation and where we’re designing at, any other information related to the project. x Angelo Quieto: “Who’s idea as to why they increased from 30 to 80 units. Why are you asking for deviations within the project, you’re asking for something not there, something special, that should require more, deviations to make it less?” Response: We are maxing out the Affordable Housing Density Bonus allowed to the site. With PUD’s you’re allowed to request deviations to the LDC to meet your specific design 9.A.5.d Packet Pg. 1493 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 6 elements. The deviations are 4 related to our project, 2 of them don’t pertain to our project, to solidify and be consistent with what was already approved for our project. x Roy Anderson: “What’s the next step on the project? What’s the timing to go to the CCPC? Response: We should be getting our hearing dates next week, I can get you the dates and you will be notified by the county. If you have any additional questions, feel free to email me or call me and thank you for coming. [Meeting Adjourned] 9.A.5.d Packet Pg. 1494 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1495 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) EXISTING ZONING:BEMBRIDGE EMERGENCY SERVICES COMPLEX Residential PUD and Community Facilities PUD(RPUD and CFPUD)BEMBRIDGE EMERGENCY SERVICES COMPLEX9.A.5.d Packet Pg. 1496 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) BEMBRIDGE EMERGENCY SERVICES COMPLEX PUDSUBJECT PARCELTRACT A-1±5.1-ACRES9.A.5.d Packet Pg. 1497 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 82 TOTAL RESIDENTIAL UNITS 16 Units/Acre @ 5.1 acres9.A.5.d Packet Pg. 1498 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) TRACT A-1±5.1-ACRESNORTH9.A.5.d Packet Pg. 1499 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1500 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) RIGHT-IN/RIGHT-OUT ACCESS AND TURN LANEPEDESTRIAN INTERCONNECTNORTH9.A.5.d Packet Pg. 1501 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) PRINCIPAL STUCTURES:50’ FRONT YARD (Santa Barbara Blvd.)20’ SIDE / REAR YARDS(Internal Boundaries)NORTH50’20’20’20’9.A.5.d Packet Pg. 1502 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1503 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Deviation #2 seeks relief from LDCsection 4.06.02 C.4., “Type DLandscape Buffer,” which requiresa 20-foot Type “D” landscapebuffer along rights-of-way fordevelopments of 15 acres ormore, toinstead allow a 15-footwideType “D” buffer on Tracts“A”and “A-1” along Santa BarbaraBoulevard.15’ Type D Buffer9.A.5.d Packet Pg. 1504 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Deviation #3 seeks relief from LDCSection 4.06.02 C.2., “Type BLandscape Buffer,” which requiresa 15’ Type ‘B’ buffer betweenmulti-family residential and acommunity facility, toinsteadallowa 7’ Type ‘B’ buffer alongtheeasternpropertylineofTract“A-1-Residential”.7’ Type B Buffer9.A.5.d Packet Pg. 1505 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Deviation #4 seeks relief from LDC Section4.05.04. G., “Parking Space Requirements,” whichrequires parking spaces for offices/clubhouses tobe parked at 50% normal requirements andaccessory recreational facilities for multi-familyprojects, toinstead require a total of four (4)parkingspaces for the office/clubhouse and noadditionalparking spaces for the accessoryrecreationalfacilitieson Tract “A-1”. 9.A.5.d Packet Pg. 1506 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Deviation #5 seeks relief from LDCSection 4.06.02. C.4., “Type DLandscape Buffer,” which requiresa 20-foot Type ’D’ landscapebuffer along rights-of-way fordevelopments of 15 acres ormore, toinstead allow a 10-footwideType ‘D’ buffer along SantaBarbaraBoulevard and along theRoadwayEasement for Tract B.10’ Type D Buffer10’ Type D Buffer9.A.5.d Packet Pg. 1507 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Deviation #6 seeks relief from LDCSection 4.05.02 Exhibit ‘A’, “Off-Street Parking Design Standards,”which permits a 2’ vehicularoverhang into any landscapebuffer that is 10’ or greater inwidth, toinstead allow vehicularoverhanginto the 7’ Type ‘B’bufferalong the easternboundaryof Tract “A-1-Residential”.9.A.5.d Packet Pg. 1508 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) THE BEMBRIDGE PROJECT WILLHAVE NO NEGATIVE IMPACT ONTHE SURROUNDING ROADWAYNETWORK.9.A.5.d Packet Pg. 1509 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1510 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1511 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1512 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) The Developer has agreed to construct 13 rental units for residents in or below the very low income category (50% or less of the County median income), 50 rental units for residents in the low income category (51 to 60% of the County median income) and 19 rental units for residents in the low to moderate income category (61 to 80% of the County median income).9.A.5.d Packet Pg. 1513 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) Bembridge Emergency Services Complex PUDA- PL20200000564 AFFIDAVIT OF COMPLIANCE I hereby certify that pursuant to Ordinance 2004-41, of the Collier County Land Development Code, I did cause the attached newspaper advertisement to appear and I did give notice by mail to the following property owners and/or condominium and civic associations whose members may be affected by the proposed land use changes of an application request for a Planned Unit Development Rezone and Growth Management Plan Amendment, at least 15 days prior to the scheduled Neighborhood Information Meeting. For the purposes of this requirement, the names and addresses of property owners shall be deemed those appearing on the latest tax rolls of Collier County and any other persons or entities who have made a formal request of the county to be notified. The said notice contained the laymen’s description of the site property of proposed change and the date, time, and place of a Neighborhood Information Meeting. Per the attached letters, property owner’s list, and copy of newspaper advertisement which are hereby made a part of this Affidavit of Compliance _________________________________________________ Jessica Harrelson, AICP State of Florida County of Collier The foregoing Affidavit of compliance was acknowledged before me this _15th_ day of _September 2020 by Jessica Harrelson, AICP, who is personally known to me. _____________________________________________ (Signature of Notary Public) (Notary Seal) Tocia Hamlin__________________________________ Printed Name of Notary 9.A.5.d Packet Pg. 1514 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1515 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1516 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 1NAME1NAME2NAME3NAME4NAME5NAME6FOLIO1150 WILDWOOD LAKES LLC1150 WILDWOOD LAKES BLVD #8 207NAPLES, FL 34104---0311560027011170 WILDWOOD LAKESBLVD #207 LLC563 EAGLE CREEK DRIVENAPLES, FL 34113---031156003506132 SANTA CLARA DR LAND TRUST 201 SANTA CLARA DRIVE UNIT 5NAPLES, FL 34104---0465730014062 VESTORS LLC15275 COLLIER BLVD #201/269NAPLES, FL 34119---046573001163434 HOLDINGS GROUP LLC8070 DREAM CATCHER CIR #2206NAPLES, FL 34119---046573001105434 HOLDINGS GROUP LLC8070 DREAM CATCHER CIRCLE #2206NAPLES, FL 34119---046573001626ABRAM, WAYNE C & ANN NSARALYN M MARQUIS7340 ST IVES WAY #3210NAPLES, FL 34104---028273750402ADUBATO, CHRISTOPHER P & ANNA 31 ECKERT DRLINCROFT, NJ 07738---031156007366AGUSHI, KRENAR & GENTIANA1430 WARING AVENUEBRONX, NY 10469---031156004505AIDA DOUZJIAN LIV TRUST1765 COURTYARD WAY #203NAPLES, FL 34112---031156000185ALCALA, ALAN OFIR SANCHEZFAVIOLA GATICA SANCHEZ1250 WILDWOOD LAKES BLVD #207NAPLES, FL 34104---031156006309ALEX PALLET INC21 CRONIN DRIVETORONTO M9B 4T7 CANADA 31156004725ALLAN FAMILY REALTY TRUST7360 PROVINCE WAY #4204NAPLES, FL 34104---606028405000289ALLEGRET, CATHERINE2310 PINEWOODS CIRNAPLES, FL 34105---031156006668ALLEGRET, CATHERINE2310 PINEWOODS CIRNAPLES, FL 34105---031156000402ALLEN FAMILY REV TRUST1190 WILDWOOD LAKES BLVD #103NAPLES, FL 34104---031156004068ALTERIO, FRANK C & MARY C7360 SAINT IVES WAY #2108NAPLES, FL 34104---028267500163ALVAREZ, MARIELA GAVIRIA169 SANTA CLARA DRIVE #5NAPLES, FL 34104---046573002968AMADOR, LINDA1275 WILDWOOD LAKES BLVD # 207NAPLES, FL 34104---581831156000305AMEWAY LLC18524 ORLANDO RDFORT MYERS, FL 33967---0 31156005326AMEWAY LLC18524 ORLANDO RDFT MYERS, FL 33967---031156005287AMEWAY LLC18524 ORLANDO ROADFORT MYERS, FL 33967---0 31156004466ANA AGUILERA LLC108 SANTA CLARA DRIVEUNIT #15NAPLES, FL 34104---046573000601ANDERER, EMILY1254 ROBINSON AVE APT #5SAN DIEGO, CA 92103---031156006642ANDRE, JOSEPH H & SUZANNE F HEIDI M ANDREMICHAEL J ANDRE234 GLACIER AVE # 2FAIRBANKS, AK 99701---3632 28267500480ANDRZEJEWSKI, ADRIAN G20325 STERLING BAY LN W #JCORNELIUS, NC 28031---031156001320ANGELUS, LAURA LEI169 SANTA CLARA DRIVEUNIT 7NAPLES, FL 34104---046573003006ANNA SEGRETO REV TRUST204 FURSE LAKES CIR #C-1NAPLES, FL 34104---031156007324ANTAL, ROBERT & ADRIANA57 MISTY WELL DRIVERICHMOND HILL L4E 4J6 CANADA 31156003580ANTELO, FREDERICK SANDOVAL 1240 WILDWOOD LAKES BLVD #6NAPLES, FL 34104---031156005724APONTE, LAWRENCE G142 SANTA CLARA DR #15NAPLES, FL 34104---541746573001888ARCHAMBAULT, JENNIFER R1190 WILDWOOD LAKES BLVD # 205NAPLES, FL 34104---580831156004262AREBALO, OSCAR201 SANTA CLARA DR #5NAPLES, FL 34104---046573004720ARMSTRONG, LESLIE JPATRICK S ARMSTRONG37 HETHERINGTON DRBOWMANVILLE L1C 3R2 CANADA 31156002866ASBL 2020 LLC2390 NORTHEAST 172ND STREETNORTH MIAMI BCH, FL 33160---0 24754201940ASDM 2018 LLC2390 NE 172 STNORTH MIAMI BCH, FL 33160---0 24754200983ASDM 2018 LLC2390 NE 172 STREETNORTH MIAMI BCH, FL 33160---0 24754203566ASDM 2018 LLC2390 NE 172 STREETNORTH MIAMI BCH, FL 33160---0 24754203906ASDM 2018 LLC2390 NE 172 STREETNORTH MIAMI BCH, FL 33160---0 24754204442ASDM 2018 LLC2390 NE 172 STREETNORTH MIAMI BCH, FL 33160---0 24754201982ASDM 2018 LLC2390 NE 172 STREETNORTH MIAMI, FL 33160---0 24754201403ASDM 2018 LLC2390 NE 172ND STN MIAMI BEACH, FL 33160---0 24754204167ASDM 2019 LLC2390 NE 172 STREETMIAMI, FL 33160---024754200543ASDM 2019 LLC2390 NE 172 STREETNORTH MAIMI, FL 33160---0 24754201720ASDM 2019 LLC2390 NE 172 STREETNORTH MIAMI BCH, FL 33160---0 24754204264ASDM 2019 LLC2390 NE 172 STREETNORTH MIAMI, FL 33160---0 24754201681ASDM 2019 LLC2390 NE 172 STREETNORTH MIAMI, FL 33160---0 24754200064ASDM 2019 LLC2390 NE 172 STREET NORTHNORTH MIAMI, FL 33160---0 24754203362ASDM 2019 LLC2390 NE 172ND STREETNORTH MIAMI, FL 33160---0 24754203003ASDM 2020 LLC2390 NE 172 STN MIAMI BEACH, FL 33160---0 24754204002ASDM 2020 LLC2390 NE 172 STREETNORTH MIAMI BEAC, FL 33160---0 24754203760ASDM 2020 LLC2390 NE 172 STREETNORTH MIAMI BEAC, FL 33160---0 24754200284Notice: This data belongs to the Collier County Property Appraiser's Office (CCPA). Therefore, the recipient agrees not to represent this data to anyone as other than CCPA provided data. The recipient may not transfer this data to others without consent from the CCPA.Petition: PL20200000564 | Buffer: 500' | Date: 8/14/2020 | Site Location: Bembridge Emergency Services Complex CFPUD/RPUDPOList_500_PL202000005649.A.5.d Packet Pg. 1517 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 2ASDM 2020 LLC 2390 NE 172 STREETNORTH MIAMI, FL 33160---0 24754202185ASDM 2020 LLC 2390 NE 172 STREETNORTH MIAMI, FL 33160---0 24754204361ASDM 2020 LLC 2390 NE 172ND STREETNORTH MIAMI BCH, FL 33160---0 24754202923ASDM 2021 LLC 2390 NE 172 STNORTH MIAMI BEAC, FL 33160---0 24754200569ASDM 2021 LLC 2390 NE 172 STNORTH MIAMI BEAC, FL 33160---0 24754204785ASDM INVESTMENT 2012 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203168ASDM INVESTMENT 2012 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203744ASDM INVESTMENT 2013 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204400ASDM INVESTMENT 2013 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203126ASDM INVESTMENT 2014 LLC 2390 N E 172 STREETNORTH MIAMI BCH, FL 33160---0 24754202046ASDM INVESTMENT 2014 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204222ASDM INVESTMENT 2014 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754200381ASDM INVESTMENT 2014 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202004ASDM INVESTMENT 2014 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202965ASDM INVESTMENT 2014 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201966ASDM INVESTMENT 2015 LLC 2390 N E 172ND STREETNORTH MIAMI BCH, FL 33160---0 24754200721ASDM INVESTMENT 2015 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202509ASDM INVESTMENT 2015 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204565ASDM INVESTMENT 2015 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204248ASDM INVESTMENT 2015 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203841ASDM INVESTMENT 2015 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203100ASDM INVESTMENT 2015 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204523ASSAF, EMILE SAMAR ISSA 17222 THOMAS BAILLAIRGE PIERREFONDS H9J 3P3 CANADA 31156001809ASSAF, EMILE G SAMAR ISSA 17222 RUE THOMAS-BAILLARGE PIERREFONDS H9J 3P3 CANADA 31156006422ATHERTON, BRUCE & LINDA L 7360 SAINT IVES WAY #2301NAPLES, FL 34104---6099 28267500422AUK LLC 1260 WILDWOOD LAKES #102NAPLES, FL 34104---0 31156006448AUK LLC 1260 WILDWOOD LAKES #102NAPLES, FL 34104---0 31156005643AYEROV, ALLEN 38 PARK ST APT 11HFLORHAM PARK, NJ 07932---1736 31156000761AZAR, FLORA A CLAUDETTE AZAR KENYON JANINE AZAR 1185 WILDWOOD LAKES BLVD #201 NAPLES, FL 34104---031156002183BACHOVE, CRAIG & GAIL1615 FORUM PLACESTE 200WEST PALM BEACH, FL 33401---0 31156004107BAILEY, BEVERLY GJENNIFER GRAYLOCK3321 SUNSET KEY CIR #309PUNTA GORDA, FL 33955---0 28273750606BANK OF AMERICA N AC/O QUINTAIROS PRIETOWOOD & BOYER P A255 SOUTH ORANGE AVENUE SUITE 900 ORLANDO, FL 32801---031156003904BARBARA L ENGELS TRUST7360 SAINT IVES WAY #2206NAPLES, FL 34104---609828267500325BARDA, YANIVNAAMA YOSI7782 SCARLET CTNAPLES, FL 34104---067965017854BARDA, YANIV & NAAMA160 PLANTATION CIRNAPLES, FL 34104---640067965017650BARDHYLI, RUZHDI1280 WILDWOOD LAKES BLVD #306NAPLES, FL 34104---031156007609BARSELOU, JOANNE1190 WILDWOOD LAKES BLVD #207NAPLES, FL 34104---031156004301BATTAGLIA, JUANARGENTINA LLCPEKOS NAPLES LLC833 COLDSTREAM CTNAPLES, FL 34104---031156002769BATTELLO, SANDRO & JANE3710 PRICE CTMISSISSAUGA L5L 4S6 CANADA 31156005481BECKETT JR, JOHN F & MERRY C 8570 JULIA LNNAPLES, FL 34114---273631156006561BECKMAN, RUTH V1260 WILDWOOD LAKES BLVD # 208NAPLES, FL 34104---580231156006723BELLA ROSSA REALTY GROUP LLC 2258 CHABLIS DRMACUNGIE, PA 18062---031156001922BENEDICT, JAY & PATRICIA ANN 43 WHITNEY STREETNORTHBOROUGH, MA 01532---0 31156007269BENITEZ, JORGE1220 WILDWOOD LAKES BLVD #101NAPLES, FL 34104---580631156004822BENN, JOHN M7780 SCARLET CTNAPLES, FL 34104---641467965017906BENYA, PAUL G3 CAMBRIDGE CTKENNEBUNK, ME 04043---0 28267500561BENYAK, RONALD7340 PROVINCE WAY #3204NAPLES, FL 34104---028380560006BERNARD III, JOHNLESLIE BERNARD788 PARK SHORE DRE-12NAPLES, FL 34103---031156000680BERNARD III, JOHN B & LESLIE A 788 PARK SHORE DRE-12NAPLES, FL 34103---031156005504BES TR, RICHARD JOHNCINDY DENISE BES TRBES FAMILY LAND TRUST 29 DENRICH AVETILLSONBURG N4G 4X5 CANADA 31156000583BESLIJA, SENAD & SEDIJA8267 VALIANT DRNAPLES, FL 34104---667324754202800BESLIJA, SENAD & SEDIJA8267 VALIANT DRNAPLES, FL 34104---667324754203524BIAGI, RUSSELL & LINDA7360 PROVINCE WAY #4209NAPLES, FL 34104---606128405000386BIANCHINI, FRED & JANET301 HASTINGS ROADMIDDLEBOROUGH, MA 02346---0 28273750486BILOUS, MARIIA2161 E 26TH STREETBROOKLYN, NY 11229---031156004327BLACK BOOK CAPITAL LLC11983 TAMIAMI TRAIL NSUITE 115NAPLES, FL 34110---046573004908BLACK BOOK CAPITAL LLC15275 COLLIER BLVD #201/269NAPLES, FL 34119---046573004924BLACK TR, VIRGINIA DAREUTD 5/8/96165 PLANTATION CIRNAPLES, FL 34104---644367965017003POList_500_PL202000005649.A.5.d Packet Pg. 1518 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 3BLAIS, TINA M 1275 WILDWOOD LAKES BLVD UNIT 2 205NAPLES, FL 34104---0 31156000266BLANCO, CARLOS ANITA L HERWAGEN 178 PLANTATION CIR # 6 NAPLES, FL 34104---6400 67965017207BLUE STAR A&S LLC 2390 NE 172 STREETNORTH MIAMI BCH, FL 33160---0 24754202884BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203469BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201542BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200802BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200527BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200705BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200462BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200860BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200349BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754203867BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200789BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200187BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200682BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200844BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200763BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200941BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200828BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200640BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754202907BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754203702BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754203728BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200323BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200747BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754203948BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200307BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200446BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200501BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200488BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200226BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200268BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200608BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200420BLUE STAR BRIAR LLC2390 NE 171 STN MIAMI BCH, FL 33160---0 24754202949BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200624BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200365BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754200404BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BCH, FL 33160---0 24754203029BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202648BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201584BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204060BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203249BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204303BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202541BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203508BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202664BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202347BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202101BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202143BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201047BLUE STAR BRIAR LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201827BLUE STAR BRIAR LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201801BLUE STAR BRIAR LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202062BLUE STAR BRIAR LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201746BLUE STAR BRIAR LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202428BLUE STAR BRIAR LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202127BLUE STAR BRIAR LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204183POList_500_PL202000005649.A.5.d Packet Pg. 1519 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 4BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202305BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201908BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202606BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204044BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201380BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201500BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202703BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201144BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201461BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203061BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202169BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201102BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202389BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204507BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201704BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202321BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203663BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201186BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202402BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201649BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202208BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203443BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201021BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204345BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201348BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202583BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201665BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203485BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204808BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202363BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201762BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202224BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202567BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201322BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203142BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203184BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203540BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204426BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201364BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201063BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203346BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202282BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202266BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203223BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201924BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201005BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204125BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201209BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204581BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201487BLUE STAR BRIAR LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201306BLUE STAR BRIAR LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203825BLUE STAR BRIAR LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204620BLUE STAR BRIAR LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202088BLUE STAR BRIAR LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203265BLUE STAR BRIAR LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201267BLUE STAR BRIAR LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202020BLUE STAR BRIAR LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202444POList_500_PL202000005649.A.5.d Packet Pg. 1520 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 5BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203401BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203427BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204549BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201283BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201869BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202622BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202680BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204468BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204743BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201445BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202460BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201429BLUE STAR BRIAR LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204484BLUESTEIN, DANIEL 330 W 58TH ST #12GNEW YORK, NY 10019---0 31156004945BONDI, I JEAN 609 MAPLEWOOD CTPITTSBURGH, PA 15237---0 31156000729BORDA, ELIANA 193 SANTA CLARA DR #11NAPLES, FL 34104---0 46573004209BORES, CHRISTOPHER JOSEPH 14785 LEEWARD DRNAPLES, FL 34114---0 31156006846BOSHART, ROBERT JOHN NANCY MARY BOSHART 330 MILL STREET SOUTH #712BRAMPTON L6Y 3V3 CANADA 31156006066BPBS INVESTMENT LLC2390 NE 171ST STNORTH MIAMI BCH, FL 33160---0 24754200129BPBS INVESTMENT LLC2390 NE 171ST STNORTH MIAMI BCH, FL 33160---0 24754200103BPBS INVESTMENT LLC2390 NE 171ST STNORTH MIAMI BCH, FL 33160---0 24754200145BPBS INVESTMENT LLC2390 NE 171ST STNORTH MIAMI BCH, FL 33160---0 24754200048BPBS INVESTMENT LLC2390 NE 171ST STNORTH MIAMI BCH, FL 33160---0 24754200080BPBS INVESTMENT LLC2390 NE 171ST STNORTH MIAMI BCH, FL 33160---0 24754200161BRACA INVESTMENTS LLC8267 LAUREL LAKES WAYNAPLES, FL 34119---046573001765BRAIR INVESTMENTS LLC2390 NE 171ST STNORTH MIAMI BCH, FL 33160---0 24754202868BRAVO, LEONARDO4601 N PARK AVE #1611CHEVY CHASE, MD 20815---0 31156003166BRIAR INVESTMENTS LLC2390 NE 171ST STNORTH MIAMI BCH, FL 33160---0 24754202761BRIAR INVESTMENTS LLC2390 NE 171ST STNORTH MIAMI BCH, FL 33160---0 24754202842BRIAR INVESTMENTS LLC2390 NE 171ST STNORTH MIAMI BCH, FL 33160---0 24754202826BRIAR INVESTMENTS LLC2390 NE 171ST STNORTH MIAMI BCH, FL 33160---0 24754202787BRIAR INVESTMENTS LLC2390 NE 171ST STNORTH MIAMI BCH, FL 33160---0 24754202745BRIGNALL TR, LEONARD A & MARY LEONARD & MARY BRIGNALL TRUST UTD 8/6/017340 SAINT IVES WAY APT 3208NAPLES, FL 34104---609228273750363BRITTON, JAMES H & KAREN S4033 SELMA ROADSPRINGFIELD, OH 45502---028273750460BROZEK REV TRUST3923 LITTLETON BEND CTJACKSONVILLE, FL 32224---0 28405000409BRUNO, JOSEPH A & COLLEEN M 91 SUNSET DRIVESTUYVESANT, NY 12173---0 31156000062BRZOVSKI REVOCABLE TRUST1565 GARLAND CRESCENTPICKERING L1V 7B2 CANADA 46573004364BSR INVESTING & CONSULTING INC 1811 19TH ST SWNAPLES, FL 34117---046573003925BSR INVESTING & CONSULTING LLC 1811 19TH ST SWNAPLES, FL 34117---046573002269BSR INVESTING & CONSULTING LLC 6017 PINE RIDGE ROAD #373NAPLES, FL 34119---046573002900BUCKLEY, GERALD L & ANDREA B 7340 ST IVES WAY #3305NAPLES, FL 34104---028273750509BUCKNELL, TIFFANY REBOLETTI 1808 N 77TH CTELMWOOD PARK, IL 60707---0 31156001265BURCREST CAPITAL LLCHP EDIFICIO MOSSFON 2 PISOCALLE 54 ESTE PANAMA46573004704BURGARETTA, FRANK & PATRICIA 23 LENOX RDJACKSON, NJ 08527---6326 31156005708BUTLER, RICHARD & PAM9 SAWMILL HILL RDMECHANICVILLE, NY 12118---3101 24754204769BUTLER, TAMMY DJACQUELYN A MARTIN319 SE DOUGLAS #203LEE'S SUMMIT, MO 64063---0 31156001388C2S FLORIDA LLC44 W FLAGLER STREETSUITE 2300MIAMI, FL 33130---046573003242CALDERON, DIANA MILENA1265 WILDWOOD LAKES BLVD #205NAPLES, FL 34104---031156000664CAMARDA, ANALIA E124 SANTA CLARA DR APT 1NAPLES, FL 34104---541446573000960CAMILIERE, SUSAN EKENNETH D'ALESSANDRO618 GOLFERS LNBARTLETT, IL 60103---1536 31156003441CARCHIDI, MARK D & MARCIA G JOHN W & MARY A GORDON JR 370 COTUIT RDSANDWICH, MA 02563---2429 28405000344CAREY, AGNES7360 SAINT IVES WAY #2307NAPLES, FL 34104---028267500545CARMONA, CLARA INEZ177 SANTA CLARA DR APT 2NAPLES, FL 34104---543446573003226CARMONA, JAVIER & INES7773 SAVANNAH COURTNAPLES, FL 34104---046573000384CARPE DIEM HACIENDA LLC27830 HACIENDA EAST BLVD#204-CBONITA SPRINGS, FL 34135---0 31156006587CARPIO JR, JOSEPH JJEAN M MACDONALD-CARPIO62 ROSES FARM RDEAST HAVEN, CT 06512---4665 31156000444CARRANCO, MIGUEL ANGELMIRNA D DIAZ132 SANTA CLARA DR APT 15NAPLES, FL 34104---541546573001561CARROLL, GLENNDEWANNA JOLENE CARROLL168 PLANTATION CIRNAPLES, FL 34104---640067965017456POList_500_PL202000005649.A.5.d Packet Pg. 1521 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 6CARTER JR, ROBERT H & HELEN C 7360 PROVINCE WAY APT 4310NAPLES, FL 34104---6062 28405000603CARZAL LLC 12936 VIOLINO LN #303NAPLES, FL 34105---0 46573001228CARZAL LLC 12936 VIOLINO LN #303NAPLES, FL 34105---0 46573004225CASTRO, RUDY B 1150 WILDWOOD LAKES BLVD #303NAPLES, FL 34104---0 31156002743CATES, BRIAN & TERESA 2030 SNOOK DRNAPLES, FL 34102---0 31156001621CELLA PROPERTIES FL, LLC 1206 MIDDLE COUNTRY RDSELDEN, NY 11784---2524 31156000169CHACON, ALEXANDER JOSE BRITO M DEL CARMEN CHACON DE BRITO 1260 WILDWOOD LAKES BLVD #303 NAPLES, FL 34104---0 31156006749CHACON, ANDREA C BRITO 1160 WILDWOOD LAKES BLVD #205NAPLES, FL 34104---0 31156003069CHANG, JACKELIN LUCIA CASTILLO THOMAS REYES 1185 WILDWOOD LAKES BLVD #203 NAPLES, FL 34104---0 31156002222CHAVEZ, ROSA 132 SANTA CLARA DRIVE #14NAPLES, FL 34104---0 46573001545CHAVIB, JULIET 193 SANTA CLARA DR #7NAPLES, FL 34104---0 46573004128CHAWANASUNTHORNPOT, PAWIN LEMANDA FRANKLIN 21164 HAYSHIRE COURT ASHBURN, VA 20147---0 31156002620CHEGWIDDEN, NIALL & CHERYL 4940 DEERFIELD WAY APT 201NAPLES, FL 34110---2308 24754203922CHERYL A IULIANO REV TRUST 13 JOHN ROADPEABODY, MA 01960---0 28380600005CHIARILLO, ROBERT M JACQUELINE T CHIARILLO 3 LINDSEY DRIVE LINCOLN, RI 02865---0 28381080006CHINITA PROPERTIES LLC 4610 SAINT CROIX LN #1037NAPLES, FL 34109---0 46573001642CHISMA LLC 7960 PRESERVE CIR # 627NAPLES, FL 34119---0 46573002544CHISMA LLC 7960 PRESERVE CIR # 627NAPLES, FL 34119---0 46573000740CHUMACHOK, SERGIY & LARYSA 1170 WILDWOOD LAKES BLVD #103NAPLES, FL 34104---0 31156003263CIBELLI, ANTHONY & VERONICA 2258 CHABLIS DRMACUNGIE, PA 18062---0 31156005928CIBELLI, ANTHONY J 2258 CHABLIS DRMACUNGIE, PA 18062---0 31156006804CICCHELLI, ANALYN A 1304 WILDWOOD LAKES BLVD #6NAPLES, FL 34104---6478 24754202525CLARK, CHRIS & LISA 10 KIM PLKINGS PARK, NY 11754---5023 31156001964CLEMMENSEN, PAUL L & KRISTIN A 156 PLANTATION CIRNAPLES, FL 34104---6484 67965018206COB REALTY TRUST 21 DEER CROSSINGSEABROOK, NH 03874---0 28405000263COLE, CAMERON M 201 SANTA CLARA DRIVE #10NAPLES, FL 34104---0 46573004827COLLIER CNTY C/O REAL PROPERTY MANAGEMENT 3335 TAMIAMI TR E, STE 101 NAPLES, FL 34112---0 00400248006COLLIER CNTY C/O REAL PROPERTY MANAGEMENT 3335 TAMIAMI TR E, STE 101 NAPLES, FL 34112---0 00400244505COLLIER CNTY C/O REAL PROPERTY MANAGEMENT 3335 TAMIAMI TR E, STE 101 NAPLES, FL 34112---0 00400120001COLLIER CNTY C/O REAL PROPERTY MANAGEMENT 3335 TAMIAMI TR E, STE 101 NAPLES, FL 34112---0 00400246309COLLIER CNTY C/O REAL PROPERTY MANAGEMENT 3335 TAMIAMI TR E, STE 101 NAPLES, FL 34112---0 00400246406COLT, LYNDA R1240 WILDWOOD LAKES BLVD # 204NAPLES, FL 34104---5804 31156005847COLTON, AUTUMN JOY 707 DELAWARE TRLMERCER, PA 16137---0 31156002727CONCANNON, JOHN F & JEAN M 18013 66TH CTTINLEY PARK, IL 60477---4104 28273750567CONNELL, MICHAEL 443 QUINCY SHORE DR APT 1N QUINCY, MA 02171---0 31156000868CONNELLY, FREDERICK E 7360 PROVINCE WAY #4301NAPLES, FL 34104---6061 28405000425CONNORS, PAUL J CELINE COOLEY-CONNORS 4185 REGENTS PARK HAMBURG, NY 14075---1361 28405000302CONSTANTINE JR, WARREN J 14 SPRING MILL LNCOLLEGEVILLE, PA 19426---4400 46573003860CONSTANTINE JR, WARREN J 14 SPRING MILL LNCOLLEGEVILLE, PA 19426---4400 46573002641COOPER, FRANK & MARIA E 4158 LORRAINE AVENAPLES, FL 34104---4737 46573001024COOPER, FRANK W & MARIA E 4158 LORRAINE AVENAPLES, FL 34104---4737 46573004584COOPER, FRANK W & MARIA E 4158 LORRAINE AVENAPLES, FL 34104---4737 46573001862COOPER, FRANK W & MARIA E 4158 LORRAINE AVENAPLES, FL 34104---4737 46573001943COOPER, FRANK W & MARIA E 4158 LORRAINE AVENAPLES, FL 34104---4737 31156003522CORAIZIN, KAYLA MAURICIO ESCOBAR 1280 WILDWOOD LAKES BLVD #204 NAPLES, FL 34104---0 31156007447CORIO, MATTHEW BRYAN 150 SANTA CLARA DRIVE #5NAPLES, FL 34104---0 46573002007CORNELL, LILLY 1025 RICHMOND ROAD #2401OTTAWA K2B 8G8 CANADA 31156007544COSETTA, ROBERT J & LINDA S 230 KAUFMAN RDSOMERSET, MA 02726---2650 31156004123COSTAS, RICARDO 15275 COLLIER BLVD 201/269NAPLES, FL 34119---0 46573001781COUNTRY HAVEN COMMONS ASSOC % R & P MANAGEMENT 2500 AIRPORT RD S STE 310 NAPLES, FL 34112---4803 28480162003COUNTRYSIDE MASTER ASSOC INC 600 COUNTRYSIDE DRNAPLES, FL 34104---6711 28536700209COVELL, STEPHEN MICHAEL RENEE MARIE COVELL 1349 GOVENORS RUN COURT OFALLON, MO 63366---0 31156001061CRAMPTON, DAVID C & SUZANNE M 7251 ORLIN CT NEROCKFORD, MI 49341---8489 28273750428CRISTO-GUERRERO, MINERVA 3687 RECREATION LANENAPLES, FL 34116---7335 31156004709CROSBY, SERYOZHA D 3373 BALTIC DRIVENAPLES, FL 34119---0 31156006600CROWN, NANCY E ROBERT=& TERRY L CROWN NANCY M CROWN 9925 BOCA CIR NAPLES, FL 34109---7315 24754204387CRUZ, GEORGE GABRIEL YUNISLEIDY CRUZ 1260 WILDWOOD LAKES BLVD UNIT 206 NAPLES, FL 34104---0 31156006684CUDMORE, CHRISTOPHER MIRANDA CUDMORE 13 EAGLESTONE LANE BARRIE I4N 0H8 CANADA 31156001304POList_500_PL202000005649.A.5.d Packet Pg. 1522 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 7CUELLO, OSLEIDY FERNANDEZ 5221 30TH AVE SWNAPLES, FL 34116---8003 46573002285CURTIS & CINDA WILSON TRUST 161 PLANTATION CIRCLENAPLES, FL 34104---6443 67965016907CYPRESSTONE LLC % CATHY TIRRI 4034 EAGLES NEST DR VALRICO, FL 33596---0 46573001008D'ACHILLE, JOHN M & CECILIA V 6338 C DURHAM DRLAKE WORTH, FL 33467---8718 46573002609DACK HOLDINGS LLC 562 BLUEBERRY PLACEFRANKLIN LAKES, NJ 07417---0 31156003865DALAKIS, MICHAEL CHRISTA DALAKIS 1831 ELGIN DR VIENNA, VA 22182---0 31156001100DALESSANDRO SR, JOHN M TONI ANN DALESSANDRO 109 LAREDO AVENUE STATEN ISLAND, NY 10312---0 31156005960D'AUTILIO, DANA A 52 WHITE MOUNTAIN WAYBRIDGTON, ME 04009---0 31156002109DAVID HEFFEL TRUST ANN HEFFEL TRUST 70 HEMLOCK LANE HALIFAX, MA 02338---0 28267500587DAVID J LAPORTE LIV TRUST KAREN E LAPORTE LIV TRUST 269 HOPE RD CRANSTON, RI 02921---0 31156001582DE BRUUN, SONIA PARADA 150 SANTA CLARA DR # 150-6NAPLES, FL 34104---7485 46573002023DE CARVALHO, SIOMARA 150 SANTA CLARA DR #9NAPLES, FL 34104---0 46573003200DECARVALHO, SIOMARA 150 SANTA CLARA DR APT 9NAPLES, FL 34104---5416 46573002146DECARVALHO, SIOMARA 150 SANTA CLARA DR APT 9NAPLES, FL 34104---5416 46573002081DECK, MARY JANE 7340 SAINT IVES WAY APT 3107NAPLES, FL 34104---6005 28273750143DEGRAND, SCOTT DAVID MARTIN 1376 WILDWOOD LAKES BLVD #8 NAPLES, FL 34104---6470 24754200967DEIN TR, ROBERT & DORIS ROBERT P DEIN LIVING TRUST UTD 09/14/00 15 WILLOW BRIDGE WAY UNIT D BLOOMINGDALE, IL 60108---2833 28380720008DEINYS, SHEYLA RODRIGUEZ 1280 WILDWOOD LAKES BLVD #102NAPLES, FL 34104---0 31156007243DEJORDY, KAREN MICHAEL DEJORDY 1696 RIDGE TOP WAY CLEARWATER, FL 33765---1830 31156006545DEL CAMPO TR, DENNIS PAUL 52140 GRIGGS RDWELLINGTON, OH 44090---9204 31156006024DELBELLO, DONALD W 24 HUNT RDSOMERSET, NJ 08873---1742 28273750062DELETRAZ, ANDRES ALBERTO SARMIENTO 1664 PISO 6 CSAN MIGUEL 1663 ARGENTINA 31156003344DEQUINZIO, ALBERT T & TERESA M 7360 PROVINCE WAY APT 4202NAPLES, FL 34104---6059 28405000247DERIY, BORIS & LUDMILA ALEXANDER B DERIY 5 BURR OAKS COURT BOLLINGBROOK, IL 60440---1285 31156002206DERIY, BORIS N & LUDMILA V ALEXANDER B DERIY 5 BURR OAKS COURT BOLLINGBROOK, IL 60440---1285 31156000745DESIR, MAX & MARIE M 164 PLANTATION CIRNAPLES, FL 34104---6400 67965017553DESMARAIS, PAUL F 1185 WILDWOOD LAKES #7 208NAPLES, FL 34104---0 31156002329DILLON, CHRISTOPHER 100 SANTA CLARA DR #15NAPLES, FL 34104---0 46573000287DINATALE, BEVERLY 259 LASALLE DRWEBSTER, NY 14580---3919 31156006260DINIRO, JOHN R KATHY A DINIRO 7360 PROVINCE WAY APT 4101 NAPLES, FL 34104---6058 28405000027DODD, PETER J & ANGELA MARIE 4359 RTE 516MATAWAN, NJ 07747---0 24754203304DOMETROVICH, JOHN MARK9716 VAN STRATTAN CTHUNTERSVILLE, NC 28078---5918 31156005821DONAGHEY, JOHN & SHANNON S 11890 N 103RD PLSCOTTSDALE, AZ 85260---0 31156007489DONOVAN, CATHERINE A 6423 83RD PLMIDDLE VILLAGE, NY 11379---2421 28405000506DONZELLI, ROSE ANNE 7360 SAINT IVES WAY #2106NAPLES, FL 34104---0 28267500121DORNER, MARTIN & HELEN SVOBODA 222 MARJAN CROTTAWA K2J 0N2 CANADA 31156003328DOUGLAS A HALL LIV TRUST 2679 GREEN MEADOWS DRTRAVERSE CITY, MI 49685---8674 28380240009DP1 PROPERTIES LLC 308 SPIDER LILY LANENAPLES, FL 34119---0 31156004482DP1 PROPERTIES LLC 308 SPIDER LILY LANENAPLES, FL 34119---0 31156004288DUANE A CHILGREN REV TRUST JOY A CHILGREN REV TRUST 714 TORCHWOOD DRIVE NEW BRIGHTON, MN 55112---0 31156000567DUGGAN, JAMES P & MADONNA M 7360 PROVINCE WAY #4105NAPLES, FL 34104---0 28405000108DWORNIK, ADINA J & KENNETH 128 WILSON RDCLINTON, PA 15026---1512 46573003268EAKIN, RICHARD P & NELLA 1275 WILDWOOD LAKES BLVD # 206NAPLES, FL 34104---5818 31156000282ECKARDT, DANIEL LUISA CASSIA ESTRADA DEL PAI VANONE OASIS TWR8 ANDAR 32 AP COLOGNE MACAO SAR CHINA 31156004602EDDY JR, THOMAS J ABIGAIL ROSE EDDY 1220 WILDWOOD LAKES BLVD # 303 NAPLES, FL 34104---5806 31156005148EL SHINNAWY, IHAB AMY ESTEP 72 MOONBEAM COURT HAMILTON L9C 0A8 CANADA 24754201788ELENI EXARHOS REV TRUST 9 DARTMOUTH STREETPEABODY, MA 01960---1301 31156006464ELFRA LLC 143 MILL RDNORTH ANDOVER, MA 01845---5528 31156001443ELLIS-HICKS, SANDRA CARLETON HICKS JR 7360 SAINT IVES WAY APT 2201 NAPLES, FL 34104---6098 28267500228ENGELS JR, PETER J & RENEE M 4079 REFORESTATION RDSUAMICO, WI 54313---8505 28267500286ERICKSON, CATHERINE 171 PLANTATION CIRNAPLES, FL 34104---6443 67965017155ERTEL, GREGORY V & CYNTHIA J 88 CAMBRIDGE DRIVE SOUTHWINDSOR, CT 06074---0 46573001066ESMOND, ROBERT E 1381 WILDWOOD LAKES BLVD #7NAPLES, FL 34104---6473 24754203980ESPANA, NORBERTO & MARIA E 34 NORTHGATE BLVDBRAMPTON L6S 4A6 CANADA 31156003221ESTER BRADA REV TRUST HABROS 3MAZKERETBATYA ISRAEL46573004649EVA VIEAU REV TRUST8283 VALIANT DRNAPLES, FL 34104---046573001529FAKHRI, HENRY & LIZETH11359 NW 53RD LANEDORAL, FL 33178---031156003548FAKHRI, HENRY J & LIZETH11359 NW 53RD LNDORAL, FL 33178---352131156002303POList_500_PL202000005649.A.5.d Packet Pg. 1523 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 8FALENCIK, PIOTR & DOROTA 1280 WILDWOOD LAKES BLVD #104NAPLES, FL 34104---0 31156007285FARLEY, PAUL & FRANCESCA 503 DOUBLETREE LANENEW MARKET L3X 2L2 CANADA 31156005106FARO INTERNATIONAL GROUP LLC 920 HONEYBEE DRIVENAPLES, FL 34120---0 31156006147FEDERAL HOME LOAN MTG CORP 800 JONES BRANCH DRMCLEAN, VA 22102---0 46573000847FEDIANOVA, VERONIKA SIXTO CASAS 1205 WILDWOOD LAKES BLVD # 206 NAPLES, FL 34104---5815 31156001485FEDIANOVA, VLADISLAVA V 1250 WILDWOOD LAKES BLVD #106NAPLES, FL 34104---5803 31156006121FEELEY, TIMOTHY P ELIZABETH A FEELEY 5S564 KIRK PL NAPERVILLE, IL 60563---1956 31156006383FEENEY, OWEN 11398 STRATHAM LOOPESTERO, FL 33928---3245 46573003129FEINDEL, CHRISTOPHER MARY ANN LUKACHKO 99 COLLEGE VIEW AVE TORONTO M5P 1K2 CANADA 28405000564FELDMAN, ALEXANDRA 2652 CROPSEY AVE #11FBROOKLYN, NY 11214---0 24754200886FELIPE, LEIDA GOVIN 108 SANTA CLARA DRIVE #8NAPLES, FL 34104---0 46573000465FENWICK, PHILLIP 457 TWO ROD RDMARILLA, NY 14102---9748 31156005342FENWICK, PHILLIP 457 TWO ROD RDMARILLA, NY 14102---9748 31156004929FERGUSON JR, ROBERT C & MAURA 45 DANELLA WAYHOWELL, NJ 07731---8913 31156000787FERRARI, PAOLO 28 VALLEYWOOD RDCOS COB, CT 06807---2329 46573003446FERRARI, PAOLO 4411 WILDER RDNAPLES, FL 34105---2528 46573002243FERRARI, PAOLO 4411 WILDER RDNAPLES, FL 34105---2528 46573002324FERRARO III, ALBERT M 1180 WILDWOOD LAKES BLVD #108NAPLES, FL 34113---0 31156003768FEUCHT, GREGOR 1195 WILDWOOD LAKES BLVD # 108NAPLES, FL 34104---5814 31156001760FILIPOV, ALEKSEY 40 CLANCY DRIVETORONTO M2J 2V8 CANADA 31156007023FISHELL, CHLOE GREGORY FISHELL 1270 WILDWOOD LAKES BLVD #303 NAPLES, FL 34104---0 31156007146FRANCO, CARLOS 9527 ROUNDSTONE CIRFORT MYERS, FL 33967---5142 24754200925FRANKOSKI, ANTHONY & LARAINE 67 EDGEWOOD AVENUEWEST ORANGE, NJ 07052---0 31156004903FRAUENGLASS, LLOYD LUCY N NEDIALKOVA-FRAUENGLASS 1500 BEDFORD ST #201 STAMFORD, CT 06905---0 31156005986FREIBERG, ROBERT ERIKA VILLAFAN 169 PLANTATION CIR NAPLES, FL 34104---0 67965017100FUNG, ALFRED & IRENE 6840 BEACH RESORT DR APT 2NAPLES, FL 34114---1526 31156005562FUNK, ANDREW J & DEANNA 81 LINMOUTH RDMALVERNE, NY 11565---2116 31156004864FUSCO, LIBERO LINA FUSCO 119 MURRAY DR OCEANSIDE, NY 11572---0 31156002280GABER, NADIA 1172 S DIXIE HWY # 453CORAL GABLES, FL 33146---2918 46573000481GABER, NADIA 1172 SOUTH DIXIE HWY, #453CORAL GABLES, FL 33146---0 46573002887GABINOS INVESTMENT LLC 833 COLDSTREAM CTNAPLES, FL 34104---0 31156004644GAIL M GAFFEY REV LIV TRUST 7360 PROVINCE WAY #107NAPLES, FL 34104---6059 28405000140GARCIA, ISELL P 100 SANTA CLARA DRIVE #2NAPLES, FL 34104---046573000766GARCIA, JEISSON ALBERTO A 1280 WILDWOOD LAKES BLVD #107NAPLES, FL 34104---0 31156007340GARCIA, JOSE M & MARTHA 1344 WILDWOOD LAKES BLVD #6NAPLES, FL 34104---6464 24754201568GARCIA, MIGUEL A TELLEZ HANCER MARTIN 1250 WILDWOOD LAKES BLVD #304 NAPLES, FL 34104---0 31156006367GARDEAZABAL, MELINA FIORELLA APOLONIA ODARBA FELIPE JAVIER GARDEAZABAL 1280 WILDWOOD LAKES BLVD UNIT 206 NAPLES, FL 34104---0 31156004181GARIZURIETA, DAFNE 185 SANTA CLARA DR #4NAPLES, FL 34104---5433 46573003585GARNET & EARTH INC 2000 N BAYSHORE DRIVE #328MIAMI, FL 33137---0 46573001480GARRISON, MOSES & LINDA 727 AIRPORT RDPALMYRA, PA 17078---9785 31156004628GAWLINSKI, FRANK A 116 SANTA CLARA DRIVE #2NAPLES, FL 34104---0 46573000669GC IT SLTN 401 (K) PLAN TRUST 42476 UNICORN DRIVESOUTH RIDING, VA 20152---0 31156003661GEACH, ROBERT E & ANNA M 167 PLANTATION CIRNAPLES, FL 34104---6443 67965017058GEARY, EILEEN DIERDRE STEVENSON 120 WEST SADDLE RIVER ROAD SADDLE RIVER, NJ 07458---0 28380320000GENNARINI, UBALDO & TERESA 26 BLOCK TERFARMINGDALE, NY 11735---6012 31156004000GENTILE, VINCENT A & MARY T 7360 PROVINCE WAY APT 4102NAPLES, FL 34104---6058 28405000043GESHKEWICH, JOHN 128 DUPEE PLACEWILMETTE, IL 60091---0 28267500189GILL, MARTHA 1280 WILDWOOD LAKES BLVD #208NAPLES, FL 34104---0 31156007528GILLIS, MARK 321 EMERALD DRIVEARNOLDS PARK, IA 51331---0 31156006163GIORDANO, MICHAEL J 1929 TANNERS COVEHEBRON, KY 41048---0 28273750169GOMEZ, OLGA I 4101 GOLDEN GATE PARKWAY #8NAPLES, FL 34116---0 46573002308GONIS, NICHOLAS G 1190 WILDWOOD LAKES BLVDNAPLES, FL 34104---5808 31156004084GONNELLA, RUDOLPH J & ELLEN A 609 103RD AVE NNAPLES, FL 34108---0 31156000622GONZALEZ, AURORA TERRAZA 201 SANTA CLARA DR # 2NAPLES, FL 34104---0 46573004665GONZALEZ, OLISDAY FERRER 1270 WILDWOOD LAKES BLVD #104NAPLES, FL 34104---0 31156006888GOOD WAVE INVESTMENTS INC 1160 WILDWOOD LAKES BLVD #101NAPLES, FL 34104---031156002824GOODFELLOW, ALISON P363 COURTLAND AVENUEDORVAL H9S 2R8 CANADA 31156001647GOODING, JOHN M & LUCIA M4361 LORRAINE AVENAPLES, FL 34104---474031156007463POList_500_PL202000005649.A.5.d Packet Pg. 1524 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9GORDINSKAYA, TAMARA 1636 SPOONBILL LN #ANAPLES, FL 34105---0 31156006286GORDON, TOM & CINDY 26 PINEHURST DRBOURNE, MA 02532---0 28267500105GORMAN, SUZANNE W 3971 JASMINE LAKE CIRNAPLES, FL 34119---7956 24754203207GOSELIN, CHRISTY L 22019 ROSEMARY RDFRANKFORT, IL 60423---3147 31156004848GRANADA LAKES LLC 9001 HIGHLAND WOODS BLVD #7BONITA SPRINGS, FL 34135---0 46573000041GRANDPIERRE, OLIVER KAPELLENSTR 9HUENSTETTEN 65510 GERMANY 31156002785GREGORY, JACKIE L 112 ROGERS STHARTSVILLE, TN 37074---0 46573000122GRIETA INVESTMENT CORP 17501 BISCAYNE BLVDAVENTURA, FL 33160---0 31156002484GRINDLAY, MAUREEN R 905 FAIRHAVEN COURTNAPLES, FL 34104---0 28380280001GROTE, GEORGE W & BARBARA L 349 HENLEY DRNAPLES, FL 34104---0 31156005407GUEVARA, THOMAS MATEO JESSICA D BOUCHARD GUEVARA 1210 WILDWOOD LAKES BLVD #206 NAPLES, FL 34104---0 31156004686GUIHO, MARC 225 ALVIN RD #304OTTAWA K1K 4H6 CANADA 31156003645GUNGOR, HALIL IBRAHIM 1210 WILDWOOD LAKES BLVD #304NAPLES, FL 34104---0 31156004767GUTIERREZ, LUIS VERONICA GUTIERREZ 1352 WILDWOOD LAKES BLVD #2 NAPLES, FL 34104---0 24754201160GUTIERREZ, MARIA L 1250 WILDWOOD LAKESNAPLES, FL 34104---0 31156006040H J LICHY & N B LICHY FM TRUST 10650 BEARD AVE S #204BLOOMINGTON, MN 55431---0 28405000205HAIGHT, KRISTIN LEWIS 3 CAMBRIDGE COURTKENNEBUNK, ME 04043---0 28273750020HAPKE, KENNETH W & MARGIE E 816 W ELKCAM CIR # 806MARCO ISLAND, FL 34145---2244 46573003666HARRIS, ALAN S & ROSEMARY L 163 PLANTATION CIRNAPLES, FL 34104---0 67965016952HARVEY, BRENDA JOYCE 7786 SCARLET CTNAPLES, FL 34104---0 67965017757HAYES, SHIRLEY A 20109 BALLYLEE CTESTERO, FL 33928---0 31156001508HAZELL, KAREN E 1265 WILDWOOD LAKES BLVD #3 204NAPLES, FL 34104---0 31156000648HEALEY, CHARLES F & LORRAINE K 22 BREK DRIVEMERRIMAK, NH 03054---0 28273750305HEIDTMAN, HAL H CARRIE ZANVILLE 7260 SLOOP CT MAUMEE, OH 43537---0 31156001223HELLU, JAMIL JORGE 7360 SAINT IVES WAY APT 2310NAPLES, FL 34104---6099 28267500600HEMPHILL, LIA 4380 27TH CT SW PAR ONE #1, BLDG 1-301 NAPLES, FL 34116---0 46573001464HENDRICKS, BRIAN 721 14TH ST NENAPLES, FL 34120---9405 24754201843HENSRUD, MICHAEL 2170 DE LA PLANTATIONST LAZARE J7T 2H6 CANADA 46573001749HENSRUD, MIKE 2170 DE LA PLANTATION STST LAZARE J7T 3E4 CANADA 46573004542HERINA TR, PETER & ANGELA P & A HERINA LIVING TRUST 7340 PROVINCE WAY # 3306 NAPLES, FL 34104---0 28381000002HERRERA, JAVIER 169 SANTA CLARA DR #6NAPLES, FL 34104---5437 46573002984HERZEL YOSI REV TRUST SADE IZHAKKIRYAT MALAKHL 83022 ISRAEL 46573000164HOFFMAN, ROBERT T & SUSAN J 609 FIELDWOODS DRCONWAY, SC 29526---0 31156005449HOGAN, THOMAS A 10 GREEN LINKS TURNAUBURN, NY 13021---9636 46573003624HOLANDA LLC 3377 HIBISCUS AVENAPLES, FL 34104---0 31156001702HORD, ANN M 696 BROOKPARK RDMARION, OH 43302---5881 28273750444HORNER TR, GEORGE L & JUDITH M G L HORNER & J M HORNER TRUST UTD 12/31/07 2831 CHIEF WILLIAM DR # 18 FAIRBANKS, AK 99709---4870 28380840001HSU, HSIAO-LAN T 2303 NICASIO PLCEDAR PARK, TX 78641---0 31156004547HUDSON CAPITAL FUND LLC 26-26 14TH ST 1ST FLOOR ASTORIA, NY 11102---0 31156004783HUDSON CAPITAL FUND LLC 26-26 14TH ST 1ST FLOOR ASTORIA, NY 11102---0 31156004806HUNNISETT, GEOFFREY 213 MUTUAL STREETTORONTO M5B 2B4 CANADA 31156002882HUSSIN, THOMAS & JULIE 7360 SAINT IVES WAY APT 2103NAPLES, FL 34104---6087 28267500066I F & C A JENNINGS RV LV TRUST 7360 PROVINCE WAY #4208NAPLES, FL 34104---0 28405000360IACOVELLI, DAVID & EILEEN 9 TAFT CIRCLEHOPEDALE, MA 01747---0 28273750389IBIS INVESTMENTS LLC 6151 EVERETT STNAPLES, FL 34112---0 28273750240IGLESIAS, MAYLIN LOPEZ DAYRON HERNANDEZ 1160 WILDWOOD LAKES BLVD #203 NAPLES, FL 34104---0 31156003027IRGAVE INC 2000 N BAYSHORE DRIVE SUITE 328MIAMI, FL 33137---0 46573002829ISUFAJ, ARMELA 9471 JANE STREET UNIT 108VAUGHAN L6A 4J2 CANADA 31156005740IVANOV, IVAN & DIANA 11 BUGLE HILL ROADTORONTO M1T 1C5 CANADA 31156007421IVANOV, IVAN I & DIANE 11 BUGLE HILL ROADSCARBOROUGH MIT 1C5 CANADA 31156004563IZOWER, LUIS B GINA MORRIS-IZOWER 342 N FARVIEW AVE PARAMUS, NJ 07652---4631 31156000907J F & M M LOPES LIVING TRUST 45 SYCAMORE STREETSWANSEN, MA 02777---0 28267500260J M & C B COLLINS IRREV TRUST PO BOX 1812NORTH CONWAY, NH 03860---0 28405000124JAGGE, FINN CHRISTIAN TRINE-LISE JAGGE SUNDVEIEN 18 OSLO 0198 NORWAY 31156001540JAMES ROBERT BRYAN LLC 3530 CRYSTAL COURTMIAMI, FL 33133---0 31156004987JIMENEZ ET AL, SUSANA MORA 190 SANTA CLARA DR #3NAPLES, FL 34104---0 46573003886JOHN J LALLY REV LIV TRUST 1250 WILDWOOD LAKES BLVD #104NAPLES, FL 34104---0 31156006082JOHNSON, SHERRY ANN 3 WEYBRIDGE LANEHOPKINTON, MA 01748---0 31156004026POList_500_PL202000005649.A.5.d Packet Pg. 1525 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 10JOHNSTON, ALAN & NADKA 1 GARLEFFIN COTTAGE BALLANTRAE GIRVAN KA26 0PA SCOTLAND 31156002002JORZ, RICHARD M KATHLEEN HARTMAN 6709 GRANDVIEW DRIVE INDEPENDENCE, OH 44131---0 31156005245JOYCE, GERALDINE M 9 H BEAL'S COVE RDHINGHAM, MA 02043---2363 28267500464JUSKIEWICZ, KRISTINE 7340 PROVINCE WAY #3104NAPLES, FL 34104---0 28380160008K & R HOMETECH LLC 131 25TH STREET SWNAPLES, FL 34117---0 46573003022K&R HOMETECH LLC 132 SANTA CLARA DR #5NAPLES, FL 34104---0 46573001367KACHMAR, SANDRA 5 BUCKINGHAM LNBUFFALO GROVE, IL 60089---0 31156004961KALVEL, PETER & IRENA 2601 S ROOSEVELT BLVD #104CKEY WEST, FL 33040---0 31156003726KAREN, BONNIE R CARLOS A LEANIZ 1180 WILDWOOD LAKES BLVD #104 NAPLES, FL 34104---0 31156003687KARPOVICH, ANDREI 1160 WILDWOOD LAKES BLVD #9-306NAPLES, FL 34104---0 31156003205KASIAN, JOHN A & SUSAN G 7340 PROVINCE WAY #3105NAPLES, FL 34104---0 28380200007KAVALLIERATOS, NICOLAOS 50 SUNNYSIDE AVETARRYTOWN, NY 10591---3813 46573000928KAVALLIERATOS, NICOLAOS HARALAMBOS TSIOUTAS 1633 BROADWAY FL 3RF NEW YORK, NY 10019---6708 31156002507KELLY, JAMES E & JESSICA S 6962 EMMA COURTWARRENTON, DC 20187---0 28405000548KENT, GREG & BONNIE 46 PERRIN AVENEPEAN K2J 2X5 CANADA 31156004369KERSTENS, BRANDON M 961 NORTH DOHENY DRIVE UNIT 1/4WEST HOLLYWOOD, CA 90069---0 31156001566KESSLER, JOHN & BEATA 14605 W WILKENS PLPLAINFIELD, IL 60544---7663 31156005805KNIGHT, CRAIG 1377 WILDWOOD LAKES BLVD #8NAPLES, FL 34104---6472 24754203045KNUDSEN, TIMOTHY & SUSAN 1350 WILDWOOD LAKES BLVDNAPLES, FL 34104---6450 24754201089KOLEV, STANISLAV E TATYANA I VOUCHEVA 13496 CAMBRIDGE LN NAPLES, FL 34109---3907 31156003483KOMODI, ZOLTAN PO BOX 9711NAPLES, FL 34101---0 46573000562KOPPER, HERMANN & MARIA E 5705 SEA GRASS LANENAPLES, FL 34116---0 46573001309KOSTADINOV, PETER & MONICA 1230 WILDWOOD LAKES BLVD #305NAPLES, FL 34104---0 31156005588KOSTAN, NICHOLAS & KATHLEEN 83 GRANT RDLYNN, MA 01904---1212 28405000182KRAMER, DANIEL A & TAMMY S 5039 MALLET HILL DRIVECINCINNATI, OH 45244---0 28267500367KRANSEL, ANGELA M CINDY L PICKETT 153 SANTA CLARA DR #6 NAPLES, FL 34104---0 46573002340KRIST, ERIC T 1265 WILDWOOD LAKES BLVD UNIT #103NAPLES, FL 34104---0 31156000460KRIZEK, IVO 6195 RESERVE CIR #1303NAPLES, FL 34119---0 31156007382KRIZEK, IVO 6195 RESERVE CIR #1303NAPLES, FL 34119---0 31156000020KRIZEK, IVO 6195 RESERVE CIR #1303NAPLES, FL 34119---0 31156004741KRYEKURTI, KUJTIM 309 W 30TH ST APT 7CNEW YORK, NY 10001---0 31156007081KRZEMINSKI JR, EDWARD P 4240 BURTON ROADNAPLES, FL 34104---0 31156004165KVC CLEANING SERVICES INC 100 SANTA CLARA DR # 8NAPLES, FL 34104---0 46573000148KYTHREOTIS, LEO & DIANNE C 3906 TAMIAMI TRL E STE 1NAPLES, FL 34112---6251 46573002463LAKE, SUZANNE 1195 WILDWOOD LAKES BLVD #207NAPLES, FL 34104---0 31156001906LAKEVIEW CONDO LLC % WILLIAM KLOHN 1630 DOLPHIN RD NAPLES, FL 34102---0 31156001126LANDCOLE & MYB LLC 1810 BALD EAGLE DR #ANAPLES, FL 34105---0 46573002722LANDEROZ, GUS & MARTHA 676 SANDPIPER DRIVENEW LENOX, IL 60451---0 28380080007LANDRIGAN, MICHAEL 18 LENORE PLSMITHTOWN, NY 11788---2706 46573002942LANGER, PETER F & GEORGEA M 2720 CALLOWAY CTCANTON, MI 48188---0 28381160007LANSING, JOHN ANTHONY & CINDY 1207 MARIE STGREENDALE, IN 47025---1237 28267500147LARSON TR, EDWARD I & SHARON S EDWARD & SHARON LARSON TRUST 7340 PROVINCE WAY APT 3202 NAPLES, FL 34104---6052 28380480005LAUKAITIS, PAUL M & AMY M 233 ORCHARD PARK BLVDROCHESTER, NY 14609---0 28380960004LAWRENCE A DELK DEC OF TRUST 11812 HARRISON RDHUNTLEY, IL 60142---0 28273750127LAWRENCE, STEVEN R 1400 CREST WAYYORK, PA 17403---9102 24754200909LAZARO, MISAEL J GONZALEZ 1220 WILDWOOD LAKES BLVD #14-203NAPLES, FL 34104---0 31156005025LEGACY NAPLES LLC 25101 CHAGRIN BLVD STE 300BEACHWOOD, OH 44122---0 00399720004LEGREGNI, LORRAINE 7360 PROVINCE WAY #4103NAPLES, FL 34104---6058 28405000069LESSARD, JACQUES & BRENDA 123 DANIEL CRESCENTPORCUPINE P0N 1K0 CANADA 31156003043LEWIS, MORRIS L 1230 WASHINGTON DRANNAPOLIS, MD 21403---4700 28267500383LICHY, ROBERT C & DIANE 7340 PROVINCE WAY APT 3101NAPLES, FL 34104---6051 28380040005LINEMAN, ALOYSIUS L & SHARON L 7340 SAINT IVES WAY #3203NAPLES, FL 34104---0 28273750266LITTLER, PETER 7340 ST IVES WAY #3307NAPLES, FL 34104---0 28273750541LJUBENOVIC, NADEZHDA STEFANOVA 6215 WILSHIRE PINES CIR #1608NAPLES, FL 34109---031156004343LOCK, KERRY D & RETA A56622 COPPERFIELD DRSHELBY TOWNSHIP, MI 48316---481131156001663LODOABA, VLAD C800 MEADOWLAND DRIVE #ONAPLES, FL 34108---031156006406LONGERNECKER, FREDERICKMAUREEN LONGERNECKER4629 NICOLE LNBETHLEHEM, PA 18017---8755 31156003700LOPEZ, ANTONIO O & MARIA C15325 SW 74 CTPALMETTO BAY, FL 33157---0 31156001841POList_500_PL202000005649.A.5.d Packet Pg. 1526 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 11LOPEZ, RAFAELA BARBARA MIGUEL A PEREZ 194 SANTA CLARA DRIVE #15 NAPLES, FL 34104---0 46573004607LORENZO, ALBERTO J ANA M LORENZO 13621 NW 9TH TER MIAMI, FL 33182---0 31156000923LORENZO, ALBERTO J & ANA M 13621 NW 9TH TERRACEMIAMI, FL 33182---0 31156001207LOSHKAREVA, EKATERINA 1235 WILDWOOD LAKES BLVD #303NAPLES, FL 34104---0 31156001142LOTHIAN, SHELLEY L 110 WOODLAWN RD E UNIT 2GUELPH N1E 1B7 CANADA 31156004408LOUGHNEY, ILENE E DAWN LOUGHNEY RAUCCIO 7340 SAINT IVES WAY #3104 NAPLES, FL 34104---6005 28273750088LOUISE KING TRUST 421 FOREST STREETDUNSTABLE, MA 01827---2500 31156001728LUCIR LLC 9901 NW 80TH AVE #3HMIAMI, FL 33016---0 31156005782MACDONALD ET AL, DIANE 14 HAMILTON ROAD PO BOX 318 PORT ROBINSON L0S 1K0 CANADA 31156002688MACHADO, VANESSA RUSSI JESUS MACHADO 426 SW 26TH RD MIAMI, FL 33129---2227 46573000708MADDEN IRREV TRUST 36 GLEN STMANSFIELD, MA 02048---0 28267500202MADDOX, JAMES CURTIS 2103 TURTLE CREEK DR #12RICHMOND, VA 23233---0 28273750185MADSEN LIVING TRUST 4365 COYOTE LAKES CIRCLELAKE INTHE HILLS, IL 60156---0 28405000441MAGDALENA E SCHULER REV TRUST 1113 CRYSTAL CREEK PKWYWENTZVILLE, MO 63385---0 31156002400MAGUIRE, DESMOND A 1270 WILDWOOD LAKES BLVD #107NAPLES, FL 34104---0 31156006943MAINOLFI, FRANK & SUSAN 14864 EDGEWATER CIRNAPLES, FL 34114---0 24754204727MAIORI LLC 3377 HIBISCUS AVENAPLES, FL 34104---0 31156003425MAIORI LLC 3377 HIBISCUS AVENUENAPLES, FL 34104---0 31156007308MALCOLM, BARRY W 209-1177 YONGE STREETTORONTO M4T 2Y4 CANADA 28405000467MARCUS, ZIV 519 HIGHCLIFFE DRIVETHORNHILL L4J 8L3 CANADA 31156006626MARIANI, ANGELA G 1760 PLYMOUTH COURT UNIT DWHETON, IL 60189---0 46573000889MARQUARDT, CARL F & ANN MARIE 108 PINE STPORT JEFF STA, NY 11776---3161 31156003629MARTELLI, DEBRA A 1178 LAKE AVE #2CLARK, NJ 07066---0 28273750583MARTIN, NAYENI RAYDEL OJEDA FIGUEROA 1220 WILDWOOD LAKES BLVD #306 NAPLES, FL 34104---0 31156005203MARVIN, SARAH 1150 WILDWOOD LAKES BLVD #107NAPLES, FL 34104---0 31156002549MASTERSON, EDWARD H & JAIA A 16 PIKE RDPLYMOUTH, MA 02360---5949 31156002248MASTROCOLA TR, DONALD & NORMA MASTROCOLA REALTY TRUST UTD 10/12/00 7340 PROVINCE WAY APT 3103 NAPLES, FL 34104---6051 28380120006MATOZZO, THEODORE & BARBARA 63 BUCKLEY RDPATCHOGUE, NY 11772---1556 31156003962MAUREEN A PIERZCHALA REV TRUST 7380 PROVINCE WAY #5308NAPLES, FL 34104---0 28380680009MAZNEV, DIMITAR 1185 WILDWOOD LAKES BLVD #103NAPLES, FL 34104---0 31156002060MAZNEV, DIMITAR 1230 WILDWOOD LAKES BLVD #105NAPLES, FL 34104---0 31156005300MAZZUCCO, WILLIAM & ELIZABETH 8 CANTERBURY DRFORKED RIVER, NJ 08731---0 28380760000MC MINN, SUSAN B 7360 ST IVES WAY #2102NAPLES, FL 34104---0 28267500040MCBRIDE, ANDREW MASON 1185 WILDWOOD LAKES BLVD # 102NAPLES, FL 34104---5813 31156002044MCDERMOTT, MICHAEL JAMES EILEEN CONNOLLY-MCDERMOTT 159 PLANTATION CIR NAPLES, FL 34104---0 67965016855MCETTRICK, MARY ELIZABETH G 31 HERSH ROADFAIRFIELD, CT 06824---0 28405000328MCGREGOR, JOHANNE 7340 SAINT IVES WAYNAPLES, FL 34104---0 28273750282MCLEAD, DIANE J 1195 WILDWOOD LAKES BLVD #201NAPLES, FL 34104---0 31156001786MCMICHAEL, LIZ A 1270 WILDWOOD LAKES BLVD # 204NAPLES, FL 34104---5801 31156007049MCNEELEY, PATRICK J & EVE C 32642 WALKER RDAVON LAKE, OH 44012---0 31156006244MEDEIROS, CHARLES 1210 WILDWOOD LAKES BLVD #101NAPLES, FL 34104---0 31156004424MEDINA, FRANK 12671 LAKEBROOK DRORLANDO, FL 32828---0 31156006503MELLOR JR, JOHN R & JUDY K 400 SANDY CREST CTSCHENECTADY, NY 12303---4716 31156006325MENDELSOHN, RALPH J & SUSAN E 1270 WILDWOOD LAKES BLVD #106NAPLES, FL 34104---0 31156006927MENDIETA, JOSE A 7432 BRISTOL CIRCLENAPLES, FL 34120---0 46573001587MERINO, CHRISTIAN 161 SANTA CLARA DR #6NAPLES, FL 34104---0 46573002706MERINO, CHRISTIAN 161 SANTA CLARA DR #6NAPLES, FL 34104---0 46573004429MERINO, CHRISTIAN F 161 SANTA CLARA DR #6NAPLES, FL 34104---0 46573002683MERINO, CHRISTIAN F 161 SANTA CLARA DR #6NAPLES, FL 34104---0 46573004746MERINO, CHRISTIAN F JENNIFER N MERINO 161 SANTA CLARA DRIVE #6 NAPLES, FL 34104---0 46573002667MERTINE, NICOLE L KATHRYN A MERTINE 270 92ND ST #2F BROOKLYN, NY 11209---0 46573000368MESCHERSKAYA, GALINA 3115 BRIGHTON 4 ST, APT 4FBROOKLYN, NY 11235---0 31156000389MESKE, ROBERT L 1450 E POND DR APT 23OKEMOS, MI 48864---2373 31156004042MEYER, GLEN & ANGELA 474 SAMUEL HARPER COURTMT ALBERT L0G 1M0 CANADA 31156000842MIHAJLOVIKJ, ELIZABETA 1250 WILDWOOD LAKES BLVD #201NAPLES, FL 34104---0 31156005601MIHAJLOVIKJ, ELIZABETH 1250 WILDWOOD LAKES BLVD #201NAPLES, FL 34104---0 31156006189MILLER, MATTHEW ROGER 1180 WILDWOOD LAKES BLVD # 201NAPLES, FL 34104---580931156003784MILONE, VIOLET APLACIDO A MILONE15 DORA AVEWALDWICK, NJ 07463---028267500341POList_500_PL202000005649.A.5.d Packet Pg. 1527 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 12MINERVA GROUP LLC 190 SE 19TH AVEPOMPANO BEACH, FL 33060---7541 46573003828MINERVA GROUP LLC C/O JOHANNE MARCOUX PO BOX 166386 MIAMI, FL 33116---0 46573000685MINERVA GROUP LLC PO BOX 166386MIAMI, FL 33116---0 46573000203MINERVA GROUP LLC PO BOX 166386MIAMI, FL 33116---0 46573000902MINERVA GROUP LLC PO BOX 166386MIAMI, FL 33116---6386 46573003187MIRBEN LLC 1810 BALD EAGLE DRIVE UNIT ANAPLES, FL 34105---0 46573004283MIRBEN LLC 4400 N FEDERAL HWY #42BOCA RATON, FL 33431---0 46573002421MITCHELL, DOUGLAS PATRICK DOUGLAS MITCHELL KATHLEEN GLADYSZ MITCHELL 185 SANTA CLARA DRIVE #15 NAPLES, FL 34104---0 46573003802MONTANA, KIM 2821 BOSTON POST RDGUILFORD, CT 06437---0 31156007586MOORE, JAMES G 100 SANTA CLARA DRIVE UNIT #5NAPLES, FL 34104---0 46573000083MOOREHOUSE, HENRY W ELIZABETH C MOOREHOUSE 570 SHEEPSCOT RD NEWCASTLE, ME 04553---3642 31156001362MOORHOUSE III, HENRY W ELIZABETH C MOORHOUSE 570 SHEEPSCOT ROAD NEWCASTLE, ME 04553---0 31156003807MORAGA, ELIZABETH & OSCAR 1445 W FLAGLER STMIAMI, FL 33135---2208 24754203964MORALES, LUIS ARMANDO 1150 WILDWOOD LAKES BLVD UNIT 101NAPLES, FL 34104---0 31156002426MORGA, GREGORY 65 OAKDALE RDCENTERPORT, NY 11721---1530 31156005041MORRISON, IRIS 1373 WILDWOOD LAKES BLVD #5NAPLES, FL 34104---6427 24754203786MUNCH Y BACKEN LLC 1810 BALD EAGLE DR #ANAPLES, FL 34105---0 46573002201MUNCH Y BACKEN LLC 1810 BALD EAGLE DR #ANAPLES, FL 34105---0 46573000423MURLAP LLC 269 HOPE RDCRANSTON, RI 02921---2742 24754203605NAJDENI, FLORIAN & ILDA 107 TUSCANA CT #406NAPLES, FL 34119---0 31156003289NAPLES SKY REALTY LLC PO BOX 110101NAPLES, FL 34108---0 31156003182NAPOLITANO, MARY JEAN 26 ICE POND DRPORTLAND, ME 04103---0 28405000522NEAL, PETER 96 LEOMINSTER RDSHIRLEY, MA 01464---2005 46573004021NEEDLES, SCOTT STACY WITTHOFF 1000 N COLLIER BLVD STE 1 MARCO ISLAND, FL 34145---0 31156006765NEEDLES, SCOTT STACY WITTHOFF 1000 N COLLIER BLVD, STE 1 MARCO ISLAND, FL 34145---0 31156002523NESS ASSET MANAGEMENT LLC PO BOX 116386MIAMI, FL 33116---0 46573004144NESS ASSET MANAGEMENT LLC PO BOX 166386MIAMI, FL 33116---0 46573001503NESS ASSET MANAGEMENT LLC PO BOX 166386MIAMI, FL 33116---0 46573004089NESS ASSET MANAGEMENT LLC PO BOX 166386MIAMI, FL 33116---0 46573004500NESS ASSET MANAGEMENT LLC PO BOX 166386MIAMI, FL 33116---0 46573000067NESS ASSET MANAGEMENT LLC PO BOX 166386MIAMI, FL 33116---0 46573004940NESS ASSET MANAGEMENT LLC PO BOX 166386MIAMI, FL 33116---0 46573004102NESS ASSET MANAGEMENT LLCPO BOX 166386MIAMI, FL 33116---0 46573001707NESS ASSET MANAGEMENT LLC PO BOX 166386MIAMI, FL 33116---6386 46573003608NESS ASSET MANAGEMENT LLC PO BOX 166386MIAMI, FL 33116---6386 46573002489NESS ASSET MGMNT GROUP LLC RADIANT INVESTMENTS LLC PO BOX 166386 MIAMI, FL 33116---0 46573003682NESS ASSET MGMNT LLC PO BOX 166386MIAMI, FL 33116---6386 46573003747NESS ASSET MGMNT LLC PO BOX 166386MIAMI, FL 33116---6386 46573003404NESS DYNASTY LLC PO BOX 166386MIAMI, FL 33116---0 46573004380NESS DYNASTY LLC PO BOX 166386MIAMI, FL 33116---0 46573000326NESS DYNASTY LLC PO BOX 166386MIAMI, FL 33116---0 46573003307NESS DYNASTY LLC PO BOX 166386MIAMI, FL 33116---0 46573002227NESS DYNASTY LLC PO BOX 166386MIAMI, FL 33116---0 46573003789NESS DYNASTY LLC PO BOX 166386MIAMI, FL 33116---0 46573001040NESS DYNASTY LLC PO BOX 166386MIAMI, FL 33116---0 46573000724NESS DYNASTY LLC PO BOX 166386MIAMI, FL 33116---0 46573002447NESS HOLDINGS LLC PO BOX 166386MIAMI, FL 33116---0 46573003569NESS, TAMIR PO BOX 166386MIAMI, FL 33116---6386 46573001969NEVES, BARBARA A 7340 ST IVES WAY #3207NAPLES, FL 34104---0 28273750347NEW HOPE MINISTRIES INC 7675 DAVIS BLVDNAPLES, FL 34104---5312 00399760006NICHOL, FRANK J & THERESE E 708 KING HENRY LNSAINT CHARLES, IL 60174---7842 28273750525NICKERSON, KENNETH & YVONNE 4955 PEPPER CIR #205NAPLES, FL 34113---0 46573004681NICKERSON, YVONNE & KENNETH 4955 PEPPER CIR #205NAPLES, FL 34113---0 46573000520NODA, DAVID 321 20TH AVE NENAPLES, FL 34120---0 46573001927NODA, DAVID 321 20TH AVE NENAPLES, FL 34120---0 46573004461NONNI FLORIDA LLC4380 77TH AVE NWNAPLES, FL 34119---031156005944NONNI FLORIDA LLC4380 7TH AVENUE NWNAPLES, FL 34119---031156005863NPS PP LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204646POList_500_PL202000005649.A.5.d Packet Pg. 1528 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 13OBREGON, EDUARDO OVIDIO 15223 SW 176TH LANEMIAMI, FL 33187---0 46573002405OCEAN BLUE 72 INC 1505 BIRDIE DRIVENAPLES, FL 34120---0 46573001341O'CONNELL, CHRISTOPHER DYMPNA SHERMAN 1308 REDWOOD WAY PACIFICA, CA 94044---0 31156005669OCONNOR, MICHAEL 830 SHORE RD #3ULONG BEACH, NY 11561---0 31156003001ODARBA, FIORELLA APOLONIA MELINA GARDEAZABAL ODARBA CALLE EL COMERCIO.EDIFICIO RLOCAL 2 PB HIDROROCA SANTA MOCARACAS 1040 VENEZUELA 31156007502OGDEN, SCOTT C 177 SANTA CLARA DR #12NAPLES, FL 34104---0 46573003420OPAL MY WORLD USA INC PO BOX 43486TUCSON, AZ 85733---0 46573000588OROFINO, MICHAEL A & PATRICIA 5324 STATE ROUTE 38AAUBURN, NY 13021---0 46573003640ORTEGA, PURISIMA G 1240 WILDWOOD LAKES BLVD #306NAPLES, FL 34104---0 31156006008OSJA, ALBANA & BENART 166 PLANTATION CIRNAPLES, FL 34104---0 67965017508OSPINA, HECTOR 150 SANTA CLARA DR #150-4NAPLES, FL 34104---0 46573001985P4 LLC 3893 MANNIX DR STE 514NAPLES, FL 34114---5417 24754203883PAHINUI, MAKENA 153 PLANTATION CIRNAPLES, FL 34104---0 67965016703PARELLA, FRANCIS C & KATHLEEN 225 CHAPEL STHOLDEN, MA 01520---1812 28380640007PARET, RENATE ELISE BELMONTE HEIGHTS BLOCK E FLAT 7 ST IGNATIUS JUNCTION SLIEMA SLM2023 MALTA 31156000965PASSMORE, STEPHEN R & RACHEL C CHAUMIERE, CLAPHAM EXETERDEVON EX2 9UN UNITED KINGDOM 31156004385PATEL, MUKESHBHAI S SHILPA M PATEL 1235 WILDWOOD LAKES BLVD #107 NAPLES, FL 34104---0 31156000949PATLAKH, VERA LEONORA STOLYER 212 CIBOA AVE NORTH PORT, FL 34287---0 31156006228PATLAKH, VERA LEONORA STOYLAR 1600 HAGYS FORD RD PENN VALLEY, PA 19072---1051 31156000981PATTERSON, LEE EDWARD MARIA VOYATZIS-PATTERSON 2109 BAKER DRIVE BURLINGTON L7L 0A8 CANADA 31156002840PAULOVICH, CESAR WALTER KARINA LORENA MIGUEZ 8999 SW 123RD CT #209 MIAMI, FL 33186---0 31156002947PCBC LLC % PAUL ARAN 400 SANDIRON CIR #431 PONTE VEDRA BCH, FL 32082---0 46573001147PCBC LLC % PAUL ARAN 400 SANDIRON CIR #431 PONTE VEDRA BEA, FL 32082---0 46573002586PCBC LLC %PAUL ARAN 400 SANDIRON CIR #431 PONTE VEDRA BEAC, FL 32082---0 46573004047PEDRAZA, RUTH A & CARLOS A 1160 WILDWOOD LAKES BLVD #105NAPLES, FL 34104---0 31156002905PEKOS NAPLES LLC 833 COLDSTREAM CTNAPLES, FL 34104---0 31156000509PEKOS NAPLES LLC 833 COLDSTREAM CTNAPLES, FL 34104---0 31156000428PELICAN TOO LLC 316 NE 1ST STPENDLETON, OR 97801---0 31156000800PELICAN TOO LLC 316 NE 1ST STPENDLETON, OR 97801---1612 24754203582PELISSIER, MARIE JOSIANE 190 SANTA CLARA DR #6NAPLES, FL 34104---5440 46573003941PENDER, JAMES E & JOAN A 100 MACE ROADHAMPTON, NH 03842---0 28405000483PERA, JOHN CARLO GIULIANA=& ELIO MASSIMILIANO 12 CATALINA CT SUDBURY P3E5L2 CANADA 28267500448PEREZ, LISSETTE JACKELYN PEREZ 1170 WILDWOOD LAKES BLVD #105 NAPLES, FL 34104---0 31156003302PERKINS, KATHLEEN 22 COOPER STTORRINGTON, CT 06790---6304 24754200200PERRY, DEBORAH A7360 SAINT IVES WAY #2210NAPLES, FL 34104---0 28267500406PETRILLA, PAUL & ROBERT P 3110 NORTH AVECLEVELAND, OH 44134---1345 46573002502PETROVA, GERGANA P 1230 WILDWOOD LAKES BLVD #303NAPLES, FL 34104---5805 31156005546PETROVSKI, FILIP & VESNA 1330 HENLEY ST #2105NAPLES, FL 34105---0 31156002468PETTERS, ADOLFO L 1270 WILDWOOD LAKES BLVD #205NAPLES, FL 34104---0 31156007065PETUSHIN, PAUL 1205 WILDWOOD LAKES BLVD #5-102NAPLES, FL 34104---0 31156001249PETUSHIN, PAUL TAISYA MIKHAILENKO 1265 WILDWOOD LAKES BLVD #107 NAPLES, FL 34104---0 31156000541PIAZZA, SALVATORE J & GLADYS J 10005 CLOVERDALE PLVIENNA, VA 22182---1353 28381040004PIDGEON, WILLIAM A & JOANNE 155 PLANTATION CIRNAPLES, FL 34104---6443 67965016758PIETZONKA, KLAUS-WERNER SANDRA ZAPPE AUF DER HOEHE 63 HERFORD 32051 GERMANY 46573003145PIJUAN, PAUL A MARA MERCADO 1195 WILDWOOD LAKES BLVD #203 NAPLES, FL 34104---0 31156001825PILOTO, OSNIEL DANIELA DUARTE 1185 WILDWOOD LAKES BLVD #7-107 NAPLES, FL 34104---0 31156002141PLANTATION HOMEOWNERS ASSOC OF COLLIER COUNTY INC%GULF BREEZE MGNT SERVICES8910 TERRENE CT STE 200BONITA SPRINGS, FL 34135---9514 67965014501PLANTATION HOMEOWNERS ASSOC OF COLLIER COUNTY INC273 AIRPORT RD S8910 TERRENE CT STE 200BONITA SPRINGS, FL 34135---9514 67965015500POPOV, NIKOLA KMARGARITA POPOVA35 MERRYGALE CRESCENTETOBICOKE M9B 5N9 CANADA 31156000208POPOV, NIKOLA K & MARGARITA 35 MERRYGALE CRESCENTETOBICOKE M9B 5N9 CANADA 31156003386PRECI, ELVIRA & ANGELO192 LINDAMIR LNFAIRFIELD, CT 06824---4046 31156001689PRECI, ELVIRA & ANGELO192 LINDAMIR LNFAIRFIELD, CT 06824---4046 31156005180PRECI, SIMON E205 PANSY RDFAIRFIELD, CT 06824---3111 31156004660PRESERVE 7965 LLC562 BLUEBERRY PLACEFRANKLIN LAKES, NJ 07417---0 24754201241PUCHYR, GENEVIEVE DIANEDEBORAH J MCCABE1275 WILDWOOD LAKES BLVD #2105NAPLES, FL 34104---031156000101PUGLESE, DEBORAH LYNN1275 WILDWOOD LAKES BLVD BLDG #2 304NAPLES, FL 34104---031156000363QUIETO, ANGELO W & ANN CTERI A ANTONUCCI7340 PROVINCE WAY APT 3303NAPLES, FL 34104---605428380920002QUILES, MIRIAM1160 WILDWOOD LAKES BLVD #9 108NAPLES, FL 34104---031156002963POList_500_PL202000005649.A.5.d Packet Pg. 1529 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 14QUIRBACH, MARK & KAREN 504 GROTON STDUNSTABLE, MA 01827---2612 31156001867R J ZANNI & E ZANNI LIV TRUST 2504 WILLOW POND DRIVERIVERHEAD, NY 11901---0 31156000240RANGEL LEON FAMILY INC 2093 HAMLIN STREETNAPLES, FL 34120---0 31156005261RANGEL, FRANK L MARIELBA LEON MUNOZ 1230 WILDWOOD LAKES BLVD 103 NAPLES, FL 34104---0 46573004801RASOR, JAMES N 1170 WILDWOOD LAKES BLVD #304NAPLES, FL 34104---0 31156003564RAZBIN, VLADIMIR SNEJANA MOUELHI 843 MARYLAND AVENUE OTTAWA K2H OH9 CANADA 31156007560REED, CARL R & MELINDA C 4 MARLBORO DRIVECLIFTON PARK, NY 12065---0 31156005229REFERENCE ONLY BRIAR LANDING AT THE ENCLAVE CONDOMINIUM00400244301REFERENCE ONLY COUNTRY HAVEN CONDOMINIUM 228480162508REFERENCE ONLY COUNTRY HAVEN CONDOMINIUM 328480163002REFERENCE ONLY COUNTRYSIDE III CONDO28430240001REFERENCE ONLY COUNTRYSIDE IV CONDO28430241000REFERENCE ONLY ENCLAVE AT NAPLES A CONDOMINIUM00400246202REFERENCE ONLY GRANADA LAKES VILLAS CONDOMINIUM00400247007REMBOULIS, GEORGES 1180 WILDWOOD LAKS BLVD 11-206NAPLES, FL 34104---5809 31156003881RENDA, MICHAEL & GEORGIANN 127 DEER RUN LNELGIN, IL 60120---7308 28405000085RENNIE, WILLIAM & GLORIA B 157 PLANTATION CIRNAPLES, FL 34104---6443 67965016800REXFORD, GARY S & MAUREEN P 7360 ST IVES WAY #2305NAPLES, FL 34104---0 28267500503REYES, MAGALY J 10017 VILLAGIO GARDENS LN #108ESTERO, FL 33928---0 31156005627RHODES, KEVIN R & SANDRA D 6368 BRAMPTON COURTALEXANDRIA, VA 22304---0 28273750208RIBEROL INVESTMENT LLC 131 25TH STREET SWNAPLES, FL 34117---0 46573004063RIBEROL INVESTMENT LLC 408 7TH STREETCARLSTADT, NJ 07072---0 46573002845RICCIO, CLYDE 521A WOODWARD AVENEW HAVEN, CT 06512---1956 31156004589RICCIO, CLYDE A 521A WOODWARD AVENEW HAVEN, CT 06512---1956 31156003742RICHARDSON, TIMOTHY 3817 ROBERTS LNARLINGTON, VA 22207---0 31156001744RICHES, THOMAS W 1230 WILDWOOD LAKES BLVD # 108NAPLES, FL 34104---5805 31156005368RICHETELLI, ROBERTA M WILLIAM F RICHETELLI 1275 WILDWOOD LAKES BLVD #102 NAPLES, FL 34104---0 31156000046RIOS, MARCO A RIOS CALLE LA VERTIENTE 145 LA MOLINA LIMA PERU 46573003349RIVAS, XIOMARA 1150 WILDWOOD LAKES BLVD #108NAPLES, FL 34104---0 31156002565RIVERA KRPAN, IRMA Z 2326 ROSE BRANCH CTBROOKEVILLE, MD 20833---0 31156002442RIVERA KRPAN, IRMA Z 2326 ROSE BRANCH CTBROOKVILLE, MD 20833---0 31156005067RIVERA, PETER & ELIZABET 4510 BOTANICAL PLACE CIRCLE #101NAPLES, FL 34112---0 31156005164ROBAUL, MERLE VIANNEY 1230 WILDWOOD LAKES BLVD #208NAPLES, FL 34104---0 31156005520ROBO, PHILIP L & JANE A 10 KING COURTLEICESTER, MA 01524---0 28273750046RODRIGUEZ, LAURA82 BURNT PINE DRIVENAPLES, FL 34119---0 31156003140RODRIGUEZ, VANESSA E 1210 WILDWOOD LAKES BLVD #102NAPLES, FL 34104---0 31156004440ROGERS, WILLIAM B JUDY E FRIEDRICH ROGERS 7360 PROVINCE WAY #4309 NAPLES, FL 34104---0 28405000580ROGOZIA, JOHNNY 20 DOWNEY DRIVEHUNTINGTON, NY 11743---5147 31156006341ROPPO, ROCCO M 174 PLANTATION CIRNAPLES, FL 34104---6400 67965017304ROSA, JAMES K 1185 WILDWOOD LAKES BLVD # 108NAPLES, FL 34104---5813 31156002167ROSE, JAY M KA TING CHAN 108 SANTA CLARA DR #10 NAPLES, FL 34104---0 46573000504ROSE, TIMOTHY M & MELISSA ANN 158 PLANTATION CIRNAPLES, FL 34104---6400 67965017702ROVIRA, ALFONSO & SUSANA 1180 WILDWOOD LAKES BLVD #303NAPLES, FL 34104---0 31156003946RUEL, RICHARD S 137 DAY STREETMANCHESTER, NH 03104---0 28273750101RUIZ, ANA I & FEDERICO 1347 WILDWOOD LAKES BLVD #1NAPLES, FL 34104---6425 24754203388RUIZ, YENY 11350 NW 53RD LANEDORAL, FL 33178---0 31156003467RUKAVINA, CLAIRE 12443 ROSE BEACH LINE #157MORPETH N0P 1X0 CANADA 31156003920RUSSELL, KIRBY & CELINA PO BOX 304MOOSEHORN R0C 2E0 CANADA 31156006862RUWE PROPERTIES LLC 4810 LAKEWOOD BLVDNAPLES, FL 34112---0 31156000143S CLARA GRANADA 142-5 LLC 88 CAMBRIDGE DRSOUTH WINDSOR, CT 06074---1551 46573001684SAAVEDRA, RUBEN LAURA SAAVEDRA 7 MADOC DR BRAMPTON L6V 1Z8 CANADA 31156006901SAAVEDRA, RUBEN & LAURA 7 MADOC DRIVEBRAMPTON L6V 1Z8 CANADA 31156005902SAAVEDRA, RUBEN ADOLFO LAURA GONZALEZ SAAVEDRA 7 MADOC DRIVE BRAMPTON L6V 1Z8 CANADA 31156003409SAHAKIAN, MICHAEL & CATHERINE 5 SCOTTVIEW CTROCKVILLE, MD 20854---0 46573000025SAKHIPOVA, GULNARA1275 WILDWOOD LAKES BLVD #106NAPLES, FL 34104---031156000127SALLEMI, JOSEPH W3 SOUTHERN WAYHOLTSVILLE, NY 11742---1079 31156000088SALLEMI, WILLIAM & MARIA83 ABBOTT AVEMASTIC, NY 11950---122931156005465SANCHEZ, LISETTE DELGADO4660 1ST AVE SWNAPLES, FL 34119---031156003988POList_500_PL202000005649.A.5.d Packet Pg. 1530 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 15SANDOVAL, FREDERICK 190 SANTA CLARA DR UNIT 1NAPLES, FL 34104---0 46573003844SANDOVAL, FREDERICK 5567 27TH COURT SW #ANAPLES, FL 34116---0 46573000300SANDUBRAE, STEVEN D DENISE M JABBOUR-SANDUBRAE 60 FORDCROFT GROSSE POINTE, MI 48236---0 31156005122SANTA BARBARA HOLDINGS LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573000782SANTA BARBARA LANDINGS PROPERTY OWNER'S ASSN INC 145 SANTA CLARA DR NAPLES, FL 34104---0 00400200002SANTIAGO, TOMAS 190 SANTA CLARA DR #7NAPLES, FL 34104---0 46573003967SASTRE, GASTON MARK 1240 WILDWOOD LAKE BLVD #108NAPLES, FL 34104---0 31156005766SASTRE, RUBEN RUBEN=& ELENA SASTRE 833 COLDSTREAM CT NAPLES, FL 34104---0 31156007227SASTRE, RUBEN O 833 COLDSTREAM CTNAPLES, FL 34104---0 31156001346SCHMIDT, KEVIN 4708 OSSABAW WAYNAPLES, FL 34119---0 24754204141SCHMUCK, DEREK A TERRY=& VALERIE LINDA ECCLES 114 DUNCAIRN CRESCENT HAMILTON L9C 6G1 CANADA 28380800009SCHOENKNECHT, ROSEMARY 7784 SCARLET CTNAPLES, FL 34104---6414 67965017809SCHOOL DISTRICT-CPE CALUSA PARK ELEMENTARY % SUPERINTENDENT 5775 OSCEOLA TRL NAPLES, FL 34109---919 00399840007SCOTT, MALGORZATA 1160 WILDWOOD LAKES BLVD 201NAPLES, FL 34104---0 31156002989SEAHRA, MALKIAT ALTHEA SEAHRA 422 BEAMISH ST PORT STANLEY N5I 0A7 CANADA 31156002808SEAVEY, BRIAN 151 PLANTATION CIRNAPLES, FL 34104---6443 67965016651SEEFELD, SHARON C 911 MAGILL AVECOLLINGSWOOD, NJ 08107---2036 31156002581SERGI, RICHARD L 87 WEST RDLONDONDERRY, NH 03053---3113 31156001469SEVERINA, NADEJDA N 8600 SHORE FRONT PKWY APT 5FROCKAWAY BEACH, NY 11693---220331156002387SGARIATA III, ANTHONY J CHERIE K SGARIATA 7193 KLOCK RD CANASTOTA, NY 13032---0 28381200006SHAPIRO, NATALIA 1140 PFINGSTEN RDGLENVIEW, IL 60025---2521 31156005889SHARON, BECKY & SCOTT 410 FLAGSHIP DR #801NAPLES, FL 34108---0 24754203320SHARON, BECKY & SCOTT 410 FLAGSHIP DR #801NAPLES, FL 34108---0 24754203281SHUAIPI, LINDITA & FATMIR 8211 IBIS COVE CIRNAPLES, FL 34119---7722 24754200666SIERRA, VIVIAN I & JOSE 2920 SW 1ST AVEMIAMI, FL 33129---2750 46573003284SIEVERT, CARL B 7773 SCARLET CTNAPLES, FL 34104---0 67965018109SIKORSKI, JOHN A & AGNES M 7360 ST IVES WAY # 2306NAPLES, FL 34104---0 28267500529SIMON, RONNIE & ELIZABETH C 2 MARSHA DRDELRAN, NJ 08075---0 31156005083SKILLIN, MARK & CHERYL 94 WINTERWOOD DRLONDONDERRY, NH 03053---0 46573000407SKP PROPERTIES & SALES LLC 12915 BRYNWOOD PRESERVE LANENAPLES, FL 34105---0 46573004885SKY TEAM GRANADA LAKES LLC 724 W 500 S STE 800WEST BOUNTIFUL, UT 84087---0 46573000986SKY TEAM LLC 724 WEST 500 SOUTH #800W BOUNTIFUL, UT 84087---0 46573002366SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573002162SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573001202SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573003365SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573002120SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573001189SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573000944SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573001448SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573004526SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573004322SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573000643SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573003763SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573001121SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573001804SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573002764SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573002382SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573000821SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573000863SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573004005SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573002780SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573002188SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573000229SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573004869SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573000245SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573004267SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573000449SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573004160POList_500_PL202000005649.A.5.d Packet Pg. 1531 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 16SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573002065SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573003064SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573003462SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573004762SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573002926SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573003103SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573002528SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573003501SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573003048SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573004568SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573003705SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573002803SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573001286SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573001668SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573003983SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573002104SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573004306SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573001260SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573004445SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573004487SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573003527SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573000805SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573000546SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573004623SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573002748SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573004241SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573001820SKYTEAM LLC 724 W 500 S #800WEST BOUNTIFUL, UT 84087---0 46573004403SMITH, JOSEPH M & SHARON A 21 SANDERLING AVEPOWELL, OH 43065---7587 31156007104SMITH, STEVEN D 5755 STATE ROUTE 13CHITTENANGO, NY 13037---0 31156005685SOARES, PAULO 2401 PYRAMID CRESMISSISSAUGA L5K 1E1 CANADA 31156002264SOFRONOVA, OLGA 1180 WILDWOOD LAKES BLVD 204NAPLES, FL 34104---5809 31156003849SOLARI, JAMES 15107 GRANDVIEW DRORLAND PARK, IL 60467---0 28405000166SORRENTINO, ALBERT P ROSEMARIE A SORRENTINO 325 MALDEN ST REVERE, MA 02151---5642 28380360002SORRENTINO, ALBERT PROSEMARIE A SORRENTINO 325 MALDEN STREET REVERE, MA 02151---0 28380400001SPINA, JEROME J 2100 CARTER RDGENEVA, NY 14456---9502 46573001325SPITALIERI, JOSEPH 1 CHEESEBROUGH STREETSTATEN ISLAND, NY 10312---0 31156000606SPOSATO, LOUIS & KIMBERLY ANNE 42 CRESCENT STHICKSVILLE, NY 11801---0 31156001883ST GEORGE GROUP CORP 3310 GRANADA BLVDCORAL GABLES, FL 33134---0 00400246503STALLONE, THEODORE R & JILL E 116 VERSAILLES CIRNAPLES, FL 34112---0 31156000826STARKWEATHER, MASON 1195 WILDWOOD LAKES BLVD UNIT 6 303NAPLES, FL 34104---0 31156001948STEIGER, PATRICIA SUSAN ARLENE STEIGER 172 PLANTATION CIR NAPLES, FL 34104---6400 67965017359STEINMULLER, SHAWN PO BOX 1407QUOGUE, NY 11959---1407 31156002646STOCK, JOHN & LYNN BARRY 405 COVE CTSEASIDE HEIGHTS, NJ 08751---1104 31156000321STOLL, JOSUE LANDOLTSTRASSE 19BERN 3007 SWITZERLAND 46573001422STOLYAR, LEONORA & BRONISLAV 46 SANDTRAP CIRWARMINSTER, PA 18974---1669 31156001605STORY, LISA MARY 4 BEACON PARK APT BAMHERST, NY 14228---0 31156002662STOVALL FAMILY TRUST 3553 PERIWINKLE WAYNAPLES, FL 34114---0 31156005009STRAUB, VELINDA 108 SANTA CLARA DR APT 16NAPLES, FL 34104---5411 46573000627STROHL FAMILY LLC 328 BOW LINE BENDNAPLES, FL 34103---0 00400244107STUMPF, EDWARD C & MARY F 412 LOIS LANESCHENECTADY, NY 12304---0 31156003823STUTSON, VICKI K OBRADORSALEX G STUTSON5563 MARICOPA DRIVESIMI VALLEY, CA 93063---031156007201STUVE, ROBERT1150 WILDWOOD LAKES BLVD #202NAPLES, FL 34104---031156002604SUAREZ, YEGNI M AROCHA108 SANTA CLARA DRNAPLES, FL 34104---046573000342SUDIT, EDWARDIRINA RUBINSHTEIN31 DUNNERDALE RDMORRIS PLAINS, NJ 07950---1253 31156005423SUDIT, RUFINA11 KRISTI DREAST HANOVER, NJ 07936---3219 31156001045SULLIVAN, BRIAN & CHERYL2 STEVENSON STREETLYNBROOK, NY 11563---031156007162SULLIVAN, BRIAN P & CHERYL2 STEVENSON STLYNBROOK, NY 11563---031156001087POList_500_PL202000005649.A.5.d Packet Pg. 1532 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 17SUN APPLE PROPERTIES LLC % FRANCIS A UZZI,ESQ 210 SUMMIT AVE #A11 MONTVALE, NJ 07645---0 24754204662SUN APPLE PROPERTIES LLC 210 SUMMIT AVE #A11MONTVALE, NJ 07645---0 31156003124SUN APPLE PROPERTIES LLC 210 SUMMIT AVENUE SUITE A11MONTVALE, NJ 07645---0 31156006480SUPER FELICES LLC 4380 7TH AVE NWNAPLES, FL 34119---0 31156006202SUYANA LLC 1534 GABRIEL STHOLLYWOOD, FL 33020---3250 46573004788SUYANA LLC 401 E LAS OLAS BLVD #130 655FT LAUDERDALE, FL 33301---2477 46573004843SUYANA LLC 401 E LAS OLAS BLVD #130-655FT LAUDERDALE, FL 33301---0 46573000180TAN AND CARROLL LLC 8085 PRINCETON DRIVENAPLES, FL 34104---0 31156005384TANKB 2010 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203621TANKB 2010 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204701TANKB 2010 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204086TANKB 2010 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202729TANKB 2010 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201607TANKB 2010 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204109TDT INVESTMENTS GROUP LLC 21410 NE 19TH AVEMIAMI, FL 33179---0 24754201623TDVA LLC 999 SW 1ST AVE SUITE PH4MIAMI, FL 33130---0 46573001383TDVA LLC PO BOX 166386MIAMI, FL 33116---0 46573002625TEGRENO LLC 9901 NW 80TH AVE #3HHIALEAH, FL 33016---0 31156001427THALIN, DEBRA & KEVIN 7732 PALISADES AVE NEOSTEGO, MN 55330---0 31156006969THALIN, KEVIN & DEBRA 7732 PALISADES AVE NEOSTEGO, MN 55330---0 31156007120THOMAS J SACCONE REV TRUST 7 GRANT AVENUESMITHTOWN, NY 11787---5518 28273750224THOMAS, NICHOLAS P 8 HENDERSON DRNAPLES, FL 34114---8205 31156000224THOMAS, SHARYN L & JOHN E 727 PROEHLS TRLHUDSON, WI 54016---1369 28381120005THOMPSON JR, FREDERICK L LISA MAY THOMPSON 7340 PROVINCE WAY #3302 NAPLES, FL 34104---6054 28380880003TITUS, JOHN 1170 WILDWOOD LAKES BLVD 102NAPLES, FL 34104---0 31156003247TMR INVESTMENTS INC #135 3564 AVALON PARK BLVD E STE 1ORLANDO, FL 32828---0 46573003080TMR INVESTMENTS INC #157 3564 AVALON PARK BLVD E STE 1ORLANDO, FL 32828---0 46573003721TMR INVESTMENTS INC #157 3564 AVALON PARK BLVD E STE 1ORLANDO, FL 32828---0 46573001723TMR INVESTMENTS INC #157 3564 AVALON PARK BLVD E SUITE 1ORLANDO, FL 32828---0 46573001244TMR INVESTMENTS INC #157, 3564 AVALON PARK BLVD E #1ORLANDO, FL 32828---0 31156002028TMR INVESTMENTS INC #157, 3564 AVALON PARK BLVD E STE #1ORLANDO, FL 32828---0 31156003108TMS 13901 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754200022TOBY USA LLC11925 COLLIER BLVD STE 102NAPLES, FL 34116---0 46573001901TOLEDO, ARMANDO CID M DE LAS MERCEDES O BERMUDEZ 1190 WILDWOOD LAKES BLVD #202NAPLES, FL 34116---031156004204TOLHURST, LYNDA C42 NEWGREEN CRESBRAMPTON L6S 4Y1 CANADA 46573003381TOLHURST, LYNDA CAROL42 NEWGREEN CRESENTBRAMPTON L6S 4Y1 CANADA 46573003323TOMKIEL, VICTOR & CYNTHIA A 7 LEBANON DRBRIELLE, NJ 08730---154831156000347TONKIN, STEPHEN & SUZANNE48 STAR LAKE RDPO BOX 111TIMMINS P4N 7C5 CANADA 31156003360TORRES, ANGEL ANTONIOSANDRA NELIDA RENZACCI122 STONEBRIAR DRIVEMAPLE L6A 2N1 CANADA31156000703TRAPANESE JR, LOUIS1185 WILDWOOD LKS BLVD #303NAPLES, FL 34104---031156002345TRERAMA MANAGEMENT LLC45 47 40TH STREETLIC, NY 11004---028267500309TRIGUEIROS, ANTONIO & BEATRIZ 1860 W CROWN POINTE BLVDNAPLES, FL 34112---360831156007007TRUJILLO, GLORIAGONZALO MORALES CRUZ176 PLANTATION CIRNAPLES, FL 34104---067965017252TRUJILLO, MARAY1270 WILDWOOD LAKES BLVD #201NAPLES, FL 34104---031156006985TURNER, JUDITH7360 ST IVES WAY #2101NAPLES, FL 34104---028267500024ULTRA BROS 2010 LLC2390 NE 171 STN MIAMI BCH, FL 33160---024754200242ULTRA BROS 2010 LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201225ULTRA BROS 2010 LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201885ULTRA BROS 2010 LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754200585ULTRA BROS 2011 LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203087ULTRA BROS 2012 LLC2390 N E 172ND STREETNORTH MIAMI BCH, FL 33160---0 24754204688ULTRA BROS 2012 LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203809ULTRA BROS 2012 LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204280ULTRA BROS 2013 LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204028ULTRA BROS 2013 LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203647ULTRA BROS 2014 LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202486ULTRA BROS 2014 LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754203689ULTRA BROS 2014 LLC2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201526POList_500_PL202000005649.A.5.d Packet Pg. 1533 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 18ULTRA BROS 2014 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204206ULTRA BROS 2014 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202981ULTRA BROS 2015 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204329ULTRA BROS 2015 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754204604ULTRA BROS 2015 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754201128ULTRA BROS 2015 LLC 2390 NE 171 STN MIAMI BEACH, FL 33160---0 24754202240VALENCIA, VICTOR 7771 SCARLET CTNAPLES, FL 34104---0 67965018154VAN HOOF, DIANE LANGE LOZANA STRAAT 229ANTWERP 2018 BELGIUM 31156001524VASQUEZ, ROBERTO 160 17TH STREET SWNAPLES, FL 34117---0 46573000009VELEZ, SANDRA G 1180 WILDWOOD LAKES BLVD # 104NAPLES, FL 34104---5809 31156004149VELEZ, SANTA 1185 WILDWOOD LAKES BLVD # 104NAPLES, FL 34104---0 31156002086VELEZ, SANTA 33 LITTLE ASHLEY DRIVEMAPLE L6A 0X3 CANADA 31156000525VERA, TED H 1752 IVER STCOLORADO SPRINGS, CO 80910---0 46573003543VERJIN SAHAKIAN REV TRUST 5 SCOTTVIEW CTROCKVILLE, MD 20854---0 46573002861VERSIACKAS, EDWARD J ANNAMARIE VERSIACKAS 281 GREAT WESTERN ROAD HARWICH, MA 02645---0 28273750321VIERA, LUIS A 142 SANTA CLARA DR #1NAPLES, FL 34104---5416 46573001600VILLAMIZAR, KATIUSKA KRISTHIAN A VILLAMIZAR 1185 WILDWOOD LAKES BLVD #106 NAPLES, FL 34104---0 31156002125VITA, MANLEY E & SHARON 337 MAPLEWOOD RDHUNTINGTN STA, NY 11746---2854 28405000221WALLEN, SUSAN PETER DEMETRIOU THOMAS M WALWER 29 CRANES LN BREWSTER, MA 02631---2306 31156003085WALSH, GREGORY & PATRICIA 12 OAK LNNORTHPORT, NY 11768---2632 31156006781WANG, KYLER 5670 MARIMIN DRIVEBONITA SPRINGS, FL 34134---0 46573004348WANG, KYLER 5670 MARIMIN DRIVEBONITA SPRINGS, FL 34134---0 46573003488WANG, KYLER 5670 MARIMIN DRIVEBONITA SPRINGS, FL 34134---0 46573000261WARA, MARIANELA WATA 12225 SW 203RD TERRMIAMI, FL 33177---5260 31156001281WARNOCK, AUBREY & JEAN 11 EXECUTIVE RDSELDEN, NY 11784---1815 31156007405WAYNE HARTMANN REV TRUST NORIETA HARTMANN REV TRUST 99 SCOTT STREETMASSAPEQUA PARK, NY 11762---35031156006820WAYNE HARTMANN REV TRUST NORIETA HARTMANN REV TRUST 99 SCOTT STREET MASSAPEQUA PK, NY 11762---3501 31156006529WELLER, JASON A 1270 WILDWOOD LAKES BLVD UNIT #305NAPLES, FL 34104---0 31156007188WEST, MATTHEW L GREGORY P FERRO 6210 STONEY HILL RD NEW HOPE, PA 18938---0 46573001082WICKA, WAYNE S 36437 OLD HOMER RDWINONA, MN 55987---6066 31156000486WIEGE PROPERTIES LLC 8379 PALACIO TERRACE SNAPLES, FL 34114---0 28267500082WILLIAMS, KENDRA SHERETTE 1170 WILDWOOD LAKES BLVD # 306NAPLES, FL 34104---5810 31156003603WILSON, KENBER SCOTT SHARON LOUISE WILSON 1160 WILDWOOD LAKES BLVD #106 NAPLES, FL 34104---0 31156002921WITTENBERGER, DAN & DOINA T 13 RUE DE CHEVERNYBLAINVILLE J7B 1M7 CANADA 31156006707WITTENBERGER, DOINA & DAN 13 RUE DE CHEVERNYBLAINVILLE J7B 1M7 CANADA 31156001980WONG, TONY ALANNA WONG 25 HENRICKS CRESCENTRICHMOND HILL L4B 3W4 CANADA 31156004521WONG, XIOMARA193 SANTA CLARA DRIVE #10NAPLES, FL 34104---046573004186WRIGHT, KEVIN53792 213TH STMANKATO, MN 56001---3978 31156001003WRIGHT, KEVIN LMICHAEL GONNERMAN53792 213TH STMANKATO, MN 56001---3978 31156001168WURSTER, BRIAN M6952 LONE OAK BLVDNAPLES, FL 34109---031156006105YAKOV, HAYNA855 NEW WATERFORD DRIVE #102NAPLES, FL 34104---046573003161YANES, DANNY ARAGON1190 WILDWOOD LAKES BLVD #203NAPLES, FL 34104---031156004220YEANDLE, JOHN & JANET H399 JOSEPH STPORT ELGIN N0H 2C2 CANADA 28380520004YERENA, YUNIER & TERESA A170 PLANTATION CIRNAPLES, FL 34104---640067965017401YOUNG, JAMES G & EILEEN SBOX 39WYEVALE TINY L0L 2T0 CANADA 28380440003YOUNG, JOHN BWILLIAM A ZAPATA7360 SAINT IVES WAY APT 2202NAPLES, FL 34104---609828267500244YPSILANTIS, BILL VASILIOS2701 RIVER RUN CIRCLE EMIRAMAR, FL 33025---031156004880YPSILANTIS, ELEFTHERIOS7422 17 AVE #2CBROOKLYN, NY 11204---046573003909YUGO REALTY LLC67 PIERPONT RDDUDLEY, MA 01571---046573000106Z & Y GROUP LLC12883 BRYNWOOD PRESERVE LANENAPLES, FL 34105---046573002560ZANNI, MICHAEL & DINA34 BROOKFIELD RDFORT SALONGA, NY 11768---0 31156001401ZARAMERICAN HOLDINGS LLC3521 SW 177TH AVEMIRAMAR, FL 33029---166646573002049ZEOLI, MICHAEL A & KATHLEEN 10115 ALEXANDRIA LNPHILADELPHIA, PA 19116---3936 31156004246ZERWAL, PAUL & JULIE A14515 GREY FOX RUN APT 118NAPLES, FL 34110---704746573001846ZIEGELMAIER, MICHAEL FJENNIFER L ZIEGELMAIER162 PLANTATION CIRNAPLES, FL 34104---640067965017605ZIELKE, JAMIEDAVID NESARAJAHTED THIAGARAJAH3 DRUMMONDVILLE LANETORONTO M4E 3X7 CANADA 31156000884ZIELONKA, MARIUSZ30 CAROLYN CTEAST HANOVER, NJ 07936---1802 31156002361ZIMMERMANN, MARK & MARY ELLEN 1235 WILDWOOD LAKES BLVD #305NAPLES, FL 34104---031156001184POList_500_PL202000005649.A.5.d Packet Pg. 1534 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 19ZUCCARO, MARTINO 1235 WILDWOOD LAKS BLVD #4-203NAPLES, FL 34104---5816 31156001029POList_500_PL202000005649.A.5.d Packet Pg. 1535 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 4365 Radio Road • Suite 201 • Naples, FL 34104 • P: 239.434.6060 • www.davidsonengineering.com D esigningE xcellence Civil Engineering • Planning • Permitting August 24, 2020 Dear Property Owner, The public is invited to attend a Neighborhood Information Meeting, regarding the Bembridge Emergency Services Complex Planned Unit Development Amendment (PUDA-20200000564), being held by Davidson Engineering, Inc. on: Thursday, September 10th, 2020 at 5:30 p.m., at New Hope Ministries, located at 7675 Davis Boulevard, Naples, FL 34104 (Room 212, located on the 2nd Floor of the Event Center) The subject ±5.1-acre property is located along on the east side of Santa Barbara Boulevard, west of Calusa Park Elementary School, in Section 4, Township 50 South, and Range 26 East (see back for location map). The Planned Unit Development Amendment (PUDA) request, submitted to Collier County, is seeking approval for the following: Bembridge Emergency Services Complex (PUDA-20200000564): To request an increase in residential density from 6 units per acre to 16 units per acre, using the Affordable Housing Density Bonus, for a maximum of 82 residential units within the Bembridge Emergency Services Complex CFPUD/RPUD. Business and property owners, residents and visitors are welcome to attend the presentation to discuss the project. If you would like to participate virtually, an on-line meeting will be available. Details related to joining the meeting can be obtained by contacting the individual listed below. Reservations for in- person meeting attendance is required to ensure that the CDC guidelines for social distancing can be achieved. If you are unable to attend the meeting in-person or participate virtually, and have questions or comments, they can also be directed by mail, phone or e-mail to the individual below: Jessica Harrelson, AICP Davidson Engineering, Inc. 4365 Radio Road, Suite 201 Naples, FL 34104 Phone: 239-434-6060 Email: jessica@davidsonengineering.com 9.A.5.d Packet Pg. 1536 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1537 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) */1&340/"55&/%"/$&7*356"-"55&/%"/$& #SVDF$BSMTPO &NBJMCDBSMTPO!WFSJ[POOFU 8JMMJBN%BWJT &NBJM8JMMJBN%BWJT!GTSFTJEFOUJBMDPN 7*356"-"55&/%"/$&*/ 1&340/"55&/%"/$&*/1&340/"55&/%"/$&9.A.5.d Packet Pg. 1538 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) ĞŵďƌŝĚŐĞŵĞƌŐĞŶĐǇ^ĞƌǀŝĐĞƐŽŵƉůĞǆ WhͲW>ϮϬϮϬϬϬϬϬϱϲϰ SIGN POSTING INSTRUCTIONS (CHAPTER 8, COLLIER COUNTY ADMINISTRATIVE CODE FOR LAND DEVELOPMENT) A zoning sign(s) must be posted by the petitioner or the petitioner’s agent on the parcel for a minimum of fifteen (15) calendar days in advance of the first public hearing and said sign(s) must be maintained by the petitioner or the petitioner’s agent through the Board of County Commissioners Hearing. Below are general guidelines for signs, however these guidelines should not be construed to supersede any requirement of the LDC. For specific sign requirements, please refer to the Administrative Code, Chapter 8 E. 1.The sign(s) must be erected in full view of the public, not more than five (5) feet from the nearest street right-of-way or easement. 2.The sign(s) must be securely affixed by nails, staples, or other means to a wood frame or to a wood panel and then fastened securely to a post, or other structure. The sign may not be affixed to a tree or other foliage. 3.The petitioner or the petitioner’s agent must maintain the sign(s) in place, and readable condition until the requested action has been heard and a final decision rendered. If the sign(s) is destroyed, lost, or rendered unreadable, the petitioner or the petitioner’s agent must replace the sign(s) -- -- -- -- -- -- -- -- -- -- -- -- --- -- -- -- AFFIDAVIT OF POSTING NOTICE STATE OF FLORIDA COUNTY OF COLLIER BEFORE THE UNDERSIGNED AUTHORITY, PERSONALLY APPEARED JESSICA HARRELSON, AICP WHO ON OATH SAYS THAT HE/SHE HAS POSTED PROPER NOTICE AS REQUIRED BY SECTION 10.03.00 OF THE COLLIER COUNTY LAND DEVELOPMENT CODE ON THE PARCEL COVERED IN PETITION NUMBER 38'$ 3/ 4365 Radio Road, Suite 201 SIGNATURE OF APPLICANT OR AGENT STREET OR P.O. BOX Jessica Harrelson, AICP, Senior Planner, Davidson Engineering, Inc. Naples, FL 34104 NAME (TYPED OR PRINTED) CITY, STATE ZIP STATE OF FLORIDA COUNTY OF COLLIER The foregoing instrument was sworn to and subscribed before me thiVWKday of September , 2020, by Jessica Harrelson, AICP, who is personally known to me and who did take an oath. Signature of NotaryPublic Tocia Hamlin Rosa Printed Name of Notary Public My Commission Expires: (Stamp with serial number) NOTE: AFTER THE SIGN HAS BEEN POSTED, THIS AFFIDAVIT OF POSTING NOTICE SHOULD BE RETURNED NO LATER THAN TEN (10) WORKING DAYS BEFORE THE FIRST HEARING DATE TO THE ASSIGNED PLANNER. 9.A.5.d Packet Pg. 1539 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1540 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1541 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1542 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1543 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1544 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1545 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1546 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1547 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1548 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1549 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1550 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1551 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1552 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1553 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1554 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1555 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1556 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1557 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1558 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1559 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1560 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1561 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1562 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1563 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1564 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1565 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1566 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1567 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1568 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1569 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1570 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1571 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1572 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1573 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1574 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1575 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) 9.A.5.d Packet Pg. 1576 Attachment: Attachment C - Application-Backup Materials (13384 : PL20200000564 Bembridge PUDA) COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliercountyfl.gov (239) 252-2400 FAX: (239) 252-6358 Hybrid Virtual Quasi-Judicial Public Hearing Waiver Emergency/Executive Order 2020-04 Hearing of the Collier County Planning Commission and Board of County Commissioners For Petition Number(s): _________________________________________________________________ Regarding the above subject petition number(s), ________________________________ (Name of Applicant) elects to proceed during the declared emergency with hybrid virtual public hearings of the Collier County Planning Commission and Board of County Commissioners, and waives the right to contest any procedural irregularity due to the hybrid virtual nature of the public hearing. Name: _________________________________ Date: ___________________________ Signature*: ______________________________ Applicant Legal Counsel to Applicant * This form must be signed by either the Applicant (if the applicant is a corporate entity, this must be an officer of the corporate entity) or the legal counsel to the Applicant. 9.A.5.e Packet Pg. 1577 Attachment: Attachment D - CCPC-BCC Hybrid Meeting Waiver (13384 : PL20200000564 Bembridge PUDA)4 McDowell Housing Partners, LLC Christopher Shear, Managing Director, McDowell Housing Partners, LLC 9/30/2020 PUDA-PL20200000564 (Bembridge Emergency Services Complex) FinnTimothy From: Sent: To: Su bject: Attachments: Roy Anderson <eanderson075@gmail.com> Monday, November 9, 2020 2:22 PM FinnTimothy Fwd: Bembridge Thurs Scan201 1 0407_55_25.pdf EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. The attachments here go with the Resolution l'm sending you. Roy Anderson Life is short, play 18 ------ Forwarded message ------ From: Joe Smith <ismith@ csgcc.net> Date: Wed, Nov 4, 2020, 8:31 AM Subject: Re: Bembridge Thurs To: Roy Anderson <eanderson075@smail.com> Here you go .JS From: Roy Anderson <eanderson075@smail.com> Date: Wednesday, November 4, 2020 at 6:56 AM To: Joe Smith <ismith@csgcc.net> Subject: Re: Bembridge Thurs Yes if you could send me those today that would be great. Roy Anderson Life is short, play L8 Ok, the minutes aren't officially approved but I can provide you with the agenda and the copy of that motion specifically On Tue, Nov 3, 2020,4:16 PM.loe Smith <ismith @csscc.net> wrote: 1 9.A.5.f Packet Pg. 1578 Attachment: Attachment E - Opposition Letters (13384 : PL20200000564 Bembridge PUDA) JS From: Roy Anderson <eanderson0 75@smail.com> Date: Tuesday, November 3, 2020 at 3:44 PM To: Joe Smith <ismith @csgcc.net> Subject: Re: Bembridge Thurs For the Planning Commission could we bring an official copy from your office showing date of meeting, unanimous vote etc. We'll use it later for the BCC as well. Roy Anderson Life is short, play 18 On Tue, Nov 3, 2O2O,3:28 PM Joe Smith <ismith@csecc.net> wrote: Yes, it was approved as is. J5 From: Roy Anderson <eanderson075 @gmail.com> Date: Tuesday, November 3,2020 at 2:28 PM To: Joe Smith <ism ith@csgcc. net> Subject: Bembridge Thurs Hi Joe, just checking, do we have the final resolution for Thursday? Roy Anderson Life is short, play L8 2 9.A.5.f Packet Pg. 1579 Attachment: Attachment E - Opposition Letters (13384 : PL20200000564 Bembridge PUDA) RESOLUTION REGARDING THE BEMBRIDGE SERVICES COMPLEX COMMT]N'ITY FACILITIES PLANNED UNIT DEVELOPMENT DAIE: September 29, 2020 COMMITTEE: Extemal Community Relations CHAIRPERSON: Roy B. Anderson CURRENT POLICY REFERENCES: 3.9. I 1.2. A. and B. WHEREAS: The project proposal is located on the east side of Santa Barbara Boulevard and is a part ofthe subject complex which comprises 39.8 acres. It includes the already-built projects of Calusa Park Elementary School, the Emergency Management Station #75, water management lakes, land for a future wastewater master pumping station (1.33 acres) and land for this proposed affordable housing project (3.77 acres), WHEREAS: The parcels of interest are the pumping station and the housing sites, which front Santa Barbara Boulevard directly opposite Countryside, specifically the Country Hollow and Country Haven communities.. The immediate project is for the housing site only, not the pump station site, WHEREAS: At a Neighborhood [nformation Meeting (NIM) on January 30, 2020, the housing project as presented consisted of42 affordable housing units to be two stories high on a site of 6.3 acres. The ECRC reviewed this project and concluded that it would have a minimal impact on Countryside, however it would be monitored in the future, WHEREAS: Another NIM was held on September 10, 2020 and the project now proposed consisted of 82 affordable housing units on a 3.77 acre site and with thrce-story high buildings, WHEREAS : The 82-unit proposal will require the approval of the Collier County Ptanning Commission and the Board of County Commissioners for density bonuses for affordable housing. Further, they propose applying th6 density bonus not only to the project's 3.77 acres but also to the 1.33 acres designated for the pumping station for purposes ofcalculating the total allowable units which will all be on the 3.77 acre site. WHEREAS: The increase in size of the project as now proposed will have a material effect on Countryside including most importantly, visual impacts as well as noise and traffic impacts' Countrysiders in this area are aheady impacted by sirens from EMS vehicles, NOW, THEREFORE: That the Master Board go on record as opposing use of the affordable housing bonus and use of the pumping station land to achieve the total Project size of 82 housing units with three story buildings. 9.A.5.f Packet Pg. 1580 Attachment: Attachment E - Opposition Letters (13384 : PL20200000564 Bembridge PUDA) MOTION Motion to consider fu rther discussion related to amending restrictions outlined in the master community documents -Article X, Section 12-Vehicles. MOTION Motion made by Bev Whiteman, seconded by Mike Cashman to approve flawless dress denim in the Lakeview Lounge and Patio as of January 1, 2021. Flawless denim is defined as not having signs of faded, worn, or frayed fabric, tears, holes, or rips in colors of indigo (very dark blue), black or white only. Final decisions on acceptable conditions of denim will be at the discretion of club management. 8 Yeas, 1 Nay (Randy Koelb) - MOTION CARRIED MOTION Motion to enter into a contract with a selected architectural/design firm to begin feasibility study ofthe amenity campus. MOTION DELAYED MOTION Motion to approve the creation of an ad hoc master plan phase ll committee and open up application process to the community. MOTION DELAYED MOTTOT{ Motion made by Mike Cashman, seconded by Ken Laycock to adopt the ECRC proposal motion opposing the 82 unit Brembridge Planned Unit Development. 9 Yeas, 0 Nays - MOTION CARRIED UNANIMOUSLY MOTION Motion made by Ken Laycock, seconded by Randy Koelb, to approve the Delinquent Members Suspension List. 9 Yeas, 0 Nays - MOION CARRIED UNANIMOUSLY NO MOTION MADE 9.A.5.f Packet Pg. 1581 Attachment: Attachment E - Opposition Letters (13384 : PL20200000564 Bembridge PUDA) f 0 OT]NTRYSIDE cq,tnYsrDE corr a orNrxY a1!u! [. . vt v . v . IV V €allto Order 8:30 AM Approval of the Master Board Minutes of a. May 28,2020 Reading of the Executive Committee Minutes of a. June 9, 2020 b. Autust 11, 2020 c. September 8, 2020 d. September 15,2020 (Special Meeting) e. October 20, 2020 Committee Recommendations / Reports a. ECRC - Bembridte Development Update............,....,.......,,..,.,,............Roy Anderson, Chair General Manage/s Report....,........... ...,.....,..,..,.............Joe Smith, GM/COO Controlle/s Report,..............,............ .............,..,........,..Jeff racob, Controller Old Business a. M-Consulting Group - Cable Survey Update...................................1arry Franzen, President b. Cheryl Deering Community Marketing Pro8ram.....................................Joe Smith, GM/COO c. Review Dress Code Survey and possible revisions........................1arry Franzen, President Neu, Business a. Kitchen AC Unit - Unplanned Rep|acement........................................Joe Smith, GM/COO b. Walk-in Cooler Evap Coil & Condenser Rep|acement........................Joe Smith, GM/COO c. Resident Request- Review master document restrictions specific to pick up, trucks, campers, RVs etc...............................1arry Franzen, President d. Candidate for Open oirector Position..................................................ioe Smith, GM/COO e. Adhoc Master Plan Phase ll Committee Charter.................................Joe Smith, GM/COO f. Delinquent Member Suspension List ........ .. ......J eff Jacob, Finance Manager lx. Open Forum for Membe6 ***Owners mdy moke o stotement up to i minutes on dgendo items under old/new business, oction items ond board motions. Board Motions a, Motion to appoint Kathy Kunow to fill the remaining term of the open directot's position. Countryside Master Board ol Directors Meeting Odober 29,2O20 x. 9.A.5.f Packet Pg. 1582 Attachment: Attachment E - Opposition Letters (13384 : PL20200000564 Bembridge PUDA) b. Motionto require masks in all indoor areas and the cart staging area untilfurther notice. c. Motion to approve Cheryl Deering Community Marketing proposal for a term of 5 months at 53000 per month. d. Motion to approve unplanned kitchen Wl Cooler evaporator coil and condenser replacement in the amount of S7535.42 e. Motion to approve unplanned kitchen a/c replacement in the amount of58078.50 f, Motion to consider further discussion related to amending restrictions outlined in the master community documents - Article X, Section 12 - Vehicles. t. Motion to approve flawless dress denim in the Lakeview Lounge and Patio as ofJanuary 1, 2021. Flawless dress denim us defined as not having any signs of faded, worn or frayed fabrig tears, holes or rips in the colors of indigo (very dark blue), black or white only. Final decisions on acceptable condition of denim will be at the discretion of club management. h. Motion to enter into a contract with selected architecture/design firm to conduct feasibility study of the amenity campus. i. Motion to approve the creation ofan ad hoc master plan phase ll committee and open up the application process to the community. j. Motion to approve delinquent member suspension list. Xl. Adjournment Boaid Workhop to lmmediately follow Eoard Meeting l. M-Consulting Group a. Tv/lnternet Survey Results b. Provider Proposal Comparison Presentation c. Next steps d. Board Dlscussion Please remember that your participation is limited to listening for most of the meeting except for ltem lX, the Open Forum segment. As a reminder, you are only permitted to comment on atenda items. Zoom M e eti ng I nfomotion : Topic: Odober Board MeetinS & Workshop Time: Oct 29, 2020 08:30 AM Eastern Time (US and Canada) Join Zoom Meeting hft ps://zoom.us/i/91519867315?Dwd=ZXl5WTlCZUhFRGYswi9ockVvYWZZz09 Due to social distancing practices we are not making in-person attendance available at this meeting. We are, however, providing access to this meeting via the zoom link provided below. 9.A.5.f Packet Pg. 1583 Attachment: Attachment E - Opposition Letters (13384 : PL20200000564 Bembridge PUDA) Meeting lD: 915 1986 7316 Passcode: 268355 One tap mobile +73!262667 99,,97579a6n76i,,,,,,M,,268355fl US (ChicaSo) +16455588656,,91579B673rffi ,,,,,,M,,268355# US (New york) Dial by your location +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New york) +1 301 715 8592 US (Germantown) +7 346 248 7799 US (Houston) +1 659 900 9128 US (San Jose) +1 253 215 8782 US (Tacoma) Meeting lD: 915 1986 7316 Passcode:268355 Find your local number: https://zoom.us/u/ad6AuVtVcU 9.A.5.f Packet Pg. 1584 Attachment: Attachment E - Opposition Letters (13384 : PL20200000564 Bembridge PUDA) FinnTimothy From: Sent: To: Subject: Atta€hments: EXTERNAT EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Enclosed are items for my statement opposing the proposed Bembridge project. lncluded herein is an Agenda and record of our Master Board's meeting on October 29,2020 wherein the board unanimously accepted the attached Resolution. On the 19th we may have other speakers as well. lf ready in time I will forward you their statements. Thank you for the opportunity to provide these statements. 1 Roy Anderson < eanderson0T5@gmail.com > Monday, November 9,2020 2:25 PM FinnTimothy Bembridge Nov 19 MB Res Bembridge.pdf 9.A.5.f Packet Pg. 1585 Attachment: Attachment E - Opposition Letters (13384 : PL20200000564 Bembridge PUDA) RESOLUTION REGARDING THE BEMBRIDGE SERVICES COMPLEX COMMI.INITY FACILITIES PLANNED LI-NIT DEVELOPMENT DAIE: September 29, 2020 COMMITTEE: External Community Relations CHAIRPERSON: Roy B. Anderson CURRENT POLICY REFERENCES: 3.9.11.2. A. and B WHEREAS: The project proposal is located on the east side of Santa Barbara Boulevard and is apart of the subject complex which comprises 39.8 acres. It includes the already-built projects of Calusa Park Elementary School, the Emergency Management Station #7 5, water management lakes, land for a future wastewater master pumping station (1.33 acres) and land for this proposed affordable housing project (3.77 acres), WHEREAS: The parcels of interest are the pumping station and the housing sites, which front Santa Barbara Boulevard directly opposite Countryside, specifically the Country Hollow and Country Haven communities.. The immediate project is for the housing site only, not the pump station site, WHEREAS: At aNeighborhood Information Meeting (NIM) on January 30,2020,the housing project as presented consisted of 42 affordable housing units to be two stories high on a site of 6.3 acres. The ECRC reviewed this project and concluded that it would have a minimal impact on Countryside, however it would be monitored in the future, WHEREAS: Another NIM was held on September 10,2020 and the project now proposed consisted of 82 affordable housing units on a3.77 acre site and with three-story high buildings, WHEREAS: The 82-unit proposal will require the approval of the Collier County Planning Commission and the Board of County Commissioners for density bonuses for affordable housing. Further, they propose applying the density bonus not only to the project's 3.77 acres but also to the 1.33 acres designated for the pumping station for purposes of calculating the total allowable units which will all be on the 3.77 acre site. WHEREAS: The increase in size of the project as now proposed will have a material effect on Countryside including most importantly, visual impacts as well as noise and traffic impacts. Countrysiders in this area are already impacted by sirens from EMS vehicles, NOW THEREFORE: That the Master Board go on record as opposing use of the affordable housing bonus and use of the pumping station land to achieve the total project size of 82 housing units with three story buildings. 9.A.5.f Packet Pg. 1586 Attachment: Attachment E - Opposition Letters (13384 : PL20200000564 Bembridge PUDA) FinnTimoth From: Sent: To: Cc: Roy Anderson <eanderson075@gmail.com> Tuesday, November 10, 2020 3:02 PM FinnTimothy Bev Whiteman; Joe Smith EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. I am Beverly Whiteman, a Countryside resident and I serve on the Countryside Master Board. The Countryside Golf and Country Club comprises 1133 families living out their dreams and enjoying the amenities of the surrounding area. Our Board was disturbed to hear of the Bembridge proposal to construct three-story high buildings on santa Barbara Boulevard within clear view of Countryside residents. The eastern vista seen by Countryside is generally low profile even with the Calusa Park School and the EMS station structu res. The original proposal for two-story structures was much more palatable to our Board. We appreciate the need for affordable rental housing in the County which this project will provide. However, we implore you to eliminate a potential eyesore from being inflicted upon our residents. Please be advised that our Master Board unanimously approved a Resolution opposing this Bembridge proposal on October 29, 2020.This Resolution is being provided by others to the planning Commission. 1 9.A.5.f Packet Pg. 1587 Attachment: Attachment E - Opposition Letters (13384 : PL20200000564 Bembridge PUDA) 11/19/2020 COLLIER COUNTY Collier County Planning Commission Item Number: 9.A.6 Item Summary: PL20190002680 - Safety Service Facility Golden Gate and DeSoto Blvd (CU) - A Resolution of the Board of Zoning Appeals of Collier County, Florida providing for the establis hment of a conditional use to allow a government safety service facility for fire and emergency medical services within the Estates (E) Zoning District with a Wellfield Risk Management Special Treatment Overlay Zone W-4 (ST/W-4), pursuant to Sections 2.03.01.B.1.c.8 and 2.01.03.G.1.e of the Collier County Land Development Code for a 5.46+/- acre property located at the southwest corner of the intersection of Golden Gate Blvd. East and DeSoto Blvd. in Section 9, Township 49 South, Range 28 East, Collier County, Florida. [Coordinator: Ray Bellows, Zoning Manager] Meeting Date: 11/19/2020 Prepared by: Title: – Zoning Name: Laura DeJohn 11/05/2020 11:02 AM Submitted by: Title: Manager - Planning – Zoning Name: Ray Bellows 11/05/2020 11:02 AM Approved By: Review: Planning Commission Diane Lynch Review item Completed 11/06/2020 3:05 PM Zoning Ray Bellows Review Item Completed 11/10/2020 4:13 PM Growth Management Operations & Regulatory Management Donna Guitard Review Item Completed 11/10/2020 4:37 PM Zoning Anita Jenkins Additional Reviewer Completed 11/10/2020 5:23 PM Growth Management Department James C French Review Item Completed 11/11/2020 7:41 PM Zoning Ray Bellows Review Item Completed 11/12/2020 11:09 AM Planning Commission Edwin Fryer Meeting Pending 11/19/2020 9:00 AM 9.A.6 Packet Pg. 1588 CU-PL20190002680; Safety Service Facility Conditional Use Page 1 of 11 November 5, 2020 STAFF REPORT TO: COLLIER COUNTY PLANNING COMMISSION FROM: ZONING DIVISION – ZONING SERVICES SECTION GROWTH MANAGEMENT DEPARTMENT HEARING DATE: NOVEMBER 19, 2020 SUBJECT: PL20190002680; SAFETY SERVICE FACILITY GOLDEN GATE AND DESOTO BLVD (CU) CONDITIONAL USE ______________________________________________________________________________ PROPERTY OWNER/AGENT: Owner: Board of County Commissioners Agent: D. Wayne Arnold, AICP 3335 Tamiami Trail E, Suite 101 Q. Grady Minor & Assoc. Naples, FL 34112 3800 Via Del Rey Bonita Springs, FL 34134 REQUESTED ACTION: To have the Collier County Planning Commission (CCPC) consider establishment of a Conditional Use to allow a Government Safety Service Facility including fire and emergency medical services within the Estates (E) zoning district with a Wellfield Risk Management Special Treatment Overlay Zone W-4 (ST/W-4), as provided in LDC Sections 2.03.01.B.1.c.8 and 2.01.03.G.1.e., on 5.46+/- acres located on the southwest corner of Golden Gate Boulevard and DeSoto Boulevard in the Rural Golden Gate Estates. Per Policy 1.1.8 of the Rural Estates Sub Element of the Golden Gate Area Master Plan adopted in the Growth Management Plan, to obtain conditional use approval, a super majority vote (minimum of 4 votes) by the Board of Zoning Appeals shall be required. GEOGRAPHIC LOCATION: The subject parcel is located on the southwest corner of the intersection of Golden Gate Boulevard East and Desoto Boulevard South in Section 9, Township 49 South, Range 28 East, Collier County, Florida. (See location map on the following page) 9.A.6.a Packet Pg. 1589 Attachment: 11-05-20 - Estates-EMS-CU-Staff Report with CAO signoff (14187 : PL20190002680 - Safety Service Facility Golden Gate and CU-PL20190002680; Safety Service Facility Conditional Use Page 2 of 11 November 5, 2020 9.A.6.aPacket Pg. 1590Attachment: 11-05-20 - Estates-EMS-CU-Staff Report with CAO signoff (14187 : PL20190002680 - Safety CU-PL20190002680; Safety Service Facility Conditional Use Page 3 of 11 November 5, 2020 PURPOSE/DESCRIPTION OF PROJECT: The petitioner seeks a Conditional Use for an Essential Service facility on property zoned the Estates (E) with Wellfield Risk Management Special Treatment Overlay Zone W-4 (ST/W-4) in the Rural Estates area of Golden Gate Estates. The petitioner proposes a safety service facility for serving the surrounding area with Collier County Emergency Medical Services and Greater Naples Fire Rescue District services. The subject property is 5.46+ acres and is located on the southwest corner of Golden Gate Boulevard and DeSoto Boulevard. To accommodate the future expansion of both Golden Gate and DeSoto Boulevards, a right-of-way reservation is designated across 1.82+ acres of the site for future roadway improvements. This reservation for public right-of-way results in 3.64+ acres of developable area. The Conceptual Site Plan (included on the following page) depicts a 26,000 square foot building that is set back a minimum of 75 feet from the Right-of-Way reservation line on the east and from the north and west property lines, and 205 feet from the south property line. The facility is designed to allow for EMS and the Greater Naples Fire Rescue District to maintain the adopted level of service for response times in the area. The site provides native vegetation preservation of 0.36+ acres as required, and provides a total of 1.1+ acres of required open space. Property to the west is occupied with a single family home, and property to the south is undeveloped. A Type “B” buffer is provided along the west and south property lines. A Type “D” buffer is provided along the northern and eastern boundaries facing the road rights-of-way. Vehicular ingress/egress is proposed from both Golden Gate Boulevard and DeSoto Boulevard. Sidewalks will also be required along these rights-of-way. The water management area is shown on the southern portion of the property adjacent to the preserve area. The petitioner provided examples of architecture for the facility (included in Attachment B) to demonstrate building design and building placement consistent with the rural residential nature of the area. The site is within the Wellfield Risk Management Special Treatment Overlay Zone W-4 (ST/W- 4) designated for the East Golden Gate Well Field. Pollution Control staff has reviewed this petition and notes the Land Development Code regulates development within the ST/W-4 zone and that disposal of hazardous waste is prohibited. 9.A.6.a Packet Pg. 1591 Attachment: 11-05-20 - Estates-EMS-CU-Staff Report with CAO signoff (14187 : PL20190002680 - Safety Service Facility Golden Gate and CU-PL20190002680; Safety Service Facility Conditional Use Page 4 of 11 November 5, 2020 Conceptual Site Plan 9.A.6.a Packet Pg. 1592 Attachment: 11-05-20 - Estates-EMS-CU-Staff Report with CAO signoff (14187 : PL20190002680 - Safety Service Facility Golden Gate and CU-PL20190002680; Safety Service Facility Conditional Use Page 5 of 11 November 5, 2020 SURROUNDING LAND USE AND ZONING: This section of the staff report identifies the land uses and zoning classifications for properties surrounding the boundaries of the subject property, which is undeveloped and zoned (E) Estates with Wellfield Risk Management Special Treatment Overlay Zone W-4 (ST/W-4). North: Golden Gate Boulevard East and Single Family Home zoned Estates (E-ST/W-4) East: Desoto Boulevard South and undeveloped property zoned Estates (E-ST/W-4) South: Undeveloped property zoned Estates (E-ST/W-4) West: Single Family Home zoned Estates (E-ST/W-4) GROWTH MANAGEMENT PLAN (GMP) CONSISTENCY: Comprehensive Planning staff has reviewed this request and offered the following comments: Future Land Use Element (FLUE): The subject property is designated Residential Estates Subdistrict of the Estates – Mixed Use District, as depicted on the Future Land Use Map (FLUM) in the Rural Golden Gate Estates Sub-Element of the Golden Gate Area Master Plan Subject Site 9.A.6.a Packet Pg. 1593 Attachment: 11-05-20 - Estates-EMS-CU-Staff Report with CAO signoff (14187 : PL20190002680 - Safety Service Facility Golden Gate and CU-PL20190002680; Safety Service Facility Conditional Use Page 6 of 11 November 5, 2020 adopted as part of the Growth Management Plan (GMP). The parcel is zoned E, Estates district with Wellfield Risk Management Special Treatment Overlay Zone W-4 (E-ST/W-4). The Residential Estates Subdistrict of the Estates – Mixed Use District designation allows single- family residential development at a maximum density of one unit per 2.25 gross acres. Generally, the Estates Designation also accommodates future non-residential uses, including: Conditional Uses Subdistrict Per Policy 1.1.7 and 3.1.2 of the Rural Golden Gate Estates Sub-Element, various types of conditional uses are permitted in the Estates zoning district within the Rural Golden Gate Estates area. In order to control the location and spacing of new conditional uses, one of the following four sets of criteria shall be met. a. Essential Services Conditional Use Provisions: Those Essential Services Conditional Uses, as identified within Section 2.01.03 G. of the Collier County Land Development Code, may be allowed anywhere within the Estates Zoning District, except as prohibited in certain Neighborhood Centers, and are described as: 1. electric or gas generating plants, ………….. 9. public safety service facilities, and other similar facilities. Policy 1.1.8 of Rural Golden Gate Estates Sub-Element specifies the procedural requirement for conditional uses in Rural Golden Gate Estates: To obtain Conditional Use approval, a super majority vote (minimum of 4 votes) by the Board of Zoning Appeals shall be required. Based upon the above GMP Policy, the petition conforms with allowances in the Future Land Use Element and is required to be heard by the CCPC and the BZA, with a super majority vote required for approval. Transportation Element: The project is consistent with Policy 5.1 of the Transportation Element of the Growth Management Plan, which states, “The County Commission shall review all rezone petitions, SRA designation applications, conditional use petitions, and proposed amendments to the Future Land Use Element (FLUE) affecting the overall countywide density or intensity of permissible development, with consideration of their impact on the overall County transportation system, and shall not approve any petition or application that would directly access a deficient roadway segment as identified in the current AUIR or if it impacts an adjacent roadway segment that is deficient as identified in the current AUIR, or which significantly impacts a roadway segment or adjacent roadway segment that is currently operating and/or is projected to operate below an adopted Level of Service Standard within the five year AUIR planning period, unless specific mitigating stipulations are also approved. A 9.A.6.a Packet Pg. 1594 Attachment: 11-05-20 - Estates-EMS-CU-Staff Report with CAO signoff (14187 : PL20190002680 - Safety Service Facility Golden Gate and CU-PL20190002680; Safety Service Facility Conditional Use Page 7 of 11 November 5, 2020 petition or application has significant impacts if the traffic impact statement reveals that any of the following occur: a. For links (roadway segments) directly accessed by the project where project traffic is equal to or exceeds 2% of the adopted LOS standard service volume; b. For links adjacent to links directly accessed by the project where project traffic is equal to or exceeds 2% of the adopted LOS standard service volume; and c. For all other links the project traffic is considered to be significant up to the point where it is equal to or exceeds 3% of the adopted LOS standard service volume. Mitigating stipulations shall be based upon a mitigation plan prepared by the applicant and submitted as part of the traffic impact statement that addresses the project’s significant impacts on all roadways.” According to the TIS provided with this petition dated May 19, 2020 the proposed EMS Station will generate a projected +/- 17 PM Peak Hour, 2-way trips on the adjacent roadways Golden Gate Boulevard and DeSoto Boulevard. According to the current 2019 AUIR the Golden Gate Boulevard segment from Everglades Boulevard to DeSoto Boulevard, link 124.0, currently operates at a LOS of “B” with a remaining capacity of 778 trips based on a peak capacity-peak direction service volume of 1,010 trips. The DeSoto Boulevard segment from Golden Gate Boulevard to Oil Well Road, link 138.0, currently operates at a LOS of “B” with a remaining capacity of 662 trips based on a peak capacity-peak direction service volume of 800 trips. Staff notes that by the time this petition is heard by the Planning Commission it is anticipated that the Collier County Board of County Commissions (BCC) will adopt the 2020 AUIR. The draft 2020 AUIR shows that the Golden Gate Boulevard segment from Everglades Boulevard to DeSoto Boulevard will operate at a LOS of “B” with a remaining capacity of 773 trips; and the DeSoto Boulevard segment from Golden Gate Boulevard to Oil Well Road will operate at a LOS of “B” with a remaining capacity of 652 trips. Therefore, the subject Conditional Use can be found consistent with Policy 5.1 of the Transportation Element of the Growth Management Plan, and as noted above, the Traffic Impact Statement (TIS) indicates that the adjacent roadway network has sufficient capacity to accommodate this project within the 5-year planning period. Conservation & Coastal Management Element (CCME): Environmental review staff has found this project to be consistent with the Conservation & Coastal Management Element (CCME). The project site consists of 3.64 acres of native vegetation. A minimum of 0.36 acres (10%) of the existing native vegetation shall be placed under preservation and dedicated to Collier County. GMP Conclusion: Based upon the above GMP policy review, the petition is consistent with the GMP and is required to be heard by the CCPC and the BZA, with a super majority vote required for approval. STAFF ANALYSIS: Staff has completed a comprehensive evaluation of this land use petition including the criteria upon which a recommendation must be based. This evaluation is completed as part of the 9.A.6.a Packet Pg. 1595 Attachment: 11-05-20 - Estates-EMS-CU-Staff Report with CAO signoff (14187 : PL20190002680 - Safety Service Facility Golden Gate and CU-PL20190002680; Safety Service Facility Conditional Use Page 8 of 11 November 5, 2020 Zoning and Land Development Review provided below. In addition, staff offers the following analyses: Environmental Review: Environmental Planning staff has reviewed the Conditional Use petition to address environmental concerns. The preserve requirement is 0.36 acres (10% of 3.64 acres). The Master Plan provides a 0.36-acre preserve, which meets the minimum 10 percent native preservation requirement in accordance with LDC 3.05.07. No listed animal species were observed on the property; however, the property has suitable habitat for various listed species. The existing onsite vegetation is potential nesting habitat for Big Cypress Fox Squirrel (Sciurus niger avicennia). No Big Cypress Fox Squirrels were observed onsite; however, prior to the site clearing state of the proposed development, additional observations for Big Cypress Fox Squirrel nests will be needed. The proposed project is located within the U.S. Fish & Wildlife (FWS) consultation area for Bonneted Bat (Eumops floridanus); however, no evidence was found indicating the trees onsite were being utilized. The Florida Fish and Wildlife Conservation Commission (FWC) wildlife data indicates the presence of Black Bear (Ursus americanus floridanus) in the area. A black bear management plan will need to be included at PPL or SDP review. The Environmental data indicates the subject property falls within FWS Primary Florida Panther (Felis concolor coryi) habitat. There were no observations of panther onsite; however, consultation with FWS may require panther mitigation. Additionally, Stiff-leafed wild-pine (Tillandsia fasciculata) and Inflated wild-pine (Tillandsia balbisiana), listed as less rare plants, have been observed on the property and will be protected in accordance with LDC Section 3.04.03. This project does not require Environmental Advisory Council (EAC) review, as this project did not meet the EAC scope of land development project reviews as identified in Section 2-1193 of the Collier County Code of Laws and Ordinances. Environmental Planning staff recommend approval of the proposed petition. Transportation Review: Transportation Division staff has reviewed the petition request and Conceptual Site Plan for right-of-way and access issues and is recommending approval. Utilities Review: Collier County Utilities staff defers to Florida Department of Health review staff because the subject site is not served by the public utility system and will be served by on site well and septic. As conditions of approval, it is noted that the design of the septic system will be determined based on final building size and daily staffing and operations, in accordance with Florida Department of Environmental Protection (FDEP) requirements at the time of SDP. Washing of vehicles would be considered industrial waste and would need to be reviewed by FDEP for the how disposal of this water will be handled. Conditional Use Findings: Before any Conditional Use recommendation can be offered to the Board of Zoning Appeals (BZA), the Collier County Planning Commission (CCPC) must make findings that: 1) approval of the Conditional Use will not adversely affect the public interest and will not adversely affect other property of uses in the same district of neighborhood; and 2) all specific requirements for the individual Conditional Use will be met; and 3) satisfactory provisions have been made concerning the following matters, where applicable: 9.A.6.a Packet Pg. 1596 Attachment: 11-05-20 - Estates-EMS-CU-Staff Report with CAO signoff (14187 : PL20190002680 - Safety Service Facility Golden Gate and CU-PL20190002680; Safety Service Facility Conditional Use Page 9 of 11 November 5, 2020 1. Section 2.03.01 of the LDC permits certain essential service facilities as conditional uses in the Estates zoning district. The requested for the safety service facility is allowed through the conditional use process on properties in the Estates zoning district per Land Development Code (LDC) Sections 2.01.03.G.1.e. and 2.03.01.B.1.c.8 which state: 2.01.03.G. Conditional uses. The following uses require approval pursuant to section 10.08.00 conditional uses: 1. Conditional essential services in every zoning district excluding the RFMU district sending lands, CON districts, NRPAs, and RLSA designated HSAs and FSAs. In every zoning district, unless otherwise identified as permitted uses, and excluding RFMU district Sending Lands, CON districts, and NRPAs, the following uses shall be allowed as conditional uses: … e. Government facilities, including where not identified as a permitted use in this section, safety service facilities such as including law enforcement, fire, emergency medical services;… 2.03.01.B. Estate District (E). 1. The following subsections identify the uses that are permissible by right and the uses that are allowable as accessory or conditional uses in the estates district (E). … c. Conditional uses. For Estates zoning within the Golden Gate Estates subdivision, the Golden Gate Area Master Plan in the GMP restricts the location of conditional uses. The following uses are permissible as conditional uses in the estates district (E), subject to the standards and procedures established in LDC section 10.08.00: … 8. Essential services, as set forth in subsection 2.01.03 G. 2. Consistency with the Land Development Code (LDC) and the Growth Management Plan (GMP). The Future Land Use designation for the subject parcel is Estates, Mixed Use District, Residential Estates Subdistrict on the Rural Golden Gate Estates Future Land Use Map. The proposed service facility is consistent with the Golden Gate Area Master Plan (GGAMP) adopted as part of the Growth Management Plan (GMP). The GGAMP contains restrictions on the location of potential conditional uses. Policy 1.1.7 and 3.1.2 of the GGAMP requires that all conditional uses adhere to the guidelines outlined in the Conditional Use Subdistrict. Under the “Essential Services Conditional Use Provisions” the Plan does allow “governmental facilities,” as further defined in section 2.0.03.G.1.e of the Land Development Code (LDC) to include safety service facilities, as a conditional use; thus, the proposed safety service facility may be approved as a conditional use. Additionally, Policy 1.1.8 of the 9.A.6.a Packet Pg. 1597 Attachment: 11-05-20 - Estates-EMS-CU-Staff Report with CAO signoff (14187 : PL20190002680 - Safety Service Facility Golden Gate and CU-PL20190002680; Safety Service Facility Conditional Use Page 10 of 11 November 5, 2020 GGAMP requires a super majority vote (minimum of 4 votes) by the Board of Zoning Appeals to obtain Conditional Use approval. 3. Ingress and egress to the property and proposed structures thereon, with particular reference to automotive and pedestrian safety and convenience, traffic flow and control, and access in case of fire or catastrophe. The site is on the corner of a major intersection of Golden Gate Boulevard and DeSoto Boulevard. Vehicular access to the site is provided with driveways on both roadways, allowing emergency response vehicles to move in all directions. A right-of-way reservation area is identified on the conceptual site plan to accommodate public roadway improvements at this intersection. The TIS submitted by the applicant indicates that the adjacent roadway network has sufficient capacity to accommodate this project within the 5-year planning period as noted above and not adversely impact the surrounding roadway network. Pedestrian safety will be accommodated by sidewalks and crosswalks as required by the LDC at the time of Site Development Plan (SDP) review. 4. The effect the Conditional Use would have on neighboring properties in relation to noise, glare, economic or odor effects. The proposed building provides minimum setbacks of 75 feet from property lines. Buffering, preserve placement and required open space are provided to minimize impacts to neighboring properties. Additionally: • Noise generated by sirens is mitigated by EMS and Fire District siren protocols in residential areas, which are determined by the operations command based on the severity and location of the emergency call. • The Conceptual Site Plan includes a note that all on-site lighting shall be shielded and directed away from adjoining properties, and parking lot lighting is limited to 15 feet in height. • The petitioner has indicated that refuse containers will be roll out totes and not dumpsters. The compliance with setbacks, landscape buffering, and lighting standards and management of noise and refuse as described above will address potential for impacts on neighboring properties. Economic impacts are anticipated to be similar to other similarly situated safety facilities which provide enhancement to service levels in Golden Gate Estates. 5. Compatibility with adjacent properties and other property in the district. With the architectural building design and placement on the site, the placement of preserve areas on the western and southern boundaries of the property, and landscape buffers, the adjoining residential properties will be separated from the facility. The location of essential safety services in a residential area is functionally compatible. 9.A.6.a Packet Pg. 1598 Attachment: 11-05-20 - Estates-EMS-CU-Staff Report with CAO signoff (14187 : PL20190002680 - Safety Service Facility Golden Gate and CU-PL20190002680; Safety Service Facility Conditional Use Page 11 of 11 November 5, 2020 NEIGHBORHOOD INFORMATION MEETING (NIM): The NIM was held on October 14, 2020 at Saint Monica’s Episcopal Church, 7070 Immokalee Road, Naples, FL 34119. A transcript of the NIM is included in Attachment B. The petitioner addressed a question about the amount of parking shown on the Conceptual Site Plan, stating the amount of parking required may be less and will be determined during the development phase. Location of bay doors in relation to the existing home to the west was also described as something that will be determined during the development phase. When asked about architecture, the County Facilities Management representative stated that the style of EMS Station 25 at Hacienda Lakes with a metal roof may be fitting for the subject site. Several emails have been received in support of the petition. Correspondence received from the public is included as Attachment C. COUNTY ATTORNEY OFFICE REVIEW: The County Attorney Office has reviewed the staff report on November 2, 2020. RECOMMENDATION: Staff recommends that the Collier County Planning Commission (CCPC) forward Petition CU- PL20190002680 to the Board of Zoning Appeals (BZA) with a recommendation of approval subject to the two-page Conceptual Site Plan accompanying the proposed resolution and subject to the following conditions: 1. Architecture shall be similar to EMS Station 25 located at Hacienda Lakes or EMS Station 76 located at the corner of Logan Boulevard and Vanderbilt Beach Road. 2. Design of the septic system will be determined based on final building size and daily staffing and operations, in accordance with Florida Department of Environmental Protection (FDEP) requirements at the time of SDP. Washing of vehicles would be considered industrial waste and would need to be reviewed by FDEP for the how disposal of this water will be handled. Attachments: A. Proposed Resolution B. Application/Backup Material C. Public input received as of October 27, 2020 Tentatively scheduled for hearing by the Board of Zoning Appeals on January 26, 2021. 9.A.6.a Packet Pg. 1599 Attachment: 11-05-20 - Estates-EMS-CU-Staff Report with CAO signoff (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.b Packet Pg. 1600 Attachment: ATTACHMENT A - Resolution - 110520 (14187 : PL20190002680 - Safety Service Facility Golden Gate and DeSoto Blvd (CU)) 9.A.6.b Packet Pg. 1601 Attachment: ATTACHMENT A - Resolution - 110520 (14187 : PL20190002680 - Safety Service Facility Golden Gate and DeSoto Blvd (CU)) 9.A.6.b Packet Pg. 1602 Attachment: ATTACHMENT A - Resolution - 110520 (14187 : PL20190002680 - Safety Service Facility Golden Gate and DeSoto Blvd (CU)) 9.A.6.b Packet Pg. 1603 Attachment: ATTACHMENT A - Resolution - 110520 (14187 : PL20190002680 - Safety Service Facility Golden Gate and DeSoto Blvd (CU)) 9.A.6.b Packet Pg. 1604 Attachment: ATTACHMENT A - Resolution - 110520 (14187 : PL20190002680 - Safety Service Facility Golden Gate and DeSoto Blvd (CU)) 9.A.6.b Packet Pg. 1605 Attachment: ATTACHMENT A - Resolution - 110520 (14187 : PL20190002680 - Safety Service Facility Golden Gate and DeSoto Blvd (CU)) Q. Grady Minor & Associates, P.A. 3800 Via Del Rey, Bonita Springs, FL 34134  239-947-1144  engineering@gradyminor.com  www.gradyminor.com EMS/Fire Station CU (PL20190002680) Application and Supporting Documents November 19, 2020 CCPC Hearing 9.A.6.c Packet Pg. 1606 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and Q. Grady Minor & Associates, P.A. Ph. 239-947-1144 Fax. 239-947-0375 3800 Via Del Rey EB 0005151 LB 0005151 LC 26000266 Bonita Springs, FL 34134 www.gradyminor.com May 28, 2020 Zoning Staff Collier County Growth Management Division/ Planning and Regulation Land Development Services Department 2800 North Horseshoe Drive Naples, FL 34104 RE: EMS Station Golden Gate Blvd and DeSoto Blvd (CU) – PL20190002680, Submittal 1 Dear Zoning Staff: A Collier County application for Public Hearing for Conditional Use (CU) is being filed electronically for review. The subject property is 5.5+/- acres in size and is located on the southwest corner of Golden Gate Boulevard and DeSoto Boulevard. The applicant is proposing to redevelop the property with an Emergency Medical/Fire Station. Documents filed with submittal 1 include the following: 1. Cover Letter 2. Application for a Public Hearing for CU 3. Evaluation Criteria 4. Pre-application meeting notes 5. Affidavit of Authorization 6. Addressing Checklist 7. Property Ownership Disclosure 8. Warranty Deed(s) 9. Boundary Survey 10. Location Map 11. Conceptual Site Plan 12. Environmental Data 13. Traffic Impact Study Please feel free to contact me should you have any questions. Sincerely, D. Wayne Arnold, AICP c: Collier County Facilities Management GradyMinor File (CCU270) 9.A.6.c Packet Pg. 1607 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 1 of 12 APPLICATION FOR PUBLIC HEARING FOR: CONDITIONAL USE LDC Section 10.08.00 & Code of Laws section 2-83 – 2-90 Chapter 3 C.1 of the Administrative Code PETITION NO (PL) PROJECT NAME DATE PROCESSED A CONDITIONAL USE TO BE HEARD BY THE PLANNING COMMISSION AND BOARD OF ZONING APPEALS A MINOR CONDITIONAL USE TO BE HEARD BY THE OFFICE OF THE HEARING EXAMINER APPLICANT CONTACT INFORMATION Name of Property Owner(s): ______________________________________________________ Name of Applicant if different than owner: __________________________________________ Address: ____________________________City: _____________ State: ________ ZIP: _______ Telephone: ____________________ Cell: ____________________ Fax: ___________________ E-Mail Address: ________________________________________________________________ Name of Agent(s): _____________________________________________________________ Firm: _________________________________________________________________________ Address: ____________________________City: _____________ State: ________ ZIP: _______ Telephone: ____________________ Cell: _____________________ Fax: __________________ E-Mail Address: ________________________________________________________________ BE AWARE THAT COLLIER COUNTY HAS LOBBYIST REGULATIONS. GUIDE YOURSELF ACCORDINGLY AND ENSURE THAT YOU ARE IN COMPLIANCE WITH THESE REGULATIONS. To be completed by staff Collier County, a Political Subdivision of the State of Florida 3335 Tamiami Trail E, Ste 101 Naples FL 34112 239-252-8880 Damon.Grant@colliercountyfl.gov D. Wayne Arnold, AICP Q. Grady Minor & Associates, P.A. 3800 Via Del Rey Bonita Springs FL 34134 239-947-1144 warnold@gradyminor.com 9.A.6.c Packet Pg. 1608 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 2 of 12 ASSOCIATIONS Required: List all registered Home Owner Association(s) that could be affected by this petition. Provide additional sheets if necessary. Information can be found on the Board of County Commissioner’s website at http://www.colliergov.net/Index.aspx?page=774. Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ Name of Homeowner Association: _________________________________________________ Mailing Address: ____________________________ City: _________ State: ______ ZIP: ______ PROPERTY INFORMATION On separate page, provide a detailed legal description of the property covered by the application: x If the request involves changes to more than one zoning district, the applicant shall include separate legal description for property involved in each district; x The applicant shall submit 4 copies of a recent survey (completed within the last six months, maximum 1" to 400' scale), if required to do so at the pre-application meeting; and x The applicant is responsible for supplying the correct legal description. If questions arise concerning the legal description, an engineer's certification or sealed survey may be required. Property I.D. Number: ____________________________ Plat Book: _______ Page #: _______ Section/Township/Range: _______ /_______ /_______ Subdivision: __________________________________________Lot: ________ Block: ________ Metes & Bounds Description: _____________________________________________________ Size of Property: _____ft. X ______ ft. = _______ Total Sq. Ft. Acres: _____________ Address/ General Location of Subject Property: ______________________________________________________________________________ ______________________________________________________________________________ N.A. 40806320009 94928 Golden Gate Est Unit 79 TR 72 N.A. see boundary survey included with submittal 1 Southwest corner of Golden Gate Blvd and DeSoto Blvd 9.A.6.c Packet Pg. 1609 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 3 of 12 ADJACENT ZONING AND LAND USE Zoning Land Use N S E W If the owner of the subject property owns contiguous property please provide a detailed legal description of the entire contiguous property: (If space is inadequate, attach on a separate page) Section/Township/Range: / / Lot: Block: Subdivision: __________________________________________ Plat Book: Page #: Property I.D. Number: ____________________________ Metes & Bounds Description: ________________________________________________ CONDITIONAL USE REQUEST DETAIL Type of Conditional Use: This application is requesting a conditional use as allowed, pursuant to LDC section 2.03.00, of the _______________________ zoning district for _______________________ (type of use). Present Use of the Property: __________________________________________ *Including fire and emergency medical services E, Estates (ST/W-4) Residential E, Estates (ST/W-4) Residential E, Estates (ST/W-4) Residential E, Estates (ST/W-4) Residential N.A. N.A.N.A. N.A. N.A. N.A. N.A.N.A.N.A. N.A. Estates (ST/W-4)Safety Service Facility* Undeveloped residential 9.A.6.c Packet Pg. 1610 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 4 of 12 EVALUATION CRITERIA Pursuant to LDC section 10.08.00 and Chapter 3 C.1 of the Administrative Code, staff’s recommendation to the reviewing body shall be based upon a finding that the granting of the conditional use will not adversely affect the public interest and that the specific requirements governing the individual conditional use, if any, have been met. Further, satisfactory provision and arrangement have been made concerning the following matters, where applicable. On a separate page, provide a narrative statement describing a request for a conditional use and a detailed response to the criteria listed below. Specify how and why the request is consistent with each of the criteria. a. Describe how the project is consistent with the Collier County Land Development Code and Growth Management Plan. Include information on how the request is consistent with the applicable section or portions of the Future Land Use Element. b. Describe the existing or planned means of ingress and egress to the property and proposed structure thereon with particular reference to automotive and pedestrian safety and convenience, traffic flow and control, and access in case of fire or catastrophe. c. Describe the effect the conditional use will have on neighboring properties in relation to noise, glare, economic impact, and odor. d. Describe the site’s and the proposed use’s compatibility with adjacent properties and other properties in the district. e. Please provide any additional information which you may feel is relevant to this request. Deed Restrictions: The County is legally precluded from enforcing deed restrictions; however, many communities have adopted such restrictions. You may wish to contact the civic or property owners association in the area for which this use is being requested in order to ascertain whether or not the request is affected by existing deed restrictions. Previous land use petitions on the subject property: To your knowledge, has a public hearing been held on this property within the last year? If so, what was the nature of that hearing? _____________________________________________________________________________________ _____________________________________________________________________________________ Official Interpretations or Zoning Verifications: To your knowledge, has there been an official interpretation or zoning verification rendered on this property within the last year? No Yes (If yes please provide copies.) N.A. 9.A.6.c Packet Pg. 1611 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 5 of 12 STATEMENT OF UTILITY PROVISIONS FOR CONDITIONAL USE REQUEST APPLICANT INFORMATION Name of Applicant(s): ___________________________________________________________ Address: ______________________________City: ___________ State: ________ ZIP: _______ Telephone: ____________________ Cell: _____________________ Fax: __________________ E-Mail Address: ________________________________________________________________ Address of Subject Property (If available): ___________________________________________ City: ________________ State: __________ ZIP: ___________ LEGAL DESCRIPTION Section/Township/Range: / / Lot: Block: Subdivision: _______________________________________________ Plat Book: Page #: Property I.D. Number: _________________________________ Metes & Bounds Description: _____________________________________________________ TYPE OF SEWAGE DISPOSAL TO BE PROVIDED Check applicable system: a. County Utility System b. City Utility System c. Franchised Utility System Provide Name: ____________________ d. Package Treatment Plant (GPD Capacity): ___________________ e. Septic System TYPE OF WATER SERVICE TO BE PROVIDED a. County Utility System b. City Utility System c. Franchised Utility System PROVIDE NAME_______________ d. Private System (Well) Total Population to be served: ____________________________________________________ Peak and Average Daily Demands: A. Water-Peak: _______ Average Daily: ________ B. Sewer-Peak: _______ Average Daily: ________ Collier County, a Political Subdivision of the State of Florida 3335 Tamiami Trail E, Ste 101 Naples FL 34112 239-252-8880 Damon.Grant@colliercountyfl.gov N.A. 94928 TR72 N.A.Golden Gate Estates, Unit No. 79 517 40806320009 see boundary survey included with submittal 1 X X 16 empl (septic calcs are peak) 1600 gpd 1600 gpd 9.A.6.c Packet Pg. 1612 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 6 of 12 If proposing to be connected to Collier County Regional Water System, please provide the date service is expected to be required: ____________________________________________ Narrative statement: Provide a brief and concise narrative statement and schematic drawing of sewage treatment process to be used as well as a specific statement regarding the method of affluent and sludge disposal. If percolation ponds are to be used, then percolation data and soil involved shall be provided from tests prepared and certified by a professional engineer. ______________________________________________________________________________ ______________________________________________________________________________ ______________________________________________________________________________ ______________________________________________________________________________ County Utility Dedication Statement: If the project is located within the service boundaries of Collier County’s utility service system, a notarized statement shall be provided agreeing to dedicate the water distribution and sewage collection facilities within the project area to the Collier County Utilities. This shall occur upon completion of the construction of these facilities in accordance with all applicable County ordinances in effect at that time. This statement shall also include an agreement that the applicable system development charges and connection fees will be paid to the County Utilities Division prior to the issuance of building permits by the County. If applicable, the statement shall contain an agreement to dedicate the appropriate utility easements for serving the water and sewer systems. ______________________________________________________________________________ ______________________________________________________________________________ ______________________________________________________________________________ ______________________________________________________________________________ Statement of Availability Capacity from other Providers: Unless waived or otherwise provided for at the pre-application meeting, if the project is to receive sewer or potable water services from any provider other than the County, a statement from that provider indicating adequate capacity to serve the project shall be provided. N.A. N.A. N.A. 9.A.6.c Packet Pg. 1613 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 7 of 12 RECORDING OF DEVELOPER COMMITMENTS Within 30 days of adoption of the Ordinance, the owner or developer at their expense shall record in the Public Records of Collier County a Memorandum of Understanding of Developer Commitments or Notice of Developer Commitments that contains the legal description of the property that is the subject of the land use petition and contains each and every commitment of the owner or developer specified in the Ordinance. The Memorandum or Notice shall be in form acceptable to the County and shall comply with the recording requirements of F.S. §695. A recorded copy of the Memorandum or Notice shall be provided to the assigned Principal Planner, Zoning Services Department, within 15 days of recording of said Memorandum or Notice. Chapter 8 of the Administrative Code requires that the applicant must remove their public hearing advertising sign(s) after final action is taken by the Board of County Commissioners. Based on the Board's final action on this item, please remove all public hearing advertising sign(s) immediately. 9.A.6.c Packet Pg. 1614 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 8 of 12 Pre-Application Meeting and Final Submittal Requirement Checklist for: A Conditional Use to be heard by the Planning Commission and Board of Zoning Appeals A Minor Conditional Use to be heard by the Office of the Hearing Examiner Chapter 3 C.1. of the Administrative Code The following Submittal Requirement Checklist is to be utilized during the Pre-Application Meeting, and at time of application submittal. At time of submittal, the checklist is to be completed and submitted with the application packet. Please provide the submittal items in the exact order listed below, with cover sheets attached to each section. Incomplete submittals will not be accepted. Requirements for Review # Of Copies Required Not Required Completed Application (download current form from County website) 1 Cover letter briefly explaining the project 1 Pre-Application Notes 1 Affidavit of Authorization, signed and notarized 1 Completed Addressing Checklist 1 Property Ownership Disclosure Form 1 Warranty Deed(s) 1 Boundary Survey 1 Conceptual Site Plan 24” X 36” plus (one 8 ½ X 11 copy) Plans showing proposed location for utilities, if required Plans for screening and buffering the use with reference as to type, dimensions, and character, if required Plans showing the proposed landscaping and provisions for trees protected by County regulations, if required Plans showing the proposed signs and lighting, including type, dimensions, and character, if required Architectural Rendering of Proposed Structure(s), if applicable 1 Current aerial photographs (available from Property Appraiser) with project boundary and, if vegetated, FLUCFCS Codes with legend included on aerial. 1 Statement of utility provisions (with all required attachments & sketches) 1 Environmental Data Requirements, pursuant to LDC section 3.08.00 1 Environmental Data Requirements collated into a single Environmental Impact Statement (EIS) at time of public hearings. Coordinate with project planner at time of public hearing. Listed Species Survey; less than 12 months old. Include copies of previous surveys. 1 Traffic Impact Study (TIS) or waiver 1 Historical and Archeological Survey, or waiver 1 Electronic copy of all documents and plans * Please advise: The Office of the Hearing Examiner requires all materials to be submitted electronically in PDF format. 1 * If located in the Bayshore/Gateway Triangle Redevelopment Area, include an additional set of each submittal requirement ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ 9.A.6.c Packet Pg. 1615 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 9 of 12 ADDITIONAL REQUIREMENTS FOR THE PUBLIC HEARING PROCESS: x Following the completion of the review process by County review staff, the applicant shall submit all materials electronically to the designated project manager. x Please contact the project manager to confirm the number of additional copies required. Planners: Indicate if the petition needs to be routed to the following additional reviewers: Bayshore/Gateway Triangle Redevelopment: Executive Director Emergency Management: Dan Summers; and/or EMS: Artie Bay Conservancy of SWFL: Nichole Johnson GMD Graphics City of Naples: Robin Singer, Planning Director Utilities Engineering: Eric Fey Parks and Recreation: Barry Williams Immokalee Water/Sewer District: Other: School District (Residential Components): Amy Lockheart Communication Towers: Mosquito Control Collier County Airport Authority Naples Airport Authority Commercial Mining: Impact Fees 9.A.6.c Packet Pg. 1616 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 10 of 12 FEE REQUIREMENTS All checks payable to: Board of County Commissioners Pre-Application Meeting: $500.00 (to be credited towards the application fee if the application is filed within 9 months of pre-application meeting) Conditional Use Application Fee: $4,000.00 o When filed with Rezone Petition: $1,500.00 o Additional fee for 5th and subsequent reviews: 20% of original fee Comprehensive Planning Consistency Review: $300.00 Environmental Data Requirements-EIS Packet (submittal determined at pre-application meeting): $2,500.00 Listed or Protected Species survey review fee (when an EIS is not required): $1,000.00 Transportation Fee, if required: o Methodology Review Fee: $500.00 o Minor Study Review Fee: $750.00 o Major Study Review Fee: $1,500.00 Estimated Legal Advertising Fee for the Hearing Examiner or CCPC: $1,125.00 Estimated Legal Advertising Fee for the BZA, if required: $500.00 Fire Code Plans Review Fees are collected at the time of application submission and those fees are set forth by the Authority having jurisdiction. The Land Development Code requires Neighborhood Notification mailers for Applications headed to hearing, and this fee is collected prior to hearing. As the authorized agent/applicant for this petition, I attest that all of the information indicated on this checklist is included in this submittal package. I understand that failure to include all necessary submittal information may result in the delay of processing this petition. All checks payable to: Board of County Commissioners. The completed application, all required submittal materials, and fees shall be submitted to: Growth Management Department ATTN: Business Center 2800 North Horseshoe Drive Naples, FL 34104 ____________________________________________ ____________ Agent/Owner Signature Date ____________________________________________ Agent/Owner Name (please print) 2 ____________________________________ X X X X X X X D. Wayne Arnold, AICP August 4, 2020 9.A.6.c Packet Pg. 1617 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 11 of 12 Public Participation Requirements LDC Section 10.03.06 B. or C. Chapter 8 of the Administrative Code Notice for Minor Conditional Use Petitions Neighborhood Information Meeting (NIM) Requirements: Applicant must conduct a NIM at least 15 days prior to the Hearing Examiner’s receipt of the staff report and application materials in accordance with the applicable sections of the Administrative Code. The NIM shall be advertised and a mailed written notice shall be given to the property owners in the notification area at least 15 days prior to the NIM meeting. Mailed Notice: Written notice shall be sent to property owners in the notification area at least 15 days before the advertised Hearing Examiner hearing. Newspaper Advertisements: The legal advertisement shall be published at least 15 days before the advertised Hearing Examiner hearing in a newspaper of general circulation. The advertisement shall include at a minimum: x Date, time, and location of the hearing; x Description of the proposed land uses; and x 2 in. x 3 in. map of the project location. Sign: A sign shall be posted at least 15 days before the advertised Hearing Examiner hearing date. Public Hearing for Minor Conditional Use Petitions Hearing Examiner: The Hearing Examiner shall hold at least 1 advertised public hearing. See Chapter 9 of the Administrative Code for the Office of the Hearing Examiner procedures. Notice for Conditional Use Petitions Neighborhood Information Meeting (NIM) Requirements: Applicant must conduct a NIM at least 15 days prior to the advertised public hearing. The NIM shall be advertised and a mailed written notice shall be given to the property owners in the notification area at least 15 days prior to the NIM meeting. 9.A.6.c Packet Pg. 1618 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 5/08/2018 Page 12 of 12 Mailed Notice: Written notice shall be sent to property owners in the notification area at least 15 days before the advertised public hearing. Newspaper Advertisements: The legal advertisement shall be published at least 15 days before the advertised public hearing in a newspaper of general circulation. The advertisement shall include at a minimum: x Date, time, and location of the hearing; x Description of the proposed land uses; and x 2 in. x 3 in. map of the project location. Sign: A sign shall be posted at least 15 days before the advertised public hearing date. Public Hearing for Conditional Use Petitions Environmental Advisory Committee (EAC): The EAC shall hold at least 1 advertised public hearing, if required. Collier County Planning Commission (CCPC): The CCPC shall hold at least 1 public hearing. Board of Zoning Appeals (BZA): The BZA shall hold at least 1 advertised public hearing. 9.A.6.c Packet Pg. 1619 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and EMS Station Golden Gate Blvd and Desoto Blvd Conditional Use (PL20190002680) Evaluation Criteria July 31, 2020 Page 1 of 3 CCU270A Evaluation Criteria-r1.docx Q. Grady Minor & Associates, P.A. 3800 Via Del Rey, Bonita Springs, FL 34134  239-947-1144  engineering@gradyminor.com  www.gradyminor.com Pursuant to LDC section 10.08.00 and Chapter 3 C.1 of the Administrative Code, staff’s recommendation to the reviewing body shall be based upon a finding that the granting of the conditional use will not adversely affect the public interest and that the specific requirements governing the individual conditional use, if any, have been met. Further, satisfactory provision and arrangement have been made concerning the following matters, where applicable. On a separate page, provide a narrative statement describing a request for a conditional use and a detailed response to the criteria listed below. Specify how and why the request is consistent with each of the criteria. Narrative The subject property is 5.5+/- acres in size and is located on the southwest corner of Golden Gate Boulevard and DeSoto Boulevard. The property is located in the Estates Designation, Mixed Use District, Residential Estates Subdistrict on the Rural Golden Gate Estates Future Land Use Map. The property is zoned E, Estates (ST/W-4). The applicant is proposing to develop the property for a Safety Service Facility with Emergency Medical Service (EMS) Station and facilities for the Greater Naples Fire Rescue District. a. Describe how the project is consistent with the Collier County Land Development Code and Growth Management Plan. Include information on how the request is consistent with the applicable section or portions of the Future Land Use Element. The proposed Conditional Use (CU) would allow an EMS/Fire station to be located on the southwest corner of the intersection of Golden Gate Boulevard and DeSoto Boulevard. This 5.5± acre parcel is designated Estates Designation, Mixed Use District, Residential Estates Subdistrict on the Rural Golden Gate Estates Future Land Use Map and the proposed safety service facility is consistent with the Golden Gate Area Master Plan (GGAMP). The GGAMP contains specific restrictions on the location of potential conditional uses. Policy 1.1.7 and 3.1.2 of the GGAMP requires that all conditional uses adhere to the guidelines outlined in the Conditional Use Subdistrict. Under the “Essential Services Conditional Use Provisions” the Plan does allow “governmental facilities”, as further defined in section 2.0.03.G.1.e of the Land Development Code (LDC), including safety service facilities, as a Conditional Use. The proposed EMS/Fire District facility is one of the uses permitted by conditional use. Objective 4.1 of the GGAMP encourages maintaining a careful balance between the provision of infrastructure and retention of the rural character of the Estates District. The proposed EMS/Fire (safety service facility) is necessary for the health, safety and welfare of the citizens of the area. By locating this station adjacent to a major thoroughfare response times to emergency calls will be decreased. Necessary right-of-way for improvements to the DeSoto/Golden Gate Boulevard intersection will also be provided which is a benefit to the public. In addition, a large portion of the site will be preserved for native vegetation. The location of the proposed site provides a necessary service while the conceptual site design is sensitive to the nature of the Estates and surrounding residential properties. Therefore, the proposed Conditional Use is consistent with Objective 4.1. 9.A.6.c Packet Pg. 1620 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and Page 2 of 3 Policy 4.3.1 of the GGAMP encourages preservation of natural resources and native vegetation in rural Golden Gate Estates. The CU Site Plan identifies a 0.36± acre area of native vegetation that will be preserved on-site consistent with this policy. Under the Future Land Use Element of the Collier County Growth Management Plan in conjunction with FLUE Policy 4.2 acknowledges the incorporation of the Golden Gate Area Master Plan into the FLUE. Policy 5.6 of the FLUE requires new development to be compatible with and complementary to surrounding land uses. The proposed joint EMS Fire station is responding to the need to provide safety services facilities in Golden Gate Estates in order to maintain mandated response times. The facility will be compatible with nearby residential homes through the use of architectural building design and building placement that will be in keeping with the rural residential nature of the area. Adequate landscape buffers and placement of preservation areas adjacent to nearby residents will assure both physical and visual separation, making the proposed EMS/Fire station compatible with the surrounding area. Objective 7 and implementing policies of the FLUE encourage internal connections and potential interconnections to surrounding properties. Due to the nature of the proposed safety service facility inter connection to adjacent properties is not feasible. The Trip Generation Report indicates that the traffic generated by the EMS station is minimal. The traffic generated will not significantly impact the surrounding road network, so the petition is consistent with Policies 5.1 and 5.2 of the Transportation Element of the GMP. Collier County will be taking additional right-of-way for future intersection improvements at the intersection of DeSoto Boulevard and Golden Gate Boulevard. The anticipated ROW taking area is identified on the CU Site Plan The conceptual site plan indicates a potential development plan including the building footprint, parking, landscape buffers and preserve locations for the site. Minor modifications may be made, but due to the preservation requirements, it is anticipated that the site will be developed as shown. Access is proposed to both Golden Gate Boulevard and to DeSoto Boulevard to facilitate efficient response to emergency calls. All development standards will be consistent with the LDC at the time of Site Development Plan review. Policy 6.1 of the CCME establishes criteria for the on-site preservation of native vegetation. The non- residential project is not located within the CHHA; therefore, a minimum of 10% of the on-site native vegetation must be retained. The site is less than 5 acres when the existing and future ROW areas are eliminated. The environmental assessment included in this application notes that the site contains 3.6± acres of vegetation and requires the preservation of a minimum of 0.36 acres of native vegetation. This preserve meets size criteria. All three stratums will be preserved as on contiguous preserve, meeting the shape criteria. And saving wetlands meets selection of native vegetation habitat priority. These areas will have all exotics, nuisance plant species eradicated. The CU Site Plan indicates that the preserve will be a minimum of 0.36 acres; thereby complying with Policy 6.1 of the CCME. b. Describe the existing or planned means of ingress and egress to the property and proposed structure thereon with particular reference to automotive and pedestrian safety and convenience, traffic flow and control, and access in case of fire or catastrophe. 9.A.6.c Packet Pg. 1621 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and Page 3 of 3 The proposed EMS station is approximately 26,000± square feet. Access points to the site are located on both Golden Gate Boulevard and DeSoto Boulevard. The subject property is located on the corner of a major intersection and emergency response vehicles will require the ability to move in all directions. The conceptual plan is designed to facilitate efficient response times without compromising the safety of the traveling public. Internal traffic flow is provided as a function of this flexibility, which will also aid the response to any potential onsite emergencies. Pedestrian safety will be accommodated by provision of sidewalks and crosswalks as required by the LDC at the time of Site Development Plan review. The future ROW taking area is identified on the CU Site Plan. c. Describe the effect the conditional use will have on neighboring properties in relation to noise, glare, economic impact, and odor. The proposed conceptual site plan minimizes impacts to neighboring properties. The nearest residence is adjacent to the preserve area and to the west of the project. Adequate setbacks and landscape buffering will decrease the immediate impacts of noise and glare. No economic impacts or effects from odor are anticipated as other similarly situated properties do exist in Golden Gate Estates. d. Describe the site’s and the proposed use’s compatibility with adjacent properties and other properties in the district. The subject property is immediately adjacent to two major roads and two lots with Estates (ST/W-4) zoning. The lots west and south of the subject property are developed with one single-family house on each lot. Potential impacts to residential lot to the west will be reduced by installation of adequate landscape buffering, including a six-foot high wall or hedge, native vegetation preserve and by the orientation of the building on the site. The home located to the south will be separated from the facility by the on-site preservation area. The intended layout locates the station as far from existing homes as possible. These factors combine to ensure compatibility with neighboring properties. e. Please provide any additional information which you may feel is relevant to this request. The subject property was purchased by the County in 2019 for right-of-way acquisition. Planned road improvements intensify the intersection and make this site less desirable for single-family residential development. The County also needs to ensure that adequate response times are maintained for EMS and Fire service in the rapidly growing area of Eastern Golden Gate Estates and Collier County. Both DeSoto Boulevard and Golden Gate Boulevard provide primary roadway access to Golden Gate Estates. Uses such as this EMS/Fire station are critical for providing safety services to the community and maintaining adequate level of service standards as required by the County’s Annual Update and Inventory Report (AUIR). 9.A.6.c Packet Pg. 1622 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1623 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1624 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1625 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1626 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1627 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1628 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1629 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1630 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1631 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1632 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1633 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1634 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1635 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1636 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and Applicant/Agent may also send site plans or conceptual plans for review in advance if desired. PL20190002680 – EMS Station GG and Desoto (CU) - PRE-APP INFORMATION Assigned Ops Staff: Ellen Murray Camden Smith, (Ops Staff) • Name and Number of who submitted pre-app request Sharon Umpenhour / 239-947-1144 / sumpenhour@gradyminor.com • Agent to list for PL# Q. Grady Minor & Associates, P.A. / D. Wayne Arnold • Owner of property (all owners for all parcels) ➢ 40806320009 – Christine M Stepien Et Al • Confirm Purpose of Pre-App: (Rezone, etc.) Conditional Use • Please list the details of the project including density, proposed or considered uses for the project, size of commercial vs. residential, number of homes/units/offices/docks (any that apply): Proposed Collier County EMS Station • Details about Project (choose type that applies): Please provide any additional details about the project. REQUIRED Supplemental Information provided by: Name: Sharon Umpenhour Title: Senior Planning Technician Email: sumpenhour@gradyminor.com Phone: 239-947-1144 Created April 5, 2017 Location: K:\CDES Planning Services\Current\Zoning Staff Information STAFF FORM FOR SUPPLEMENTAL PRE-APPLICATION MEETING INFORMATION 9.A.6.c Packet Pg. 1637 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1638 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1639 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1640 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1641 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1642 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1643 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and AFFIDAVIT OF AUTHORIZATION FOR PETITION NUMBERS(S)P120190002680 t,(print name),aS Oteclor. Facllities Managemeil applicable)Of collid Counry, a PoliUcal Subdivision ol rh6 state ol Florida (company, lf a licable), swear or atfirm under oath, that I am the (choose one) owner applicantEcontract purchaser and that: 1. I have full authority to secure the approval(s) requested and to impose covenants and restrictions on the referenced property as a result of any action approved by the County in accordance with this application and the Land Development Code; 2. All answers to the questions in this application and any sketches, data or other supplementary matter attached hereto and made a part of this application are honest and true;3. I have authorized the staff of Collier County to enter upon the property during normal working hours for the purpose of investigating and evaluating the request made through this application; and that 4. The property will be transferred, conveyed, sold or subdivided subject to the conditions and restrictions imposed by the approved action. 5. We/l authorize o. Grady Minora Assoc,ares P.A.to act as our/my representative in any matters regarding this petition including 1 through 2 above. 'Nolesi. lf the applicant is a coryontion, then it is usually executed by the cory- pres. or v. pres. . lf the applicant is a Limited Liabilrty Company (L.L.C.) or Limited Company (L.C.), then the documents should Upically be signed by the Company's "Managing Member.' . lf the applicant is a padnership, then Upically a padner can sign on behalt of the pafinership. . ff the applicant is a limited padnership, then the general padner must sign and be identified as the "general paftnel' of the named paftnership. . ff the applicant is a trust, then they must include the trustee's name and the words 'as trustee". . ln each instance, first determine the applicant's status, e.9., individual, cotporate, trust, paftnership, and then use the appropiate fomat for that ownership. Under penalties of perjury, I declare that I have read the foregoing Affidavit of Authorization and that in it are true Sign re Date STATE OF FLORIDA COUNTY OF COLLIER The foregoing instrument was acknowleged before me by means of cal presence or !online notarization this &-o"v or <) Ulx {onv"i r qualifler) U Such person(s) Notary Public must check applicable box Ef Are personally known to me ,20_:1_, by (printed name of owner o as identification Damo. Grant Coll'er Counly taciklies Ma.agsmsn' I Has produced a current drivers license 1l Has produced Notary Signature sotlA $5549IcotlltsslclIN202425JanuErlEORES:Pidcild,ITi!JBo.r&d cf\08-coA-001t 5\155 Rfv 3/4/2020 (title, if a7pgl2a20 9.A.6.c Packet Pg. 1644 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 1 Sharon Umpenhour From:GrantDamon <Damon.Grant@colliercountyfl.gov> Sent:Wednesday, July 29, 2020 3:14 PM To:Sharon Umpenhour Cc:OchsLeo; BrockMaryJo Subject:FW: EMS Station GG and Desoto (CU) – PL20190002680 Attachments:07292020151026.pdf Ms. Umpenhour, Please find attached the signed Affidavit of Authorization for the above listed location for your review and file. Thank you! Damon Grant Director, Facilities Management FACILITIES MANAGEMENT 3335 Tamiami Trail East, Suite 101, Naples, Florida 34112 Phone: 239‐252‐8880 Cell: 239‐778‐6129 From: OchsLeo <Leo.Ochs@colliercountyfl.gov> Sent: Wednesday, July 29, 2020 2:38 PM To: GrantDamon <Damon.Grant@colliercountyfl.gov> Subject: FW: EMS Station GG and Desoto (CU) – PL20190002680 Damon, Per the email below, I authorize you to sign the Affidavit of Authorization on my behalf. Thanks. Leo E. Ochs, Jr. Collier County Manager leo.ochs@colliercountyfl.gov 3299 East Tamiami Trail Naples FL 34112 239.252.8383 From: Sharon Umpenhour <SUmpenhour@gradyminor.com> Sent: Wednesday, July 29, 2020 2:34 PM To: OchsLeo <Leo.Ochs@colliercountyfl.gov> Cc: BrockMaryJo <MaryJo.Brock@colliercountyfl.gov> Subject: EMS Station GG and Desoto (CU) – PL20190002680 9.A.6.c Packet Pg. 1645 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 2 EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Good afternoon Leo, Per staff comment below, please find attached the required Affidavit of Authorization for the EMS Station GG and Desoto Conditional Use Petition (PL20190002680). Once the Affidavit is executed and notarize please forward to my attention. Correction Comment 5: Miscellaneous Corrections: Please provide a resolution or document granting authority to Damon Grant to sign the Affidavit of Authorization on behalf of the County. In the alternative, please have the County Manager sign the Affidavit of Authorization on behalf of the County. Regards, Sharon Umpenhour Senior Planning Technician Q. Grady Minor and Associates, P.A. 3800 Via Del Rey Bonita Springs, FL 34134 Phone - 239.947.1144 Fax - 239.947.0375 Email - sumpenhour@gradyminor.com Web - http://www.gradyminor.com DISCLAIMER: This communication from Q. Grady Minor & Associates, P.A., along with any attachments or electronic data is intended only for the addressee(s) named above and may contain information that is confidential, legally privileged or otherwise exempt from disclosure. The recipient agrees and accepts the following conditions: The electronic file/data is for informational purposes only and is the responsibility of the recipient to reconcile this electronic file/data with the approved and certified "plan of record" along with actual project site conditions. Q. Grady Minor & Associates, P.A. reserves the right to revise, update and improve its electronically stored data without notice and assumes no responsibility due to a virus or damages caused by receiving this email. Under Florida Law, e-mail addresses are public records. If you do not want your e-mail address released in response to a public records request, do not send electronic mail to this entity. Instead, contact this office by telephone or in writing. 9.A.6.c Packet Pg. 1646 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and K>>/ZKhEdz'KsZEDEd 'ZKtd,DE'DEdWZdDEd ǁǁǁ͘ĐŽůůŝĞƌŐŽǀ͘ŶĞƚ ϮϴϬϬEKZd,,KZ^^,KZ/s EW>^͕&>KZ/ϯϰϭϬϰ ;ϮϯϵͿϮϱϮͲϮϰϬϬ&y ;ϮϯϵͿϮϱϮͲϱϳϮϰ ADDRESSING CHECKLIST 3OHDVHFRPSOHWHWKHIROORZLQJDQGHPDLOWR*0'B$GGUHVVLQJ#FROOLHUJRYQHWRUID[WRWKH2SHUDWLRQV'LYLVLRQ DWRUVXEPLWLQSHUVRQWRWKH$GGUHVVLQJ6HFWLRQDWWKHDERYHDGGUHVV)RUPPXVWEHVLJQHGE\ $GGUHVVLQJSHUVRQQHOSULRUWRSUHDSSOLFDWLRQPHHWLQJplease allow 3 days for processing. 1RW DOO LWHPV ZLOO DSSO\ WR HYHU\ SURMHFW ,WHPV LQbold type DUHUHTXLUHGFOLIO NUMBERS MUST BE PROVIDED.)RUPVROGHUWKDQPRQWKVZLOOUHTXLUHDGGLWLRQDOUHYLHZDQGDSSURYDOE\WKH$GGUHVVLQJ6HFWLRQ PETITION TYPE (Indicate type below, complete a separate Addressing Checklist for each Petition type) %/%ODVWLQJ3HUPLW %'%RDW'RFN([WHQVLRQ &DUQLYDO&LUFXV3HUPLW &8&RQGLWLRQDO8VH (;3([FDYDWLRQ3HUPLW )3)LQDO3ODW //$/RW/LQH$GMXVWPHQW 31&3URMHFW1DPH&KDQJH 33/3ODQV 3ODW5HYLHZ 3633UHOLPLQDU\6XEGLYLVLRQ3ODW 38'5H]RQH 5=6WDQGDUG5H]RQH 6'36LWH'HYHORSPHQW3ODQ 6'3$6'3$PHQGPHQW 6'3,,QVXEVWDQWLDO&KDQJHWR6'3 6,36LWH,PSURYHPHQW3ODQ 6,3,,QVXEVWDQWLDO&KDQJHWR6,3 6156WUHHW1DPH&KDQJH 61&6WUHHW1DPH&KDQJH±8QSODWWHG 7'57UDQVIHURI'HYHORSPHQW5LJKWV 9$9DULDQFH 9539HJHWDWLRQ5HPRYDO3HUPLW 956)39HJHWDWLRQ5HPRYDO 6LWH)LOO3HUPLW 27+(5 LEGAL DESCRIPTION RIVXEMHFWSURSHUW\RUSURSHUWLHV(copy of lengthy description may be attached) FOLIO (Property ID) NUMBER(s)RIDERYH(attach to, or associate with, legal description if more than one) 675((7$''5(66RU$''5(66(6(as applicable, if already assigned) 352326('675((71$0(6(if applicable) 6,7('(9(/230(173/$1180%(5(for existing projects/sites only) LOCATION MAP PXVWEHDWWDFKHGVKRZLQJH[DFWORFDWLRQRISURMHFWVLWHLQUHODWLRQWRQHDUHVWSXEOLFURDGULJKW RIZD\ 352326('352-(&71$0((if applicable) 6'3RU$5RU3/ 6859(<FRS\QHHGHGRQO\IRUXQSODWWHGSURSHUWLHV &855(17352-(&71$0((if applicable) Rev. 6/9/2017 Page 1 of 2 ■ GOLDEN GATE EST UNIT 79 TR 72 (S9, T49 R28) 40806320009 9.A.6.c Packet Pg. 1647 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and K>>/ZKhEdz'KsZEDEd 'ZKtd,DE'DEdWZdDEd ǁǁǁ͘ĐŽůůŝĞƌŐŽǀ͘ŶĞƚ ϮϴϬϬEKZd,,KZ^^,KZ/s EW>^͕&>KZ/ϯϰϭϬϰ ;ϮϯϵͿϮϱϮͲϮϰϬϬ&y ;ϮϯϵͿϮϱϮͲϱϳϮϰ 3OHDVH5HWXUQ$SSURYHG&KHFNOLVW%\(PDLO3HUVRQDOO\SLFNHGXS ASSOLFDQW1DPH 6LJQDWXUHRQ$GGUHVVLQJ&KHFNOLVWGRHVQRWFRQVWLWXWH3URMHFWDQGRU6WUHHW1DPH DSSURYDODQGLVVXEMHFWWRIXUWKHUUHYLHZE\WKH2SHUDWLRQV'LYLVLRQ FOR STAFF USE ONLY FROLR Number Folio Number Folio Number Folio Number )ROLR1XPEHU )ROLR1XPEHU Approved by: Date: Updated by: Date: IF OLDER THAN 6 MONTHS, FORM MUST BE UPDATED OR NEW FORM SUBMITTED )D[ (PDLO)D[3KRQH 3URMHFWRUGHYHORSPHQWQDPHVSURSRVHGIRURUDOUHDG\DSSHDULQJLQFRQGRPLQLXPGRFXPHQWVLIDSSOLFDWLRQ LQGLFDWHZKHWKHUSURSRVHGRUH[LVWLQJ Rev. 6/9/2017 Page 2 of 2 40806320009 04/22/2020 ■ Sharon Umpenhour for Q. Grady Minor & Associates, P.A. 239-947-1144 sumpenhour@gradyminor.com 9.A.6.c Packet Pg. 1648 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and / $ 0 $ 63,856 $ 0 $ 63,856 $ 41,124 $ 22,732 $ 63,856 $ 22,732 Collier County Property AppraiserProperty Summary Parcel No 40806320009 SiteAddress*Disclaimer Site City Site Zone*Note Name / Address STEPIEN ET AL, CHRISTINE M 5279 MILITARY RD City LEWISTON State NY Zip 14092-1951 Map No. Strap No. Section Township Range Acres *Estimated 4D09 350200 72 4D09 9 49 28 5.46 Legal GOLDEN GATE EST UNIT 79 TR 72 Millage Area 80 Millage Rates *Calculations Sub./Condo 350200 - GOLDEN GATE EST UNIT 79 School Other Total Use Code 0 - VACANT RESIDENTIAL 5.083 6.3071 11.3901 Latest Sales History (Not all Sales are listed due to Confidentiality) Date Book-Page Amount 09/18/12 4843-2757 2019 Certified Tax Roll (Subject to Change) Land Value (+) Improved Value (=) Market Value (-) 10% Cap (=) Assessed Value (=) School Taxable Value (=) Taxable Value If all Values shown above equal 0 this parcel was created after theFinal Tax Roll 9.A.6.c Packet Pg. 1649 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and / Collier County Property AppraiserProperty Aerial Parcel No 40806320009 SiteAddress*Disclaimer Site City Site Zone*Note Open GIS in a New Window with More Features. 9.A.6.c Packet Pg. 1650 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 Created 9/28/2017 Page 1 of 3 PROPERTY OWNERSHIP DISCLOSURE FORM This is a required form with all land use petitions, except for Appeals and Zoning Verification Letters. Should any changes of ownership or changes in contracts for purchase occur subsequent to the date of application, but prior to the date of the final public hearing, it is the responsibility of the applicant, or agent on his behalf, to submit a supplemental disclosure of interest form. Please complete the following, use additional sheets if necessary. a. If the property is owned fee simple by an INDIVIDUAL, tenancy by the entirety, tenancy in common, or joint tenancy, list all parties with an ownership interest as well as the percentage of such interest: Name and Address % of Ownership b. If the property is owned by a CORPORATION, list the officers and stockholders and the percentage of stock owned by each: Name and Address % of Ownership c. If the property is in the name of a TRUSTEE, list the beneficiaries of the trust with the percentage of interest: Name and Address % of Ownership Collier County, a Political Subdivision of the State of Florida 100 3335 Tamiami Trail E, Ste 101 9.A.6.c Packet Pg. 1651 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 Created 9/28/2017 Page 2 of 3 d. If the property is in the name of a GENERAL or LIMITED PARTNERSHIP, list the name of the general and/or limited partners: Name and Address % of Ownership e. If there is a CONTRACT FOR PURCHASE, with an individual or individuals, a Corporation, Trustee, or a Partnership, list the names of the contract purchasers below, including the officers, stockholders, beneficiaries, or partners: Name and Address % of Ownership Date of Contract: ___________ f. If any contingency clause or contract terms involve additional parties, list all individuals or officers, if a corporation, partnership, or trust: Name and Address g. Date subject property acquired _______________ Leased: Term of lease ____________ years /months If, Petitioner has option to buy, indicate the following: 12/20/2019 9.A.6.c Packet Pg. 1652 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and COLLIER COUNTY GOVERNMENT 2800 NORTH HORSESHOE DRIVE GROWTH MANAGEMENT DEPARTMENT NAPLES, FLORIDA 34104 www.colliergov.net (239) 252-2400 FAX: (239) 252-6358 Created 9/28/2017 Page 3 of 3 Date of option: _________________________ Date option terminates: __________________, or Anticipated closing date: ________________ AFFIRM PROPERTY OWNERSHIP INFORMATION Any petition required to have Property Ownership Disclosure, will not be accepted without this form. Requirements for petition types are located on the associated application form. Any change in ownership whether individually or with a Trustee, Company or other interest-holding party, must be disclosed to Collier County immediately if such change occurs prior to the petition’s final public hearing. As the authorized agent/applicant for this petition, I attest that all of the information indicated on this checklist is included in this submittal package. I understand that failure to include all necessary submittal information may result in the delay of processing this petition. The completed application, all required submittal materials, and fees shall be submitted to: Growth Management Department ATTN: Business Center 2800 North Horseshoe Drive Naples, FL 34104 ____________________________________________ ____________ Agent/Owner Signature Date ____________________________________________ Agent/Owner Name (please print) D. Wayne Arnold, AICP Digitally signed by D. Wayne Arnold, AICP Date: 2020.04.22 14:44:33 -04'00' D. Wayne Arnold, AICP April 22, 2020 9.A.6.c Packet Pg. 1653 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1654 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1655 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1656 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1657 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1658 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1659 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1660 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and TRACT 72GOLDEN GATE ESTATES UNIT 79LYING INCOLLIER COUNTY, FLORIDABOUNDARY AND TOPOGRAPHIC SURVEYDRAWN BY:CHECKED BY:JOB CODE:SCALE:DATE:FILE:SHEET:9 DECEMBER 20191" = 30'DLSKJG19-213-BST.DWG1 of 1GradyMinorCivil Engineers●Land Surveyors●Planners●Landscape ArchitectsCert. of Auth. EB 0005151 Cert. of Auth. LB 0005151 Business LC 26000266 Bonita Springs: 239.947.1144Fort Myers: 239.690.4380PLAT BOOK 5, PAGE 17SECTION 4, TOWNSHIP 49 SOUTH, RANGE 28 EAST LEGENDPROPERTY DESCRIPTIONNOTES: This item has been electronically signed and sealed by Donald L. Saintenoy III, P.S.M. on the date adjacent to the seal using a SHA authentication code. Printed copies of this document are not considered signed and sealed and the SHA authentication code must be verified on any electronic copies. Digitally signed by Donald L. Saintenoy III, P.S.M. Date: 2020.04.22 11:42:45 -04'00'9.A.6.cPacket Pg. 1661Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - 40806320009 Desoto BLVD SGolden Gate BLVD E Desoto BLVD NSource: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User Community Collier County EMS Station Location Map . 140 0 14070 Feet Legend Subject Property 9.A.6.c Packet Pg. 1662 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and PROPOSED FUTURE ROW EXPANSION AREA PRESERVE POTENTIAL SEPTIC LOCATION PROPERTY BOUNDARY MINIMUM 15' TYPE 'D' LANDSCAPE BUFFER MINIMUM 15' TYPE 'D' LANDSCAPE BUFFER MINIMUM 15' WIDE TYPE 'B' LANDSCAPE BUFFERMINIMUM 15' WIDE TYPE 'B'LANDSCAPE BUFFERMINIMUM BUILDING SETBACK LEGEND ZONED: ESTATES USE:RESIDENTIAL ZONED: ESTATES USE:RESIDENTIAL 100' PUBLIC ROAD (PER PLAT BOOK 5 PAGE 17)100' PUBLIC ROAD(PER PLAT BOOK 5PAGE 17)ZONED: ESTATES USE:RESIDENTIAL ZONED: ESTATES USE:RESIDENTIAL DRY DETENTION AREA 75' MIN. BLDG.SETBACK75' MIN. BLDG. SETBACK 75' MIN. BLDG. SETBACK 6' LANDSCAPE BUFFER RESERVATION (SEE NOTE #2)205' MIN. BLDG.SETBACKMINIMUM 15' TYPE 'D' LANDSCAPE BUFFER 25' 30'39'REFUSE AND SERVICE AREA 20' 22' 20' POTENTIAL WELL LOCATION 0 100'50' SCALE: 1" = 100' GradyMinor Civil Engineers ●Land Surveyors ●Planners ●Landscape Architects Cert. of Auth. EB 0005151 Cert. of Auth. LB 0005151 Business LC 26000266 Q. Grady Minor and Associates, P.A. 3800 Via Del Rey Bonita Springs, Florida 34134 Bonita Springs: 239.947.1144 ZZZ.GradyMinor.coP Fort Myers: 239.690.4380 WHEN PLOTTED @ 8.5" X 11"DESOTO BLVD SGOLDEN GATE BLVD E PROPOSED EMS/FIRE BUILDING 26,000 SF 9.A.6.c Packet Pg. 1663 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and GradyMinor Civil Engineers ●Land Surveyors ●Planners ●Landscape Architects Cert. of Auth. EB 0005151 Cert. of Auth. LB 0005151 Business LC 26000266 Q. Grady Minor and Associates, P.A. 3800 Via Del Rey Bonita Springs, Florida 34134 Bonita Springs: 239.947.1144 ZZZ.GradyMinor.coP Fort Myers: 239.690.4380 SITE INFORMATION: ZONING: E, ESTATES SITE AREA: 5.46+/- ACRES ROW RESERVATION:1.82± ACRES DEVELOPMENT AREA:3.64± ACRES BUILDING: MAXIMUM 26,000 SQUARE FEET BUILDING HEIGHT:ZONED ACTUAL PRINCIPAL:35'40' ACCESSORY:25'30' PRESERVE (MINIMUM): REQUIRED:0.36± ACRES (3.64 ACRES X .10) PROVIDED:0.36± ACRES OPEN SPACE (MINIMUM): REQUIRED:1.1± ACRES (3.64 X .30) PROVIDED:1.1± ACRES SETBACKS (MINIMUM): PRINCIPAL STRUCTURE:ACCESSORY: GOLDEN GATE BLVD.75' DESOTO BLVD.75' SOUTH 205' WEST 75' PRESERVE 25' 10' NOTES: 1.ALL ON-SITE LIGHTING SHALL BE SHIELDED AND DIRECTED AWAY FROM ADJOINING PROPERTIES. PARKING LOT LIGHTING LIMITED TO 15 FEET IN HEIGHT IN AREA SHOWN ON SITE PLAN. 2.PRESERVES MAY BE USED TO SATISFY THE LANDSCAPE BUFFER REQUIREMENTS AFTER EXOTIC VEGETATION REMOVAL IN ACCORDANCE WITH LDC SECTIONS 4.06.02 AND 4.06.05.E.1. SUPPLEMENTAL PLANTINGS WITH NATIVE PLANT MATERIALS SHALL BE IN ACCORDANCE WITH LDC SECTION 3.05.07. IN ORDER TO MEET THE LDC REQUIREMENTS FOR A TYPE B BUFFER ALONG THE WESTERN AND SOUTHERN BOUNDARIES OF THE PROJECT, A 6-FOOT WIDE LANDSCAPE BUFFER RESERVATION HAS BEEN IDENTIFIED ON THE CONCEPTUAL SITE PLAN. IN THE EVENT THAT THE PRESERVE DOES NOT MEET BUFFER REQUIREMENTS AFTER REMOVAL OF EXOTICS AND SUPPLEMENTAL PLANTING WITHIN THE PRESERVE, PLANTINGS WILL BE PROVIDED IN THE 6-FOOT WIDE RESERVATION TO MEET THE BUFFER REQUIREMENTS. THE TYPE, SIZE, AND NUMBER OF SUCH PLANTINGS, IF NECESSARY, WILL BE DETERMINED AT TIME OF INITIAL SDP OR PLAT AND INCLUDED ON THE LANDSCAPE PLANS FOR THE SDP OR PLAT. 9.A.6.c Packet Pg. 1664 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1665 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1666 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1667 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.cPacket Pg. 1668Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - 9.A.6.cPacket Pg. 1669Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - 9.A.6.c Packet Pg. 1670 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1671 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.cPacket Pg. 1672Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - 9.A.6.cPacket Pg. 1673Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - 9.A.6.cPacket Pg. 1674Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - 9.A.6.cPacket Pg. 1675Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - 9.A.6.c Packet Pg. 1676 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1677 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.cPacket Pg. 1678Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - 9.A.6.c Packet Pg. 1679 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1680 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.cPacket Pg. 1681Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - 9.A.6.c Packet Pg. 1682 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1683 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.cPacket Pg. 1684Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - 9.A.6.cPacket Pg. 1685Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - 9.A.6.c Packet Pg. 1686 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1687 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1688 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1689 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1690 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.cPacket Pg. 1691Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - 9.A.6.cPacket Pg. 1692Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - 9.A.6.cPacket Pg. 1693Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - 9.A.6.cPacket Pg. 1694Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - 9.A.6.c Packet Pg. 1695 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1696 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1697 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.cPacket Pg. 1698Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - 756 756756 756756 756 756756756756 6RXUFHV(VUL+(5(*DUPLQ,QWHUPDSLQFUHPHQW3&RUS*(%&286*6 )$2 136 15&$1 *HR%DVH ,*1 .DGDVWHU 1/ 2UGQDQFH 6XUYH\ (VUL -DSDQ0(7,(VUL&KLQD+RQJ.RQJF2SHQ6WUHHW0DSFRQWULEXWRUVDQG WKH*,68VHU&RPPXQLW\*,6$GGUHVVLQJ 756 :HOOILHOGV 30 PL NP 6FUHHQ&DSWXUHRI=RQLQJ0DS &ROOLHU&RXQW\ EMS Station Golden Gate Blvd. & Desoto Blvd - PL20190002680 Wellfield Overlay Exhibit Subject Property 9.A.6.c Packet Pg. 1699 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and Subject Property EMS Station GG Blvd & DeSoto Blvd PL20190002680 Wellfield Overlay Map 9.A.6.c Packet Pg. 1700 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1701 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1702 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1703 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1704 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1705 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1706 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1707 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1708 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1709 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.cPacket Pg. 1710Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - 9.A.6.c Packet Pg. 1711 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.cPacket Pg. 1712Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - 9.A.6.cPacket Pg. 1713Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - EMS Station Golden Gate Blvd and Desoto Blvd Conditional Use (PL20190002680) Architectural Example August 3, 2020 Page 1 of 1 Architectural Example.docx Q. Grady Minor & Associates, P.A. 3800 Via Del Rey, Bonita Springs, FL 34134  239-947-1144  engineering@gradyminor.com  www.gradyminor.com Station #76 View from Vanderbilt Beach Road Station #76 View from Logan Blvd. 9.A.6.c Packet Pg. 1714 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 9.A.6.c Packet Pg. 1715 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and Q. Grady Minor & Associates, P.A. Ph. 239-947-1144 Fax. 239-947-0375 3800 Via Del Rey EB 0005151 LB 0005151 LC 26000266 Bonita Springs, FL 34134 www.gradyminor.com Project Location Map NEIGHBORHOOD INFORMATION MEETING RE: Petition PL20190002680, EMS/Fire Station Golden Gate Blvd and DeSoto Blvd Conditional Use A Neighborhood Information Meeting hosted by D. Wayne Arnold, AICP, of Q. Grady Minor & Associates, P.A., representing Collier County (Applicant) will be held Wednesday, October 14, 2020, 5:30 pm at Saint Monica’s Episcopal Church, 7070 Immokalee Road, Naples, FL 34119 (attendees are required to wear masks). Individuals who would like to participate remotely or have questions or comments should contact Sharon Umpenhour, Senior Planning Technician with Q. Grady Minor & Associates, P.A. by email: sumpenhour@gradyminor.com, phone: 239-947-1144, or mail: 3800 Via Del Rey, Bonita Springs, FL 34134. Project information is posted online at www.gradyminor.com/planning. Collier County has submitted a formal application to Collier County seeking approval of a Conditional Use. The application is requesting a conditional use as allowed, pursuant to Land Development Code (LDC) Section 2.03.00, of the Estates (ST/W-4) Zoning District for a Safety Service Facility, including fire and emergency medical services. The subject property (Parcel ID # 40806320009) is comprised of approximately 5.46± acres, located on the southwest corner of Golden Gate Boulevard and DeSoto Boulevard in Section 9, Township 49 South, Range 28 East in Collier County, Florida. The Neighborhood Information Meeting is for informational purposes, it is not a public hearing. 9.A.6.c Packet Pg. 1716 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and EMS/Fire Station GG Blvd DeSoto Blvd, PL20190002680NAME1 NAME2 NAME3 NAME4 NAME5 NAME6 FOLIOACEVEDO, RAFAEL A & JOSEFA V4625 GOLDEN GATE BLVD ENAPLES, FL 34120-9026 40749600103ALBANESE, GEORGE & MARY120 DESOTO BLVD NNAPLES, FL 34120-9052 40749640008ALONSO, SAHARA M JANET F RIVERO ANA C GIRALDEZ 7421 SW 147TH CT MIAMI, FL 33193-1116 40749280002BADILLO, BERTHA P JIMENEZ 4444 2ND AVE NENAPLES, FL 34120 40747640000BAKER, NIKKI JO JORDAN GIVEN BAKER301 LENA FRANK DRIVE IMMOKALEE, FL 34142 40806020008BARSTOW, BARBARA N 6286 SILVER MOON LNGREEN ACRES, FL 33463 40806560005BORDON, CHERYL N 4410 2ND AVE SENAPLES, FL 34117 40804120007CANTAVE, GARY & BERNADETTE4645 GOLDEN GATE BLVD ENAPLES, FL 34120-9026 40749600006CARRASCO, OSMAN GREGORY EILEEN GARCIA 141 DESOTO BLVD N NAPLES, FL 34120 40749240000CINTORA, ARIANA ROCIO CINTORA ROXANA G ROSALES FLORES 4410 2ND AVE NE NAPLES, FL 34120-9027 40747600008COLLIER CNTY C/O REAL PROPERTY MANAGEMENT 3335 TAMIAMI TR E, STE 101 NAPLES, FL 34112 40749320001COLLIER COUNTY 3335 TAMIAMI TRAIL E STE 101NAPLES, FL 34112 40806320009CRUZ, MARIA E 260 29TH ST SWNAPLES, FL 34117-3123 40808680006DORIA, DANIEL TORI LYNN BILLS 4430 GOLDEN GATE BLVD E NAPLES, FL 34120 40804040006DUNN FAMILY LTD PARTNERSHIP I 6605 BANDEVA AVE #10DALLAS, TX 75225 40802440006ELEZI, ANJEZA 240 NAPA RIDGE RD ENAPLES, FL 34119 40806400107ELEZI, REXHINA 240 NAPA RIDGE RD ENAPLES, FL 34119 40806400000FARO INTERNATIONAL GROUP LLC 2675 10TH AVE SWNAPLES, FL 34117 40806240008FORD, JOHN B 4391 GOLDEN GATE BLVD ENAPLES, FL 34120-9037 40747440006FOUCHE, THOMAS & JUDY 6127 QUINN RDFREDERICK, MD 21701-6709 40803960006GONZALEZ, DAYANA230 DESOTO BLVD SNAPLES, FL 34117-9029 40806600004HARRINGTON, TEDDY & KIM 4455 GOLDEN GATE BLVD ENAPLES, FL 34120 40749360003HIJAZI, TECHRIN 2121 NORTH BAYSHORE DRIVE, UNIT 718MIAMI, FL 33137 40806440002HOBALLAH, SAMIR 165 DESOTO BLVD SNAPLES, FL 34117-9023 40806120005JACOBS ET AL, JANEEN A 5544 ST MICHAEL STMOUNDS VIES, MN 55112 40806200006JOHNSON, CHERYL ANN 27830 SW 132ND CTHOMESTEAD, FL 33032-8553 40806720007JULIAN, JOSEPH & BIBIANA4380 2ND AVE SENAPLES, FL 34117-9011 40803800001LALLA, HARDAT SANTHANA APPU DURAI 4470 GOLDEN GATE BLVD E NAPLES, FL 34120-9044 40806280000LAZARIT, RAMON PO BOX 466SOLVANG, CA 93464 40747480008LE, LINH DUY 912 HERITAGE PKWY SALLEN, TX 75002-5762 40806480004LIRIA, JESSICA ROBERT LIRIA4660 2ND AVE SE NAPLES, FL 34117 40808560003LOIS J FURMANEK TRUST 16012 ALEXANDRIA DRTINLEY PARK, IL 60477-6330 40745880008LOOR, MILTON SAUL 4380 GOLDEN GATE BLVD ENAPLES, FL 34120 40803920004LOPEZ, RICHARD T 410 16TH AVE NWNAPLES, FL 34120-3315 40804080008MANQUENE, GERARD D LAURENCE AILLOUD-MANQUENE 527 CROSSFIELD CIR NAPLES, FL 34104 40803840003MARTINEZ, AYMEE 265 DESOTO BLVD SNAPLES, FL 34117-9030 40805960004MARTINEZ, BEATRIZ4525 2ND AVE SENAPLES, FL 34118 40806080006MARTINEZ, OSCAR JESUS 4340 GOLDEN GATE BLVD ENAPLES, FL 34120 40802361004MAYOL, MAYRA 30 SW 58TH AVEMIAMI, FL 33144-3424 40804000004NODARSE, ROBERTO & YOLANDA 733 RIVER DRELMWOOD PARK, NJ 07407-1220 40749400002OMALES LLC 10970 SW 170TH TERMIAMI, FL 33157 40747520007PAKOSH, SILVIA 54 ROSE TERCHATHAM, NJ 07928-2070 40751580004PAKOSH, SILVIA M 54 ROSE TERCHATHAM, NJ 07928-2070 40751560008RAMIREZ, ROSENDO SEBASTIANA RAMIREZ PO BOX 11346 NAPLES, FL 34101 40751480007REU, RONALD E 154 STROMBOLI DRISLAMORADA, FL 33036-3313 40806360001RJB CAPITAL LLC 307 N MICHIGAN AVE SUITE 305 CHICAGO, IL 60601 40806040004ROGERO, JAMES S & TAMMY A 4385 2ND AVE SENAPLES, FL 34117-9012 40803841002RYALL TR, GEORGE F & EVELYN L G F & E L RYALL LIV/TRUST509 HILLCREST AVE TITUSVILLE, FL 32796-3738 40806520003SHECK, LISA K DEANNA M BRODERICK 616 NORTONTOWN RD GUILFORD, CT 06437-2222 40747560009SHIRLEY, DAVID R & ANGELA A 4360 E PAYNETOWN ROADBLOOMINGTON, IN 47401 40806000002SOCHASCKYY, OSMAN G CARRASCO EILEEN GARCIA141 DESOTO BLVD N NAPLES, FL 34120-9060 40749200008SORGEN JR, CARL H 367 SANTA FE TRAILN FT MYERS, FL 33917 40749440101SOUSA, ESTELA GONZALES 1680 BOMI CIRWINTER PARK, FL 32792-6315 40749520005SPENCER, CATHERINE 4675 2ND AVE SENAPLES, FL 34117 40808640004SPRINT FLORIDA INC % PROPERTY TX DEPT PO BOX 7909 OVERLAND PARK, KS 66207-909 40749300005THAMES JR, ALLEN Q 6442 MERRITT CTMONTGOMERY, AL 36117-4735 4080420000819.A.6.cPacket Pg. 1717Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - EMS/Fire Station GG Blvd DeSoto Blvd, PL20190002680TIERNEY, THOMAS JOSEPH4375 GOLDEN GATE BLVD ENAPLES, FL 34120-9037 40747400004TONCHI INVESTMENT LLC2057 TRADE CENTER WAYNAPLES, FL 34109-6244 40747360005TRUMAN, LINCOLN CHURCHILL TERRATRUST LLC 593 RUE LA GRANDE ELIZABETHTOWN, KY 42701 40806160007URS PROPERTIES LLC 5245 BIRMINGHAM DR APT 201NAPLES, FL 34110 40803880005VARGAS, JUAN 16360 S W 30TH STHOLLYWOOD, FL 33027 40808720005VASILYEV, SERGEY NATALLIA KARLIONAVA4438 2ND AVE SE NAPLES, FL 34117 40804160009WITT, DOUGLAS M 55 DESOTO BLVD NNAPLES, FL 34120 40749440004GGEACAPO Box 990596Naples, FL 34116 29.A.6.cPacket Pg. 1718Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - NEIGHBORHOOD INFORMATION MEETING Petition PL20190002680,EMS/Fire Station Golden Gate Blvd and DeSoto Blvd Conditional Use A Neighborhood Information Meeting hosted by D. Wa yne Arnold,AICP,of Q.Grady Minor &Associates, P.A.,representing Collier County (Applicant)will be held We dnesday,October 14,2020,5:30 pm at Saint Monica’s Episcopal Church,7070 Immokalee Road,Naples,FL 34119 (attendees are required to wear masks).Individuals who would like to participate remotely or have questions or comments should contact Sharon Umpenhour,Senior Planning Te chnician with Q.Grady Minor &Associates,P.A. by email:sumpenhour@gradyminor.com,phone:239-947- 1144,or mail:3800 Via Del Rey,Bonita Springs,FL 34134. Project information is posted online at www.gradyminor. com/planning. Collier County has submitted a formal application to Collier County seeking approval of a Conditional Use.The application is requesting a conditional use as allowed, pursuant to Land Development Code (LDC)Section 2.03.00, of the Estates (ST/W-4)Zoning District for a Safety Service Facility,including fire and emergency medical services. The subject property (Parcel ID #40806320009)is comprised of approximately 5.46±acres,located on the southwest corner of Golden Gate Boulevard and DeSoto Boulevard in Section 9,To wnship 49 South,Range 28 East in Collier County,Florida. The Neighborhood Information Meeting is for informational purposes,it is not a public hearing. ND-GCI0495494-01 9.A.6.c Packet Pg. 1719 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden EMS/Fire Station Golden Gate Blvd and DeSoto Blvd, PL20190002680 October 14, 2020 Neighborhood Information Meeting Page 1 of 9 Wayne Arnold: All right. Well, good evening, everybody. I'm Wayne Arnold. I'm GradyMinor Engineering and, uh, Certified Planner. And with us tonight is Sharon Umpenhour. She is going to be recording the meeting and handling the Zoom. I'm gonna use the microphone just to make sure that everybody can hear. Here on Zoom, can you hear us okay? Assume you can. Now, let me make a few introductions. This is Tony Barone, who's with Collier County. He's Project Manager for the county. We have Chief Butcher in the back of the room. She's, uh, head of EMS and is gonna be in charge of getting this new station built, hopefully, at this location. In the back of the room, we have Jim Banks. He's our Traffic Engineer. Mike Delate, who's sitting there, is the Civil Engineer. And Marco Espinar is the gentleman who just walked in. He's our Biologist on the project. And Laura DeJohn, who's with Johnson Engineering, but also Collier County in her capacity as the planner, is here tonight. And she's been reviewing the conditional use application that's circulating through the review cycle. So, this piece of property is, um, the Estates as most of you realize, and Collier County acquired this property last year with the intent of putting in a joint EMS and fire station property. And so, the idea would be going through the conditional use process. So, in the Estates, fire stations and safety services, like EMS, are allowed as conditional uses, which means you have to go through a public hearing process. And in the Golden Gate master plan, we're required to go to the Planning Commission and the County Commission. So, we're in that process. We've been in it for a few months. We do have hearing dates established, which I'll go over shortly. And I'm gonna go through just a brief presentation of our master plan. So, I think you're all familiar with the location – southwest corner of Desoto and Golden Gate Boulevard. It's about a five and a half acre property. It's currently vacant. The county purchased it. The – they purchased the corner because they also are gonna be making some intersection improvements in the future at that intersection. This is our conceptual site plan. I've got an image that's a little larger, but you can see we're proposing access to both Desoto and Golden Gate Boulevard. We have a building that sets 9.A.6.c Packet Pg. 1720 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and EMS/Fire Station Golden Gate Blvd and DeSoto Blvd, PL20190002680 October 14, 2020 Neighborhood Information Meeting Page 2 of 9 generally in the middle of the site. That depicts about a 26,000- square-foot building. The building hasn't been completely designed yet, so that's essentially a building envelope that we're working in. So, we have site circulation around the building. We have a preservation area that buffers us from the property to the west. And the preserve wraps around to the south. We have water management on the southern portion of the property. And then, the – the bays for both the fire and EMS vehicles would face, um, onto Desoto Boulevard. This is an aerial overview showing you the proximity to the neighboring property to the west. It's our only – nearest residential structure. And, uh, the overlay on the west side demonstrates that, our proximity. We've set the building back about 75 feet from our western property boundary. The minimum setback is 30. We've set it back a minimum of 75 feet to give them some extra buffer between, uh, the proposed EMS fire station and the nearest neighbor. Uh, this is a programmed improvement for the EMS fire station, from the funding, I think, through the infrastructure tax as well general allocation of funds through impact fees, etc. And I'm sure Chief Butcher would be happy to answer any questions if anybody has questions. But I believe it's programmed to be started in 2021 – 2021, if I'm not mistaken. This is a couple architectural examples that – Golden Gate master plan requires that these be designed in some sort of, you know, more residential character. So, these are a couple of examples of other, uh, recent EMS fire stations that have been built. And they're low scale. We can't ask for any deviations from the code as part of this process. So, we're building within the height and setback restrictions that govern everything else in Golden Gate Estates. So, these will be lower scale. They'll try to fit in with your community. And, Chief, as far as I know, it's designed to be a single-story building. So, there are several examples from Golden Gate. I'm sure you're familiar with those other fire facilities that are out there. So, again, the process we're in requires two public hearings, and we do have hearings set. Our Planning Commission hearing is set for November 19th, 9:00 a.m., in your County Commission chambers. And the Board of County Commissioner final hearing on this would be January 26, 2021. Due to the Holiday schedule, 9.A.6.c Packet Pg. 1721 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and EMS/Fire Station Golden Gate Blvd and DeSoto Blvd, PL20190002680 October 14, 2020 Neighborhood Information Meeting Page 3 of 9 they're not, able to hear it any sooner than that, but we do have a scheduled hearing date in January of next year for the board to make a final decision. All of the information we have tonight, as well as our application, are available on the County's website, or we have Laura DeJohn's contact on the slide, if you'd like to write her number or email address. Sharon's email address and information is on the slide as well. And the – prior to going to public hearings – if you received a letter for this meeting, you should receive a notice from Collier County Government, indicating when the hearings are going to be held. Another reminder to you as well is zoning signs will be posted on the property. You've seen them around – the four- by-eight signs that – that indicate the date and time for the public hearing. So, that's, in a nutshell, where we are and what we're doing and – and I know that the Civic Associate and, the County, really want this project to happen. I think it's in terms of meeting a level of service standards as Golden Gate Estates has grown. Certainly the need for service facilities like this have grown as well. And the County is bound to have response times based on their level of service standards, and I think this is considered rural, so there's a 12- minute service time that they must maintain 90 percent of the time. So, you'll see long-term plans for more of these as the community continues to grow. As the eastern lands – the rural land areas – continue to grow, there'll be fire station and EMS facilities that are proponent to those as well. So, again, this is, uh, a necessary part of our growth and we hope you will support it. So, with that, I can turn it over and we'll try to answer any questions from our team that anybody may have. Sharon, should we start with the Zoom participants and see if anybody has a question? Sharon Umpenhour: Yeah, we can do that. There's a Basil. Wayne Arnold: Do you have to unmute them? Sharon Umpenhour: Basil, do you have a question for us? Jeff Curl: I have no idea, guys, why this says Basil. This is Jeff Curl. Sharon Umpenhour: Oh, hey, Jeff. Jeff Curl: I have no clue. I used the link that you gave me, Sharon, and I 9.A.6.c Packet Pg. 1722 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and EMS/Fire Station Golden Gate Blvd and DeSoto Blvd, PL20190002680 October 14, 2020 Neighborhood Information Meeting Page 4 of 9 have no idea why it's on there. But I – I do have a couple of, uh, questions, Wayne. One, when we, uh, entertained the purchase of land through the, uh, GAC Land Trust for this parcel, uh, Chief Butcher presented – and it certainly sounded like, um, some sort of a – a sheriff's operation was gonna be in with fire and EMS? Still wanted to know if that was on the table. Wayne Arnold: Okay. Well, Chief Butcher's in the back. We're gonna have her come up and grab the microphone so everybody can hear. Jeff Curl: Thank you. Chief Tabitha Butcher: Hi, there. This is Chief Butcher. Um, the concept would be to add office space, um, so that sheriff's deputies would have a – a place to go, do reports, um, have a deputy on standby in case there were calls in that area. So, that is something that we do still plan to reach out to the Sheriff's Office, um, to let them know that we can provide them space. Jeff Curl: All right. Um, and then, the next question that I've got, na – it – it's either you, Wayne, or maybe Mike Delate. I heard he's in the house over there. Um, there seems to be quite a lot of parking, um, for a handful of EMS, a handful of fire department folks, and – and maybe a – a deputy or two. Um, what – why is there so much parking, I guess? Just a general question. Wayne Arnold: We're gonna let Mike Delate answer that question. Jeff Curl: Thank you. Mike Delate: Hi, Jeff. It's Mike Delate here. So, yeah, it's a question. I think what we did is just try to maximize the footprint. Uh, I think once the site is actually – the uses are determined, maybe that – not that much parking is needed. But we didn't want to try to add parking later after going through the conditional use. So, as indicated, if there's fewer uses, you won't need that much parking. Jeff Curl: That – that – that's great. And – and it's a – it's a loaded question because I'm gonna lead into the neighbor due west of this property with a potential for open bays, uh, blaring right into his side yard. Uh, perhaps there's, uh, an opportunity to widen the buffer, or green space. And, I guess, in that area, along that property line, is – d – did you guys envision a – a 9.A.6.c Packet Pg. 1723 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and EMS/Fire Station Golden Gate Blvd and DeSoto Blvd, PL20190002680 October 14, 2020 Neighborhood Information Meeting Page 5 of 9 barrier wall or s – any t – sort of sound abatement in those open bays toward that residence with sirens? Male Speaker: It's a Type B buffer. Mike Delate: So, Jeff, it's a Type B because it – you might know this better. Does a B require a fence or a wall? Jeff Curl: Uh, not explicitly. You can satisfy it with a five-foot hedge. So, again, it's a loaded question. But a wall can – can come into play with that. The only – so, then – let – let me – let me throw another loaded one to you. You know, you're gonna have existing grade. I'm sure the pad of this building's gonna be pretty tall. So, I don't know if there's an opportunity to offset the height of that wall, um, with, you know – let's say it's three feet above grade at the building. You know, if it's a six-foot wall, then you'd only have three feet of potential sound abatement, uh, against the neighbor. Mike Delate: Yeah, I think we'll have to look into that as the site eval and see what the – the county plans for that area – how the bay's lay out. I mean, that's just, uh, kind of a square box there. Uh, we'd probably wanna look at where that actual house is, uh, in relation to the proposed bays. Because we don't really have the bays laid out. If you see there, it's just a big area in the front. Uh, we don't know how many trucks the fire department wants to have or the EMS will have. And that would kind of lay out – to your point, I think that's a consideration the county, uh [inaudible – crosstalk] [00:10:33] – [Crosstalk] Jeff Curl: Okay. That sounds good. Um, next thing I had for you is kinda the architectural examples that were shown. Um, I think everybody out – out in the Estates is familiar with the – uh, yes, with that station in particular. In my mind, though, that doesn't really fit what I consider to be Estates. And I'm really honing in on the barrel tile roof. Uh, for example, Max Hass has a standing seam metal roof and it's green. I don't – I don't really care about that, but did you guys envision any – any fray from what we're looking at right now, or any opportunities to maybe make it more Estates like, if that's even a term? Wayne Arnold: Well, Jeff, this is Wayne. And the answer to that is the building hasn't been designed yet. These were just easy examples we pulled to show you the scale and style of buildings. 9.A.6.c Packet Pg. 1724 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and EMS/Fire Station Golden Gate Blvd and DeSoto Blvd, PL20190002680 October 14, 2020 Neighborhood Information Meeting Page 6 of 9 Jeff Curl: Yeah. Wayne Arnold: So, you know, your comments are dully noted and both Tony Barone and the Chief are here, who will be making decisions relative to the architecture and finish for the building. Tony Barone: Yeah, and just – [Crosstalk] Jeff Curl: All right. Tony Barone: – for the record – Wayne Arnold: Uh, this is Tony Barone. Tony Barone: This is Tony Barone with, uh, Facilities Management. Uh, just for the record, the – the pictures do show EMS 76, which is on the corner of Logan and Vanderbilt. Our more iteration of this EMS station design includes a metal roof. Uh, our EMS 25 location at Hacienda Lakes actually has a metal room, um, that has, uh – uh, I think that would fit more into the style out there in Golden Gate Estates rather than the barrel tile. We're generally getting away from that because of just hurricane resilience. Metal roofs perform much better in the hurricanes, uh, and cost the county a lot less money in repairs afterwards. Jeff Curl: All right. Awesome. Thanks for your time, guys, that’s all I had. Tony Barone: Thank you. Wayne Arnold: Thank you, Jeff. Um, next person who's on is – can't read that from here. Does it say N? Sharon Umpenhour: It's N. Must. Wayne Arnold: N. Must? Do you have a question or comment? N. Must: No, I had no questions or comments. Wayne Arnold: Okay. All right. Thank you. Anybody in the audience have any questions or comments? Yes, sir. 9.A.6.c Packet Pg. 1725 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and EMS/Fire Station Golden Gate Blvd and DeSoto Blvd, PL20190002680 October 14, 2020 Neighborhood Information Meeting Page 7 of 9 Bob Mcloughlin: Anybody from Greater Naples here? Wayne Arnold: Greater Naples Fire? Bob Mcloughlin: Yes. Wayne Arnold: Is somebody in the audience from there? No, I don't believe they are in attendance. Bob Mcloughlin: Oh, then Chief, what are you gonna put there? Chief Tabitha Butcher: Uh, well, the plan, uh – [Crosstalk] Wayne Arnold: Can – can I get you to come over here – from – [Crosstalk] Chief Tabitha Butcher: Sure, I'd love to. Wayne Arnold: The question was, what are we gonna put there. So, the Chief's gonna explain a little bit more detail. Bob Mcloughlin: Well, I – I know already. At least, I – if Greater Naples isn't here, then – [Crosstalk] Chief Tabitha Butcher: So, from the EMS side of, we will be putting a transport ambulance, um, in that station. Bob Mcloughlin: EOS, AOS? Chief Tabitha Butcher: Yes. All of our ambulances are AOS. Bob Mcloughlin: All right. Chief Tabitha Butcher: Um, so it will be an ambulance transport ambulance. Um, Greater Naples, um, at minimum would like to put an engine there, and possibly a brush truck since most of the brush fires are out in that area. Um, and then, there is also potential that North Collier could put a fire resource there as well since their district actually comes down, um, towards that end on the eastern portion. 9.A.6.c Packet Pg. 1726 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and EMS/Fire Station Golden Gate Blvd and DeSoto Blvd, PL20190002680 October 14, 2020 Neighborhood Information Meeting Page 8 of 9 Bob Mcloughlin: [Inaudible] Chief Tabitha Butcher: Yeah, it is. So, um, we have been in discussion with them as well, so they may potentially put a resource there. Bob Mcloughlin: You said they potentially – oh, I – I want you to speak to some of these without representing them. I don't follow. They have quarters at, uh, Randall and Immokalee. You're saying they'll piggyback into this location? Chief Tabitha Butcher: Yes, because – and again, I'm not speaking for them – [Crosstalk] Bob Mcloughlin: Yeah. Chief Tabitha Butcher: – however, um, in recent meetings with them, they have been advised by the town team that some of the new developments that are planned on that eastern portion of Desoto – Bob Mcloughlin: Right. Chief Tabitha Butcher: – would be within their fire district. Bob Mcloughlin: Oh, yeah. O – okay. That's a – that's what that's – this meeting is about. Okay. Wayne Arnold: All right. Thank you. Thanks, Chief. Anybody else have a question or a comment? No? Yes, sir? Richard Eckster: My name's Richard Eckster and I'd like to make a donation to this fire department. Wayne Arnold: Can you speak up a little, just to make sure everybody hears you. We're recording this. Richard Eckster: My name's Richard Eckster. I would like to donate stone from here on the outside of the fire station. This is a, uh, – it's a fractured – actually, it's a – what do they call it, uh, hand quarried limestone. And it's 100 years old. And, uh, it has moss on it and everything. I wanna put it on the outside of the fire station and even more – all the, uh, firemen and frontline workers in the coronavirus, they could etch their name in the stone and apply it to the outside of the building as a memorial. Put the date, their service date. And I'd like to donate about 50 9.A.6.c Packet Pg. 1727 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and EMS/Fire Station Golden Gate Blvd and DeSoto Blvd, PL20190002680 October 14, 2020 Neighborhood Information Meeting Page 9 of 9 tons – uh, 50 tons of the stuff as a architectural veneer. Wayne Arnold: Okay. Richard Eckster: All right. Thank you. Wayne Arnold: Thank you. And I would suggest you get in touch with Chief Butcher and Mr. Barone – Richard Eckster: Also, the stone has dinosaur fossils in the rock. If they would like to look at it, they're welcome to. Tony Barone: All right. Thanks. Wayne Arnold: Any other comments or questions? If not, we're gonna close the meeting. All right. Well, thank you all for coming out. I guess our meeting is adjourned. [End of Audio] Duration: 16 minutes 9.A.6.c Packet Pg. 1728 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and EMS/Fire Station Golden Gate Blvd and DeSoto Blvd Conditional Use, PL20190002680 October 14, 2020 Neighborhood Information Meeting (NIM) 9.A.6.c Packet Pg. 1729 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : •Collier County –Applicant •Tony Barone, PMP, Senior Project Manager –Division of Facilities Management •D. Wayne Arnold, AICP, Professional Planner –Q. Grady Minor & Associates, P.A. •Michael J. Delate, P.E., Professional Planner –Q. Grady Minor & Associates, P.A. •James M. Banks, PE, Traffic Engineer –JMB Transportation Engineering, Inc. •Marco A. Espinar, Environmental Planning/Biologist –Collier Environmental Consultants, Inc. 2 Project Team 9.A.6.c Packet Pg. 1730 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : Parcel Number:40806320009 Legal:Golden Gate Estates Unit 79 Tract 72 Property Owner:Collier County Zoning:Estates (ST/W-4) Project Acreage:5.46+/-acres Proposed Request: The applicant is requesting a conditional use as allowed,pursuant to Land Development Code (LDC)Section 2.03.00,of the Estates (ST/W-4)Zoning District for a Safety Service Facility,including fire and emergency medical services. 3 Project Information 9.A.6.c Packet Pg. 1731 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : 4 Location Map Subject Property 9.A.6.c Packet Pg. 1732 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : 5 Conceptual Site Plan 9.A.6.c Packet Pg. 1733 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : 6 Aerial/Site Plan Overlay 9.A.6.c Packet Pg. 1734 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : 7 2019 Annual Update and Inventory Report 9.A.6.c Packet Pg. 1735 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : 8 Architectural Examples 9.A.6.c Packet Pg. 1736 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : 9 Conclusion Documents and information can be found online: •Gradyminor.com/Planning •Collier County GMD Public Portal: cvportal.colliergov.net/cityviewweb Next Steps •Hearing sign(s) posted on property advertising Planning Commission (CCPC) and Board of County Commissioner (BCC) hearing dates. •CCPC November 19, 2020, 9:00 AM •BCC January 26, 2021, 9:00 AM Contact: •Q. Grady Minor & Associates, P.A.: Sharon Umpenhour, Senior Planning Technician; sumpenhour@gradyminor.com or 239.947.1144 extension 1249 •Collier County:Laura DeJohn, AICP, Senior Planner; Laura.DeJohn@colliercountyfl.gov or 239.252.4324 9.A.6.c Packet Pg. 1737 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : 9.A.6.c Packet Pg. 1738 Attachment: ATTACHMENT B - PL20190002680 Nov 19 2020 CCPC Backup (14187 : PL20190002680 - Safety Service Facility Golden Gate and 1 LauraDeJohnVEN From:Rae Ann Burton <raburton@embarqmail.com> Sent:Monday, October 12, 2020 7:31 PM To:LauraDeJohnVEN Subject:SUPPORT OF EMS/FIRE STATION PL20190002680 EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. We support the construction of the EMS/Fire Station at Golden Gate Blvd @ Desoto Blvd. PL20190002680 9.A.6.d Packet Pg. 1739 Attachment: ATTACHMENT C - Public input received as of Oct 29 (14187 : PL20190002680 - Safety Service Facility Golden Gate and DeSoto 1 LauraDeJohnVEN From:Barbara Pierce <barbarapierce06@yahoo.com> Sent:Monday, October 12, 2020 5:51 PM To:LauraDeJohnVEN Subject:Fire Station in Golden Gate Estates EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Dear Ms. DeJohn: We are writing to express our strong support of a Fire Station at Golden Gate Blvd. and Desoto. Our home, a few miles from that intersection, has been rejected by several insurance companies as it is too far from a fire station or even a fire hydrant. Thank you for your consideration of this important project. Barbara Pierce George L. Mason 9.A.6.d Packet Pg. 1740 Attachment: ATTACHMENT C - Public input received as of Oct 29 (14187 : PL20190002680 - Safety Service Facility Golden Gate and DeSoto 1 LauraDeJohnVEN From:Ty Thrasher <tythrasher@outlook.com> Sent:Monday, October 12, 2020 5:48 PM To:LauraDeJohnVEN Subject:SUPPORT OF EMS/FIRE STATION PL20190002680 EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. Good afternoon, I am a resident of Golden Gate Estates. My wife and I reside at 4880 16th Ave SE, Desoto & 16th SE I am also a board member of the Civic Association I just received an email from the President of our board about the movement of getting a station on the SW corner of Golden Gate Blvd & Desoto. I understand there is a meeting for this on Wednesday at 530pm, due to that time, I am unfortunately unable to attend. I really wish I could be there; will it be recorded maybe?? But I also wanted to make clear as a resident, that my wife and I both fully support the construction of the EMS/Fire Station at Golden Gate Blvd @ Desoto Blvd. If you are able, please forward to me any material about this so I may get caught up. Thank you so much Ty Thrasher Sent via Outlook.com 9.A.6.d Packet Pg. 1741 Attachment: ATTACHMENT C - Public input received as of Oct 29 (14187 : PL20190002680 - Safety Service Facility Golden Gate and DeSoto PROPOSED FUTURE ROW EXPANSION AREA PRESERVE POTENTIAL SEPTIC LOCATION PROPERTY BOUNDARY MINIMUM 15' TYPE 'D' LANDSCAPE BUFFER MINIMUM 15' TYPE 'D' LANDSCAPE BUFFER MINIMUM 15' WIDE TYPE 'B' LANDSCAPE BUFFERMINIMUM 15' WIDE TYPE 'B'LANDSCAPE BUFFERMINIMUM BUILDING SETBACK LEGEND ZONED: ESTATES USE:RESIDENTIAL ZONED: ESTATES USE:RESIDENTIAL 100' PUBLIC ROAD (PER PLAT BOOK 5 PAGE 17)100' PUBLIC ROAD(PER PLAT BOOK 5PAGE 17)ZONED: ESTATES USE:RESIDENTIAL ZONED: ESTATES USE:RESIDENTIAL DRY DETENTION AREA 75' MIN. BLDG.SETBACK75' MIN. BLDG. SETBACK 75' MIN. BLDG. SETBACK 6' LANDSCAPE BUFFER RESERVATION (SEE NOTE #2)205' MIN. BLDG.SETBACKMINIMUM 15' TYPE 'D' LANDSCAPE BUFFER 25' 30'39'REFUSE AND SERVICE AREA 20' 22' 20' POTENTIAL WELL LOCATION 0 100'50' SCALE: 1" = 100' GradyMinor Civil Engineers ●Land Surveyors ●Planners ●Landscape Architects Cert. of Auth. EB 0005151 Cert. of Auth. LB 0005151 Business LC 26000266 Q. Grady Minor and Associates, P.A. 3800 Via Del Rey Bonita Springs, Florida 34134 Bonita Springs: 239.947.1144 ZZZ.GradyMinor.coP Fort Myers: 239.690.4380 WHEN PLOTTED @ 8.5" X 11"DESOTO BLVD SGOLDEN GATE BLVD E PROPOSED EMS/FIRE BUILDING 26,000 SF 9.A.6.d Packet Pg. 1742 Attachment: ATTACHMENT C - Public input received as of Oct 29 (14187 : PL20190002680 - Safety Service Facility Golden Gate and DeSoto1. Police substation / USE ? 2. Parking quantity vs. employee count? 3. Bldg grade vs transition "down" to preserve(s) ? 4. Architectural example ? (EMS station vs Max Haase) 5. Wall(s) against residential - "raised" bldg vs. final buffer grade(s) and sound abatement in Type 'B' buffer ? 6. Overhead door screening requirement for buffering in Type 'D' buffer along Desoto ? **Correspondence from Jeff Curl following 10/14/20 NIM** GradyMinor Civil Engineers ●Land Surveyors ●Planners ●Landscape Architects Cert. of Auth. EB 0005151 Cert. of Auth. LB 0005151 Business LC 26000266 Q. Grady Minor and Associates, P.A. 3800 Via Del Rey Bonita Springs, Florida 34134 Bonita Springs: 239.947.1144 ZZZ.GradyMinor.coP Fort Myers: 239.690.4380 SITE INFORMATION: ZONING: E, ESTATES SITE AREA: 5.46+/- ACRES ROW RESERVATION:1.82± ACRES DEVELOPMENT AREA:3.64± ACRES BUILDING: MAXIMUM 26,000 SQUARE FEET BUILDING HEIGHT:ZONED ACTUAL PRINCIPAL:35'40' ACCESSORY:25'30' PRESERVE (MINIMUM): REQUIRED:0.36± ACRES (3.64 ACRES X .10) PROVIDED:0.36± ACRES OPEN SPACE (MINIMUM): REQUIRED:1.1± ACRES (3.64 X .30) PROVIDED:1.1± ACRES SETBACKS (MINIMUM): PRINCIPAL STRUCTURE:ACCESSORY: GOLDEN GATE BLVD.75' DESOTO BLVD.75' SOUTH 205' WEST 75' PRESERVE 25' 10' NOTES: 1.ALL ON-SITE LIGHTING SHALL BE SHIELDED AND DIRECTED AWAY FROM ADJOINING PROPERTIES. PARKING LOT LIGHTING LIMITED TO 15 FEET IN HEIGHT IN AREA SHOWN ON SITE PLAN. 2.PRESERVES MAY BE USED TO SATISFY THE LANDSCAPE BUFFER REQUIREMENTS AFTER EXOTIC VEGETATION REMOVAL IN ACCORDANCE WITH LDC SECTIONS 4.06.02 AND 4.06.05.E.1. SUPPLEMENTAL PLANTINGS WITH NATIVE PLANT MATERIALS SHALL BE IN ACCORDANCE WITH LDC SECTION 3.05.07. IN ORDER TO MEET THE LDC REQUIREMENTS FOR A TYPE B BUFFER ALONG THE WESTERN AND SOUTHERN BOUNDARIES OF THE PROJECT, A 6-FOOT WIDE LANDSCAPE BUFFER RESERVATION HAS BEEN IDENTIFIED ON THE CONCEPTUAL SITE PLAN. IN THE EVENT THAT THE PRESERVE DOES NOT MEET BUFFER REQUIREMENTS AFTER REMOVAL OF EXOTICS AND SUPPLEMENTAL PLANTING WITHIN THE PRESERVE, PLANTINGS WILL BE PROVIDED IN THE 6-FOOT WIDE RESERVATION TO MEET THE BUFFER REQUIREMENTS. THE TYPE, SIZE, AND NUMBER OF SUCH PLANTINGS, IF NECESSARY, WILL BE DETERMINED AT TIME OF INITIAL SDP OR PLAT AND INCLUDED ON THE LANDSCAPE PLANS FOR THE SDP OR PLAT. 9.A.6.d Packet Pg. 1743 Attachment: ATTACHMENT C - Public input received as of Oct 29 (14187 : PL20190002680 - Safety Service Facility Golden Gate and DeSoto 1 LauraDeJohnVEN From:mabachelor@comcast.net Sent:Sunday, October 18, 2020 12:50 PM To:LauraDeJohnVEN Subject:SUPPORT OF EMS/FIRE STATION PL20190002680 EXTERNAL EMAIL: This email is from an external source. Confirm this is a trusted sender and use extreme caution when opening attachments or clicking links. We support the construction of the EMS/Fire Station at Golden Gate Blvd @ Desoto Blvd. PL20190002680 Mary Ann & Greg Bachelor 2123 Par Drive Naples, Florida 34120 9.A.6.d Packet Pg. 1744 Attachment: ATTACHMENT C - Public input received as of Oct 29 (14187 : PL20190002680 - Safety Service Facility Golden Gate and DeSoto 9.A.6.e Packet Pg. 1745 Attachment: AffidavitandSignPosting 10-27-2020 (14187 : PL20190002680 - Safety Service Facility Golden Gate and DeSoto Blvd (CU)) 9.A.6.ePacket Pg. 1746Attachment: AffidavitandSignPosting 10-27-2020 (14187 : PL20190002680 - Safety Service Facility Golden Gate and DeSoto Blvd (CU)) 11/19/2020 COLLIER COUNTY Collier County Planning Commission Item Number: 9.A.7 Item Summary: ******This Item will not be heard before 5:05 pm ***** An Ordinance of the Board of County Commissioners of Collier County, Florida, Amending Ordinance Number 04-41, as amended, the Collier County Land Development Code, which includes the comprehensive land regulations for the unincorporated area of Collier County, Florida, to allow Communication Towers as a Conditional Use in the Estates (E) Zoning District, to clarify that Cluster Development for Affordable Housing does not require Conditional Use approval in the RMF-6 Zoning District and to create Alternative Design Standards for Housing that is Affordable, to modify setback requirements for Public Utility Ancillary Systems enclosures, and to Correct Citations and Update Text, by providing for: Section One, Recitals; Section Two, Findings Of Fact; Section Three, Adoption Of Amendments To The Land Development Code, more specifically amending the following: Chapter One-General Provisions; Chapter Two - Zoning Districts And Uses; Chapter Four - Site Design And Development Standards; Chapter Five - Supplemental Standards; Chapter Ten - Application, Review, And Decision-Making Procedures; and Appendix A Standard Performance Security Documents For Required Improvements; Section Four, Conflict And Severability; Section Five, Inclusion in the Collier County Land Development Code, and Section Six, Effective Dated. ( Coordinator: Jeremy Frantz, LDC Manager) Meeting Date: 11/19/2020 Prepared by: Title: Planner, Principal – Growth Management Development Review Name: Richard Henderlong 10/30/2020 10:15 AM Submitted by: Title: Manager - Planning – Zoning Name: Ray Bellows 10/30/2020 10:15 AM Approved By: Review: Zoning Ray Bellows Review Item Completed 10/30/2020 11:02 AM Growth Management Operations & Regulatory Management Donna Guitard Review Item Completed 11/04/2020 1:02 PM Planning Commission Diane Lynch Review item Completed 11/06/2020 1:40 PM Zoning Jeremy Frantz Additional Reviewer Completed 11/10/2020 4:41 PM Zoning Anita Jenkins Additional Reviewer Completed 11/10/2020 5:18 PM Growth Management Department James C French Review Item Completed 11/11/2020 7:35 PM Zoning Ray Bellows Review Item Completed 11/12/2020 11:14 AM Planning Commission Edwin Fryer Meeting Pending 11/19/2020 9:00 AM 9.A.7 Packet Pg. 1747 1 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx LAND DEVELOPMENT CODE AMENDMENT PETITION PL20200001602 SUMMARY OF AMENDMENT This amendment corrects scrivener’s errors and updates cross references related to various Land Development Code (LDC) sections, the Florida Statues (F.S.) and Florida Administrative Code (F.A.C.) Chapter and Rule citations. LDC SECTIONS TO BE AMENDED 1.08.02 Definitions 2.03.01 Agricultural Districts 2.03.02 Residential Zoning Districts 2.03.03 Commercial Zoning Districts 2.03.05 Civic and Institutional Zoning Districts 2.03.07 Overlay Zoning Districts 2.03.08 Rural Fringe Zoning Districts 4.02.06 Standards for Development within the Airport Overlay (APO) 10.02.03 Requirements for Site Development, Site Improvement Plans and Amendments thereof 10.02.05 Construction, Approval, and Acceptance of Required Improvements 10.02.13 Planned Unit Development (PUD) Procedures Appendix A-Standard Performance Security Documents for Required Improvements ORIGIN Growth Management Department HEARING DATES BCC TBD CCPC 11/19/20 DSAC 10/07/20 DSAC-LDR 09/15/20 ADVISORY BOARD RECOMMENDATIONS DSAC-LDR DSAC CCPC Approval Approval TBD BACKGROUND Staff has researched and reviewed 2019 Florida Statues and Florida Administrative Code citations for the definition and use of the terms “Assisted Living Facility” (ALF) and “Family Care Facility” (FCF). The previous referenced citations have been transferred over time and require correction throughout the respective residential and non - residential zoning districts and the Santa Barbara Commercial Overlay District. The correct F.S. and F.A.C. citations are listed in a Correction Table. See Exhibit A. This amendment further corrects scrivener’s errors and cross references in the following LDC sections: Section 1.08.02: When the F.A.C. Chapter 59 A-36.10 was adopted, the word “supervisors” has been replaced with “staff” for the definition of “Family Care Facility”, and this change has been made. Section 2.03.03 D.1.a.26: The word “texture” should read “textile.” Sections 2.03.08 A.2.a.(4)(b)ii. a)iv) and 2.03.08 A.2.a.(4)(b)ii. b)v): The reference to LDC section 4.02.01 should read 4.02.03 which is the appropriate section for the “Specific Standards for Location of Accessory Buildings and Structures”. 9.A.7.a Packet Pg. 1748 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) 2 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx Section 4.02.06 L.2.a: When Ordinance 19-35 was sent to FDOT for review, the FDOT-Aviation and Spaceports Office representatives brought a discrepancy to staff’s attention. The correct height is 499 feet rather than 500 feet, and this change is consistent with the Federal Regulation Title 14, Part 77. See Exhibit B. Section 10.02.03 F.5: The reference to LDC section 10.03.06 Q should read LDC section 10.03.06 R, which is the appropriate section for public notice and required hearings for “Site Plan with Deviations for Redevelopment”. Section 10.02.05 B.2.a: The words “Competition Certificate” should read “Completion Certificate.”. Section 10.02.13 I.: The reference to LDC sections “2.02.12 and 2.02.12 D” should read “10.02.13 and 10.02.13 D”. Appendix A: Florida Statues 117.05 (4) provides for the notarial certificate requirements and F.S. 117.05 (13) provides the templates and acknowledgements in a representative capacity. For each respective standard performance security document, the notarial acknowledgement is updated and replaced with the generic notarial certificate requirement for conformity. FISCAL & OPERATIONAL IMPACTS There are no anticipated fiscal or operational impacts associated with this amendment. GMP CONSISTENCY There are no anticipated Growth Management Plan impacts associated with this amendment. EXHIBITS: A) F.S. and F.A.C. Correction Table B) Federal Aviation Administration DOT: 14 CFR Part 77, Subpart C § 77.17(a)(1) 9.A.7.a Packet Pg. 1749 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 3 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx Amend the LDC as follows: 1 2 1.08.02 Definitions 3 4 * * * * * * * * * * * * * 5 Assisted living facility: Any building(s), section of a building, distinct part of a building, 6 residence, private home, boarding home, or other place, whether operated for profit or 7 not, which undertakes through its ownership or management to provide for a period 8 exceeding 24 hours, housing, food service, and 1 or more personal services for 4 or more 9 adults, not related to the owner or administrator by blood or marriage, who require such 10 services and to provide limited nursing services, when specifically licensed to do so 11 pursuant to § 400.407 400.062 F.S. A facility offering personal services or limited nursing 12 services for fewer than 4 adults is within the meaning of this definition if it formally or 13 informally advertises to or solicits the public for residents or referrals and holds itself out 14 to the public to be an establishment that regularly provides such services. 15 * * * * * * * * * * * * * 16 Family care facility: A residential facility designed to be occupied by not more than 6 17 persons under care, plus supervisors staff as required by subsection 10A-5.019, FAC rule 18 59A-36.010, F.A.C. and constituting a single dwelling unit (i.e., adult congregate living 19 facility for: aged persons; developmentally disabled persons; physically disabled or 20 handicapped persons; mentally ill persons; and persons recovering from alcohol and/or 21 drug abuse. Foster care facilities are also included, but not the uses listed under group 22 care facility (category II). This use shall be applicable to single-family dwelling units and 23 mobile homes. 24 * * * * * * * * * * * * * 25 # # # # # # # # # # # # # 26 27 2.03.01 - Agricultural Districts. 28 29 A. Rural Agricultural District (A). The purpose and intent of the rural agricultural district (A) is 30 to provide lands for agricultural, pastoral, and rural land uses by accommodating 31 traditional agricultural, agricultural related activities and facilities, support facilities related 32 to agricultural needs, and conservation uses. Uses that are generally considered 33 compatible to agricultural uses that would not endanger or damage the agricultural, 34 environmental, potable water, or wildlife resources of the County, are permissible as 35 conditional uses in the A district. The A district corresponds to and implements the 36 Agricultural/Rural land use designation on the future land use map of the Collier County 37 GMP, and in some instances, may occur in the designated urban area. The maximum 38 density permissible in the rural agricultural district within the urban mixed use district shall 39 be guided, in part, by the density rating system contained in the future land use element 40 of the GMP. The maximum density permissible or permitted in A district shall not exceed 41 the density permissible under the density rating system. The maximum density permissible 42 in the A district within the agricultural/rural district of the future land use element of the 43 Collier County GMP shall be consistent with and not exceed the density permissible or 44 permitted under the agricultural/rural district of the future land use element. 45 46 1. The following subsections identify the uses that are permissible by right and the 47 uses that are allowable as accessory or conditional uses in the rural agricultural 48 district (A). 49 * * * * * * * * * * * * * 50 9.A.7.a Packet Pg. 1750 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 4 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx c. Conditional uses. The following uses are permitted as conditional uses in the rural 1 agricultural district (A), subject to the standards and procedures established in LDC 2 section 10.08.00 and the Administrative Code. 3 * * * * * * * * * * * * 4 16. Group care facilities (category I and II); care units; nursing homes; assisted 5 living facilities pursuant to § 400.402 429.02 F.A.C F.S.; and continuing 6 care retirement communities pursuant to § ch. 651 F.S. and ch. 4-193 69O-7 193 F.A.C., all subject to LDC section 5.05.04 when located within the 8 Urban Designated Area on the Future Land Use Map to the Collier County 9 Growth Management Plan. 10 * * * * * * * * * * * * * 11 B. Estate District (E). The purpose and intent of the estates district (E) is to provide lands for 12 low density residential development in a semi-rural to rural environment, with limited 13 agricultural activities. In addition to low density residential development with limited 14 agricultural activities, the E district is also designed to accommodate as conditional uses, 15 development that provides services for and is compatible with the low density residential, 16 semi-rural and rural character of the E district. The E district corresponds to and 17 implements the estates land use designation on the future land use map of the Collier 18 County GMP, although, in limited instances, it may occur outside of the estates land use 19 designation. The maximum density permissible in the E district shall be consistent with 20 and not exceed the density permissible or permitted under the estates district of the future 21 land use element of the Collier County GMP as provided under the Golden Gate Master 22 Plan. 23 24 1. The following subsections identify the uses that are permissible by right and the 25 uses that are allowable as accessory or conditional uses in the estates district (E). 26 * * * * * * * * * * * * * 27 c. Conditional uses. For Estates zoning within the Golden Gate Estates 28 subdivision, the Golden Gate Area Master Plan in the GMP restricts the 29 location of conditional uses. The following uses are permissible as 30 conditional uses in the estates district (E), subject to the standards and 31 procedures established in LDC section 10.08.00. 32 * * * * * * * * * * * * * 33 5. Group care facilities (category I); care units, subject to the 34 provisions of LDC subsection 2.03.01 B.3.f; nursing homes; 35 assisted living facilities pursuant to § 400.402 429.02 F.S. and ch. 36 58A-5 59A-36 F.A.C.; and continuing care retirement communities 37 pursuant to § ch. 651 F.S. and ch. 4-193 69O-193 F.A.C.; all subject 38 to LDC section 5.05.04. 39 * * * * * * * * * * * * * 40 # # # # # # # # # # # # # 41 42 2.03.02 - Residential Zoning Districts 43 44 A. Residential Single-Family Districts (RSF-1; RSF-2; RSF-3; RSF-4; RSF-5; RSF-6). The 45 purpose and intent of the residential single-family districts (RSF) is to provide lands 46 primarily for single-family residences. These districts are intended to be single-family 47 residential areas of low density. The nature of the use of property is the same in all of 48 these districts. Variation among the RSF-1, RSF-2, RSF-3, RSF-4, RSF-5 and RSF-6 49 9.A.7.a Packet Pg. 1751 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 5 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx districts is in requirements for density, lot area, lot width, yards, height, floor area, lot 1 coverage, parking, landscaping and signs. Certain structures and uses designed to 2 serve the immediate needs of the single-family residential development in the RSF 3 districts such as governmental, educational, religious, and noncommercial recreational 4 uses are permitted as conditional uses as long as they preserve , and are compatible 5 with the single-family residential character of the RSF district[s]. The RSF districts 6 correspond to and implement the urban mixed use land use designation on the future 7 land use map of the Collier County GMP. The maximum density permissible in the 8 residential single-family (RSF) districts and the urban mixed use land use designation 9 shall be guided, in part, by the density rating system contained in the future land use 10 element of the Collier County GMP. The maximum density permissible or permitted in 11 the RSF district shall not exceed the density permissible under the density rating 12 system, except as permitted by policies contained in the future land use element. 13 14 1. The following subsections identify the uses that are permissible by right and the 15 uses that are allowable as accessory or conditional uses in the residential single-16 family districts (RSF). 17 * * * * * * * * * * * * * 18 c. Conditional uses. The following uses are permissible as conditional uses 19 in the residential single-family districts (RSF), subject to the standards and 20 procedures established in LDC section 10.08.00 21 * * * * * * * * * * * * * 22 7. Group care facilities (category I); care units subject to the provisions 23 of LDC subsection 2.03.02 3.h; nursing homes; assisted living 24 facilities pursuant to § 400.402 429.02 F.S. and ch. 58A-5 59A-36 25 F.A.C.; and continuing care retirement communities pursuant to § 26 ch. 651 F.S. and ch. 4-193 69O-193 F.A.C.; all subject to LDC 27 section 5.05.04. 28 * * * * * * * * * * * * * 29 30 B. Residential Multi-Family-6 District (RMF-6). The purpose and intent of the 31 residentialmulti-family-6 district (RMF-6) is to provide for single-family, two-family and 32 multi-family residences having a low profile silhouette, surrounded by open space, 33 being so situated that it is located in close proximity to public and commercial s ervices 34 and has direct or convenient access to collector and arterial roads on the county major 35 road network. The RMF-6 district corresponds to and implements the urban mixed use 36 land use designation on the future land use map of the Collier County GMP. The 37 maximum density permissible in the RMF-6 district and the urban mixed use land use 38 designation shall be guided, in part, by the density rating system contained in the future 39 land use element of the Collier County GMP. The maximum density permissible or 40 permitted in the RMF-6 district shall not exceed the density permissible under the 41 density rating system, except as permitted by policies contained in the future land use 42 element. 43 44 1. The following subsections identify the uses that are permissible by right and the uses that 45 are allowable as accessory or conditional uses in the RMF-6 district. 46 * * * * * * * * * * * * * 47 c. Conditional uses. The following uses are permissible as conditional uses in the 48 RMF-6 district, subject to the standards and procedures established in LDC section 49 10.08.00. 50 9.A.7.a Packet Pg. 1752 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 6 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx * * * * * * * * * * * * * 1 6. Group care facilities (category I and II); care units; nursing homes; assisted 2 living facilities pursuant to § 400.402 429.02 F.S. and ch. 58A-5 59A-36 3 F.A.C; and continuing care retirement communities pursuant to § ch. 651 4 F.S. and ch. 4-193 69O-193 F.A.C.; all subject to LDC section 5.05.04. 5 * * * * * * * * * * * * * 6 C. Residential Multi-Family-12 District (RMF-12). The purpose and intent of the residential 7 multi-family 12 district (RMF-12) is to provide lands for multiple-family residences having 8 a mid-rise profile, generally surrounded by lower structures and open space, located in 9 close proximity to public and commercial services, with direct or convenient access to 10 collector and arterial roads on the county major road network. Governmental, social, and 11 institutional land uses that serve the immediate needs of the multi-family residences are 12 permitted as conditional uses as long as they preserve and are compatible with the mid-13 rise multiple-family character of the district. The RMF-12 district corresponds to and 14 implements the urban mixed use land use designation on the future land use map of the 15 Collier County GMP. The maximum density permissible in the RMF-12 district and the 16 urban mixed use land use designation shall be guided, in part, by the density rating system 17 contained in the future land use element of the Collier County GMP. The maximum density 18 permissible or permitted in the RMF-12 district shall not exceed the density permissible 19 under the density rating system, except as permitted by policies contained in the future 20 land use element. 21 22 1. The following subsections identify the uses that are permissible by right and the 23 uses that are allowable as accessory or conditional uses in the residential multi-24 family-12 district (RMF-12). 25 * * * * * * * * * * * * * 26 c. Conditional uses. The following uses are permissible as conditional uses 27 in the residential multiple-family-12 district (RMF-12), subject to the 28 standards and procedures established in LDC section 10.08.00. 29 * * * * * * * * * * * * * 30 6. Group care facilities (category I and II); care units; nursing homes; 31 assisted living facilities pursuant to § 400.402 429.02 F.S. and ch. 32 58A-5 59A-36 F.A.C.; and continuing care retirement communities 33 pursuant to § ch. 651 F.S. and ch. 4-193 69O-193 F.A.C.; all subject 34 to 35 * * * * * * * * * * * * * 36 D. Residential Multi-Family-16 District (RMF-16). The purpose and intent of the 37 residentialmulti-family-16 district (RMF-16) is to provide lands for medium to high density 38 multiple-family residences, generally surrounded by open space, located in close proximity 39 to public and commercial services, with direct or convenient access to arterial and collector 40 roads on the county major road network. Governmental, social, and institutional land uses 41 that serve the immediate needs of the multiple-family residences are permitted as 42 conditional uses as long as they preserve and are compatible with the medium to high 43 density multi-family character of the district. The RMF-16 district corresponds to and 44 implements the urban mixed use land use designation on the future land use map of the 45 Collier County GMP. The maximum density permissible in the RMF-16 district and the 46 urban mixed use land use designation shall be guided, in part, by the density rating system 47 contained in the future land use element of the Collier County GMP. The maximum density 48 permissible or permitted in the RMF-16 district shall not exceed the density permissible 49 under the density rating system, except as permitted by policies contained in the future 50 land use element. 51 9.A.7.a Packet Pg. 1753 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 7 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx 1 1. The following subsections identify the uses that are permissible by right and the 2 uses that are allowable as accessory or conditional uses in the residential multi-3 family-16 district (RMF-16). 4 * * * * * * * * * * * * * 5 c. Conditional uses. The following uses are permissible as conditional uses 6 in the residential multiple-family-16 district (RMF-16), subject to the 7 standards and procedures established in LDC section 10.08.00. 8 * * * * * * * * * * * * * 9 6. Group care facilities (category I and II); care units; nursing homes; 10 assisted living facilities pursuant to § 400.402 429.02 F.S. and ch. 11 58A-5 59A-36 F.A.C.; and continuing care retirement communities 12 pursuant to § ch. 651 F.S. and ch. 4-193 69O-193 F.A.C.; all subject 13 to LDC section 5.05.04. 14 * * * * * * * * * * * * * 15 E. Residential Tourist District (RT). The purpose and intent of the residential tourist district 16 (RT) is to provide lands for tourist accommodations and support facilities, and multiple 17 family uses. The RT district corresponds with and implements the urban mixed use district 18 and the activity center district in the urban designated area on the future land use map of 19 the Collier County GMP. 20 21 1. The following subsections identify the uses that are permissible by right and the 22 uses that are allowable as accessory or conditional uses in the residential tourist 23 district (RT). 24 * * * * * * * * * * * * * 25 c. Conditional uses. The following uses are permitted as conditional uses in 26 the residential tourist district (RT), subject to the standards and procedures 27 established in LDC section 10.08.00. 28 * * * * * * * * * * * * * 29 4. Group care facilities (category I and II); care units; nursing homes; 30 assisted living facilities pursuant to § 400.402 429.02 F.S. and ch. 31 58A-5 59A-36 F.A.C.; and continuing care retirement communities 32 pursuant to § ch. 651 F.S. and ch. 4-193 69O-193 F.A.C.; all subject 33 to LDC section 5.05.04. 34 * * * * * * * * * * * * * 35 F. Village Residential District (VR). The purpose and intent of the village residential district 36 (VR) is to provide lands where a mixture of residential uses may exist. Additionally, uses 37 are located and designed to maintain a village residential character which is generally low 38 profile, relatively small building footprints as is the current appearance of Goodland and 39 Copeland. The VR district corresponds to and implements the mixed residential land use 40 designation on the Immokalee future land use map of the Collier County GMP. It is 41 intended for application in those urban areas outside of the coastal urban area designated 42 on the future land use map of the Collier County GMP, though there is some existing VR 43 zoning in the coastal urban area. The maximum density permissible in the VR district and 44 the urban mixed use land use designation shall be guided, in part, by the density rating 45 system contained in the future land use element of the Collier County GMP. The maximum 46 density permissible or permitted in the VR district shall not exceed the density permissible 47 under the density rating system, except as permitted by policies contained in the future 48 land use element, or as designated on the Immokalee future land use map of the GMP. 49 50 9.A.7.a Packet Pg. 1754 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 8 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx 1. The following subsections identify the uses that are permissible by right and the 1 uses that are allowable as accessory or conditional uses in the village residential 2 district (VR). 3 * * * * * * * * * * * * * 4 c. Conditional uses. The following uses are permissible as conditional uses 5 in the village residential district (VR), subject to the standards and 6 procedures established in LDC section 10.08.00. 7 * * * * * * * * * * * * * 8 8. Group care facilities (category I and II); care units; nursing homes; 9 assisted living facilities pursuant to § 400.402 429.02 F.S. and ch. 10 58A-5 59A-36 F.A.C.; and continuing care retirement communities 11 pursuant to § ch. 651 F.S. and ch. 4-193 69O-193 F.A.C.; all subject 12 to LDC section 5.05.04. 13 * * * * * * * * * * * * * 14 # # # # # # # # # # # # # 15 16 2.03.03 - Commercial Zoning Districts 17 18 A. Commercial Professional and General Office District (C-1). The purpose and intent of 19 the commercial professional and general office district C-1 is to allow a concentration of 20 office type buildings and land uses that are most compatible with, and located near, 21 residential areas. Most C-1 commercial, professional, and general office districts are 22 contiguous to, or when within a PUD, will be placed in close proximity to residential 23 areas, and, therefore, serve as a transitional zoning district between residential areas 24 and higher intensity commercial zoning districts. The types of office uses permitted are 25 those that do not have high traffic volumes throughout the day, which extend into the 26 evening hours. They will have morning and evening short-term peak conditions. The 27 market support for these office uses should be those with a localized basis of market 28 support as opposed to office functions requiring inter-jurisdictional and regional market 29 support. Because office functions have significant employment characteristics, which are 30 compounded when aggregations occur, certain personal service uses shall be permitted, 31 to provide a convenience to office-based employment. Such convenience commercial 32 uses shall be made an integral part of an office building as opposed to the singular use 33 of a building. Housing may also be a component of this district as provided for through 34 conditional use approval. 35 36 1. The following uses, as identified with a number from the Standard Industrial 37 Classification Manual (1987), or as otherwise provided for within this section are 38 permissible by right, or as accessory or conditional uses within the C-1 commercial 39 professional and general office district. 40 41 a. Permitted uses. 42 * * * * * * * * * * * * * 43 20. Group care facilities (category I and II, except for homeless 44 shelters); care units, except for homeless shelters; nursing homes; 45 assisted living facilities pursuant to § 400.402 429.02 F.S. and ch. 46 58A-5 59A-36 F.A.C.; and continuing care retirement communities 47 pursuant to § ch, 651 F.S. and ch. 4-193 69O-193 F.A.C.; all 48 subject to LDC section 5.05.04. 49 * * * * * * * * * * * * * 50 9.A.7.a Packet Pg. 1755 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 9 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx B. Commercial Convenience District (C-2). The purpose and intent of the commercial 1 convenience district (C-2) is to provide lands where commercial establishments may be 2 located to provide the small-scale shopping and personal needs of the surrounding 3 residential land uses within convenient travel distance except to the extent that office 4 uses carried forward from the C-1 district will expand the traditional neighborhood size. 5 However, the intent of this district is that retail and service uses be of a nature that can 6 be economically supported by the immediate residential environs. Therefore, the uses 7 should allow for goods and services that households require on a daily basis, as 8 opposed to those goods and services that households seek for the most favorable 9 economic price and, therefore, require much larger trade areas. It is intended that the C-10 2 district implements the Collier County GMP within those areas designated 11 agricultural/rural; estates neighborhood center district of the Golden Gate Master Plan; 12 the neighborhood center district of the Immokalee Master Plan; and the urban mixed use 13 district of the future land use element permitted in accordance with the locational criteria 14 for commercial and the goals, objectives, and policies as identified in the future land use 15 element of the Collier County GMP. The maximum density permissible in the C-2 district 16 and the urban mixed use land use designation shall be guided, in part, by the density 17 rating system contained in the future land use element of the Collier County GMP. The 18 maximum density permissible or permitted in a district shall not exceed the density 19 permissible under the density rating system. 20 21 1. The following uses, as identified with a number from the Standard Industrial 22 Classification Manual (1987), or as otherwise provided for within this section are 23 permissible by right, or as accessory or conditional uses within the C-2 24 commercial convenience district. 25 26 a. Permitted uses. 27 * * * * * * * * * * * * * 28 34. Group care facilities (category I and II, except for homeless 29 shelters); care units, except for homeless shelters; nursing homes; 30 assisted living facilities pursuant § 400.402 429.02 F.S. and ch. 31 58A-5 59A-36 F.A.C.; and continuing care retirement communities 32 pursuant to § ch. 651 F.S. and ch. 4-193 69O-193 F.A.C.; all subject 33 to LDC section 5.05.04. 34 * * * * * * * * * * * * * 35 C. Commercial Intermediate District (C-3). The purpose and intent of the commercial 36 intermediate district (C-3) is to provide for a wider variety of goods and services intended 37 for areas expected to receive a higher degree of automobile traffic. The type and variety 38 of goods and services are those that provide an opportunity for comparison shopping, 39 have a trade area consisting of several neighborhoods, and are preferably located at the 40 intersection of two-arterial level streets. Most activity centers meet this standard. This 41 district is also intended to allow all of the uses permitted in the C-1 and C-2 zoning districts 42 typically aggregated in planned shopping centers. This district is not intended to permit 43 wholesaling type of uses, or land uses that have associated with them the need for outdoor 44 storage of equipment and merchandise. A mixed-use project containing a residential 45 component is permitted in this district subject to the criteria established herein. The C-3 46 district is permitted in accordance with the locational criteria for commercial and the goals, 47 objectives, and policies as identified in the future land use element of the Collier County 48 GMP. The maximum density permissible in the C-3 district and the urban mixed use land 49 use designation shall be guided, in part, by the density rating system contained in the 50 future land use element of the Collier County GMP. The maximum density permissible or 51 9.A.7.a Packet Pg. 1756 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 10 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx permitted in the C-3 district shall not exceed the density permissible under the density 1 rating system. 2 3 1. The following uses, as identified with a number from the Standard Industrial 4 Classification Manual (1987), or as otherwise provided for within this section are 5 permissible by right, or as accessory or conditional uses within the commercial 6 intermediate district (C-3). 7 8 a. Permitted uses. 9 * * * * * * * * * * * * * 10 42. Group care facilities (category I and II, except for homeless 11 shelters); care units, except for homeless shelters; nursing homes; 12 assisted living facilities pursuant to § 400.402 429.02 F.S. and ch. 13 58A-5 59A-36 F.A.C.; and continuing care retirement communities 14 pursuant to § ch. 651 F.S. and ch. 4-193 69O-193 F.A.C.; all subject 15 to LDC section 5.05.04. 16 * * * * * * * * * * * * * 17 D. General Commercial District (C-4). The general commercial district (C-4) is intended to 18 provide for those types of land uses that attract large segments of the population at the 19 same time by virtue of scale, coupled with the type of activity. The purpose and intent of 20 the C-4 district is to provide the opportunity for the most diverse types of commercial 21 activities delivering goods and services, including entertainment and recreational 22 attractions, at a larger scale than the C-1 through C-3 districts. As such, all of the uses 23 permitted in the C-1 through C-3 districts are also permitted in the C-4 district. The outside 24 storage of merchandise and equipment is prohibited, except to the extent that it is 25 associated with the commercial activity conducted on-site such as, but not limited to, 26 automobile sales, marine vessels, and the renting and leasing of equipment. Activity 27 centers are suitable locations for the uses permitted by the C-4 district because most 28 activity centers are located at the intersection of arterial roads. Therefore, the uses in the 29 C-4 district can most be sustained by the transportation network of major roads. The C-4 30 district is permitted in accordance with the locational criteria for uses and the goals, 31 objectives, and policies as identified in the future land use element of the Collier County 32 GMP. The maximum density permissible or permitted in a district shall not exceed the 33 density permissible under the density rating system. 34 35 1. The following uses, as defined with a number from the Standard Industrial 36 Classification Manual (1987), or as otherwise provided for within this section are 37 permissible by right, or as accessory or conditional uses within the general 38 commercial district (C-4). 39 40 a. Permitted uses. 41 * * * * * * * * * * * * * 42 26. Business services - miscellaneous (7381, 7389 - except 43 auctioneering service, automobile recovery, automobile 44 repossession, batik work, bottle exchanges, bronzing, cloth cutting, 45 contractors' disbursement, cosmetic kits, cotton inspection, cotton 46 sampler, directories-telephone, drive-away automobile, exhibits-47 building, filling pressure containers, field warehousing, fire 48 extinguisher, floats-decoration, folding and refolding, gas systems, 49 bottle labeling, liquidation services, metal slitting and shearing, 50 packaging and labeling, patrol of electric transmission or gas lines, 51 9.A.7.a Packet Pg. 1757 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 11 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx pipeline or powerline inspection, press clipping service, recording 1 studios, repossession service, rug binding, salvaging of damaged 2 merchandise, scrap steel cutting and slitting, shrinking textiles, 3 solvent recovery, sponging textiles, swimming pool cleaning, tape 4 slitting, texture textile designers, textile folding, tobacco sheeting, 5 and window trimming service). 6 * * * * * * * * * * * * * 7 64. Group care facilities (category I and II, except for homeless 8 shelters); care units, except for homeless shelters; nursing homes; 9 assisted living facilities pursuant to § 400.402 429.02 F.S. and ch. 10 58A-5 59A-36 F.A.C.; and continuing care retirement communities 11 pursuant to § ch. 651 F.S. and ch. 4-193 69O-193 F.A.C.; all subject 12 to LDC section 5.05.04. 13 * * * * * * * * * * * * * 14 E. Heavy Commercial District (C-5). In addition to the uses provided in the C-4 zoning district, the 15 heavy commercial district (C-5) allows a range of more intensive commercial uses and services 16 which are generally those uses that tend to utilize outdoor spac e in the conduct of the business. 17 The C-5 district permits heavy commercial services such as full-service automotive repair, and 18 establishments primarily engaged in construction and specialized trade activities such as contractor 19 offices, plumbing, heating and air conditioning services, and similar uses that typically have a need 20 to store construction associated equipment and supplies within an enclosed structure or have 21 showrooms displaying the building material for which they specialize. Outdoor storage y ards are 22 permitted with the requirement that such yards are completely enclosed or opaquely screened. The 23 C-5 district is permitted in accordance with the locational criteria for uses and the goals, objectives, 24 and policies as identified in the future land use element of the Collier County GMP. 25 26 1. The following uses, as identified with a number from the Standard Industrial 27 Classification Manual (1987), or as otherwise provided for within this section are 28 permissible by right, or as accessory or conditional uses within the heavy 29 commercial district (C-5). 30 31 a. Permitted uses. 32 * * * * * * * * * * * * * 33 76. Group care facilities (category I and II, except for homeless 34 shelters); care units, except for homeless shelters; nursing homes; 35 assisted living facilities pursuant to § 400.402 429.02 F.S. and ch. 36 58A-5 59A-36 F.A.C.; and continuing care retirement communities 37 pursuant to § ch. 651 F.S. and ch. 4-193 69O-193 F.A.C.; all subject 38 to LDC section 5.05.04. 39 * * * * * * * * * * * * * 40 # # # # # # # # # # # # # 41 42 2.03.05 - Civic and Institutional Zoning Districts 43 44 * * * * * * * * * * * * * 45 B. Community Facility District (CF). The purpose and intent of (CF) district is to implement 46 the GMP by permitting nonresidential land uses as generally identified in the urban 47 designation of the future land use element. These uses can be characterized as public 48 facilities, institutional uses, open space uses, recreational uses, water-related or 49 dependent uses, and other such uses generally serving the community at large. The 50 dimensional standards are intended to insure compatibility with existing or future nearby 51 9.A.7.a Packet Pg. 1758 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 12 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx residential development. The CF district is limited to properties within the urban mixed use 1 land use designation as identified on the future land use map. 1. 2 3 1. The following uses are permitted as of right, or as accessory or conditional uses, 4 in the community facility district (CF). 5 6 a. Permitted uses. 7 * * * * * * * * * * * * * 8 5. Nursing homes, assisted living facilities (ALF) pursuant to § 9 400.402 429.02 F.S. and ch. 58A-5 59A-36., family care facilities, 10 group care facilities (category I) and continuing care retirement 11 communities pursuant to § ch. 651 F.S. and ch. 4-193 69O-193 12 F.A.C.; all subject to LDC section 5.05.04. 13 * * * * * * * * * * * * * 14 # # # # # # # # # # # # # 15 16 2.03.07 - Overlay Zoning Districts 17 18 * * * * * * * * * * * * * 19 H. Santa Barbara Commercial Overlay District (SBCO). Special conditions for properties 20 abutting the east side of Santa Barbara Boulevard and the west side of 55th Terrace 21 S.W., as referenced in the Santa Barbara Commercial Subdistrict Map (Map 7) of the 22 Golden Gate Area Master Plan. This is referenced as figure 2.03.07 H. below. 23 * * * * * * * * * * * * * 24 6. The following uses, as identified within the latest edition of the Standard Industrial 25 Classification Manual, or as otherwise provided for within this section, are 26 permitted as of right, or as uses accessory to permitted primary or secondary 27 uses, or are conditional uses within the Santa Barbara Commercial Overlay 28 District. 29 30 a. Permitted uses. 31 * * * * * * * * * * * * * 32 39. Group care facilities (category I and II, except for homeless 33 shelters); care units , except for homeless shelters; nursing 34 homes; assisted living facilities pursuant to § 400.402 429.02 F.S. 35 and ch. 58A-5 59A-36 F.A.C.; and continuing care retirement 36 communities pursuant to F.S. § 651 and ch. 4-193 ch. 651 F.S. 37 and ch. 69O-193 F.A.C.; all subject to LDC section 5.05.04. 38 * * * * * * * * * * * * * 39 # # # # # # # # # # # # # 40 41 2.03.08 - Rural Fringe Zoning Districts 42 43 A. Rural Fringe Mixed-Use District (RFMU District). 44 * * * * * * * * * * * * 45 2. RFMU receiving lands. RFMU receiving lands are those lands within the RFMU 46 district that have been identified as being most appropriate for development and 47 to which residential develop ment units may be transferred from RFMU sending 48 lands. Based on the evaluation of available data, RFMU receiving lands have a 49 lesser degree of environmental or listed species habitat value than RFMU 50 sending lands and generally have been disturbed through d evelopment or 51 9.A.7.a Packet Pg. 1759 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 13 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx previous or existing agricultural operations. Various incentives are employed to 1 direct development into RFMU receiving lands and away from RFMU sending 2 lands, thereby maximizing native vegetation and habitat preservation and 3 restoration. Suc h incentives include, but are not limited to: the TDR process; 4 clustered development; density bonus incentives; and, provisions for central 5 sewer and water. Within RFMU receiving lands , the following standards shall 6 apply, except as noted in LDC subsection 2.03.08 A.1. above, or as more 7 specifically provided in an applicable PUD. 8 9 a. Outside rural villages. 10 * * * * * * * * * * * * * 11 (4) Design Standards. 12 * * * * * * * * * * * * * 13 (b) Clustered development: 14 * * * * * * * * * * * * 15 ii. Minimum yard requirements 16 17 a) single-family. Each single-family lot or parcel 18 minimum yard requirement shall be 19 established within an approved PUD, or shall 20 comply with the following standards: 21 * * * * * * * * * * * * * 22 iv) Accessory: Per LDC section 4.02.01 23 4.02.03. 24 25 b) multi-family. For each multi-family lot or 26 parcel minimum yard shall be established 27 within an approved PUD, or shall comply with 28 the following standards: 29 * * * * * * * * * * * * 30 v) Accessory: LDC section 4.02.01 31 4.02.03. 32 * * * * * * * * * * * * * 33 # # # # # # # # # # # # # 34 35 4.02.06 - Standards for Development within the Airport Overlay (APO) 36 37 * * * * * * * * * * * * * 38 L. Other areas. In addition to the height limitations imposed in LDC sections 4.02.06 (C)-(K) 39 above, no structure or obstruction will be permitted within Collier County that would cause 40 a minimum obstruction clearance altitude (MOCA), a minimum descent altitude (MDA), 41 decision height (DH), or a minimum vectoring altitude (MVA) to be raised nor which would 42 impose either the establishment of restrictive minimum climb gradients or nonstandard 43 takeoff minimums. 44 * * * * * * * * * * * * * 45 2. Except as otherwise provided in this section of the LDC, no structure, or object of 46 natural growth shall be erected, altered, allowed to grow or be maintained, which 47 is or would result in a potential hazard to air navigation within Collier County by 48 exceeding any of the following: 49 50 9.A.7.a Packet Pg. 1760 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 14 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx a. A height of 500 499 feet above ground level at the site of the object. 1 * * * * * * * * * * * * * 2 # # # # # # # # # # # # # 3 4 10.02.03 - Requirements for Site Development, Site Improvement Plans and Amendments 5 thereof 6 7 * * * * * * * * * * * * * 8 F. Site plan with deviations for redevelopment projects. 9 * * * * * * * * * * * * * 10 5. Public notice. Public notice of the hearing shall be as required by the LDC section 11 10.03.06 Q R and Chapter 6 of the Administrative Code. 12 * * * * * * * * * * * * * 13 # # # # # # # # # # # # # 14 15 10.02.05 - Construction, Approval, and Acceptance of Required Improvements 16 17 * * * * * * * * * * * * * 18 B. Preliminary Acceptance of Required Subdivision Improvements by the County Engineer 19 or designee. Preliminary acceptance by the County Engineer or designee shall identify 20 that the subdivision or development is substantially safe for public occupancy. 21 * * * * * * * * * * * * * 22 2. Submittal requirements. Upon completion of all required improvements contained 23 in the approved construction plans, the applicant's professional engineer of record 24 shall provide the following materials for the review by the County Engineer or 25 designee: 26 27 a. Competition Completion Certificate. The applicant's professional engineer 28 of record shall submit a completion certificate for the required 29 improvements completed. The completion certificate shall be based on 30 information provided by the project professional surveyor and mapper and 31 the engineer's own observations. The completion certificate shall not be 32 based on "information provided by the contractor. "The applicant's 33 professional engineer of record shall document that the required 34 improvements have been installed in compliance with the approved 35 construction plans. Any discrepancy shall be brought to the attention of the 36 County Engineer or designee and resolved to the satisfaction of the County 37 Engineer or designee. 38 * * * * * * * * * * * * * 39 # # # # # # # # # # # # # 40 41 10.02.13 - Planned Unit Development (PUD) Procedures 42 43 * * * * * * * * * * * * * 44 I. Applicability. All applications for either a PUD rezoning or an amendment to an existing 45 PUD document or PUD master plan submitted after January 8, 2003, shall comply with 46 the amended procedures set forth in LDC section 2.02.12 10.02.13 of this Code. All PUDs 47 existing and future, shall comply with the sunset provisions established pursuant to LDC 48 section 2.02.12 10.02.13 D. of this Code. 49 * * * * * * * * * * * * * 50 # # # # # # # # # # # # # 51 9.A.7.a Packet Pg. 1761 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 15 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx 1 APPENDIX A- STANDARD PERFORMANCE SECURITY DOCUMENTS FOR REQUIRED 2 IMPROVEMENTS 3 4 The following specimen forms are to be used as a guide for preparation of bonding 5 instruments which will be submitted to the Collier County Board of County Commissioners for 6 guaranteeing the completion of required improvements with respect to this Code. Adherence to 7 the forms will assure an expeditious review by the Development Services Division and the 8 Collier County Attorney's Office. Deviation in substance or form from the suggested specimen 9 forms may result in a substantial delay or disapproval of the bonding provisions for Required 10 Improvements by the Development Services Division or the County Attorney's Office. These 11 specimen forms may be revised from time to time by resolution of the Board of County 12 Commissioners. 13 14 Appendix A consists of the following specimen forms: 15 * * * * * * * * * * * * * 16 A.1. Subdivision Improvements 17 * * * * * * * * * * * * * 18 b. The Performance Bond shall be substantially as follows: 19 * * * * * * * * * * * * 20 IN WITNESS WHEREOF, the parties hereto have caused this PERFORMANCE BOND 21 to be executed this ___ day of ________. 22 WITNESSES: (Owner Name and Title if Corporation) By:___________ _____ _____ Printed Name Printed Name/Title (Provide Proper Evidence of Authority) _____ Printed Name 23 ACKNOWLEDGEMENT 24 STATE OF ___________ 25 COUNTY OF ___________ 26 THE FOREGOING PERFORMANCE BOND WAS ACKNOWLEDGED BEFORE ME THIS DAY______ 27 OF ________, 20___, BY (NAME OF ACKNOWLEDGER) AS (TITLE) OF (NAME OF COMPANY) WHO 28 IS PERSONALLY KNOWN TO ME, OR HAS PRODUCED ___________ AS IDENTIFICATION. 29 Notary Public - State of ___________ 30 (SEAL) 31 ___________ 32 Printed Name 33 34 Notarial Acknowledgement 35 Per Requirements of § 117.05, Florida Statutes 36 37 9.A.7.a Packet Pg. 1762 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 16 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx STATE OF [state]__ _ 1 COUNTY OF [county]___ 2 3 The foregoing instrument was acknowledged before me by means of ☐ physical presence or ☐ 4 online notarization, this day of [year] , by [name of person] as [type of authority, e.g. 5 president or vice president] for [legal name of entity] , who ☐ is personally known or ☐ 6 has produced [type of identification] as identification. 7 8 [signature of Notary Public] _ 9 10 [the notary public’s official seal] 11 12 [printed name of Notary Public] 13 14 WITNESSES: (Surety Name and Title if Corporation) _____ By: _____ Printed Name Printed Name/Title (Provide Proper Evidence of Authority) _____ Printed Name 15 ACKNOWLEDGEMENT 16 STATE OF ___________ 17 COUNTY OF ___________ 18 THE FOREGOING PERFORMANCE BOND WAS ACKNOWLEDGED BEFORE ME THIS DAY 19 ______OF ________, 20___, BY (NAME OF ACKNOWLEDGER) AS (TITLE) OF (NAME OF 20 COMPANY) WHO IS PERSONALLY KNOWN TO ME, OR HAS PRODUCED ___________ AS 21 IDENTIFICATION. 22 Notary Public - State of ___________ 23 (SEAL) 24 ___________ 25 Printed Name 26 Notarial Acknowledgement 27 Per Requirements of § 117.05, Florida Statutes 28 29 STATE OF [state]__ _ 30 COUNTY OF [county]___ 31 32 The foregoing instrument was acknowledged before me by means of ☐ physical presence or ☐ 33 online notarization, this day of [year] , by [name of person] as [type of authority, e.g. 34 president or vice president] for [legal name of entity] , who ☐ is personally known or ☐ 35 has produced [type of identification] as identification. 36 37 [signature of Notary Public] _ 38 39 9.A.7.a Packet Pg. 1763 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 17 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx [the notary public’s official seal] 1 2 [printed name of Notary Public] 3 * * * * * * * * * * * * * 4 A.2. Excavation Improvements 5 * * * * * * * * * * * * * 6 b. The Performance Bond for Excavation Work shall be substantially as follows: 7 * * * * * * * * * * 8 IN WITNESS WHEREOF, the parties hereto have caused this PERFORMANCE BOND to be 9 executed this ______ day of ____________, 20____. 10 WITNESSES: (Owner Name and Title if Corporation) _____ By: _____ Printed Name Printed Name/Title (Provide Proper Evidence of Authority) _____ Printed Name 11 ACKNOWLEDGEMENT 12 STATE OF ___________ 13 COUNTY OF ___________ 14 THE FOREGOING PERFORMANCE BOND WAS ACKNOWLEDGED BEFORE ME THIS DAY______ 15 OF ________, 20___, BY (NAME OF ACKNOWLEDGER) AS (TITLE) OF (NAME OF COMPANY) WHO 16 IS PERSONALLY KNOWN TO ME, OR HAS PRODUCED ___________ AS IDENTIFICATION. 17 Notary Public - State of ___________ 18 (SEAL) 19 ___________ 20 Printed Name 21 Notarial Acknowledgement 22 Per Requirements of § 117.05, Florida Statutes 23 24 STATE OF [state]__ _ 25 COUNTY OF [county]___ 26 27 The foregoing instrument was acknowledged before me by means of ☐ physical presence or ☐ 28 online notarization, this day of [year] , by [name of person] as [type of authority, e.g. 29 president or vice president] for [legal name of entity] , who ☐ is personally known or ☐ 30 has produced [type of identification] as identification. 31 32 [signature of Notary Public] _ 33 34 [the notary public’s official seal] 35 36 [printed name of Notary Public] 37 38 9.A.7.a Packet Pg. 1764 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 18 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx WITNESSES: (Owner Name and Title if Corporation) _____ By: _____ Printed Name Printed Name/Title (Provide Proper Evidence of Authority) _____ Printed Name 1 ACKNOWLEDGEMENT 2 STATE OF ___________ 3 COUNTY OF ___________ 4 THE FOREGOING PERFORMANCE BOND WAS ACKNOWLEDGED BEFORE ME THIS _____ DAY 5 OF ________, 20___, BY (NAME OF ACKNOWLEDGER) AS (TITLE) OF (NAME OF COMPANY) WHO 6 IS PERSONALLY KNOWN TO ME, OR HAS PRODUCED ___________ AS IDENTIFICATION. 7 Notary Public - State of ___________ 8 (SEAL) 9 ___________ 10 Printed Name 11 Notarial Acknowledgement 12 Per Requirements of § 117.05, Florida Statutes 13 14 STATE OF [state]__ _ 15 COUNTY OF [county]___ 16 17 The foregoing instrument was acknowledged before me by means of ☐ physical presence or ☐ 18 online notarization, this day of [year] , by [name of person] as [type of authority, e.g. 19 president or vice president] for [legal name of entity] , who ☐ is personally known or ☐ 20 has produced [type of identification] as identification. 21 22 [signature of Notary Public] _ 23 24 [the notary public’s official seal] 25 26 [printed name of Notary Public] 27 * * * * * * * * * * * * * 28 A.3. Early Work Improvements 29 * * * * * * * * * * * * * 30 b. The Performance Bond for Early Work shall be substantially as follows: 31 * * * * * * * * * * * * 32 IN WITNESS WHEREOF, the parties hereto have caused this PERFORMANCE BOND to be 33 executed this _____ day of ____________, 20____. 34 WITNESSES: (Owner Name and Title if Corporation) _____ By:___________ 9.A.7.a Packet Pg. 1765 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 19 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx Printed Name Printed Name/Title (Provide Proper Evidence of Authority) _____ Printed Name 1 ACKNOWLEDGEMENT 2 STATE OF ___________ 3 COUNTY OF ___________ 4 THE FOREGOING PERFORMANCE BOND WAS ACKNOWLEDGED BEFORE ME THIS______DAY 5 OF ________, 20___, BY (NAME OF ACKNOWLEDGER) AS (TITLE) OF (NAME OF COMPANY) WHO 6 IS PERSONALLY KNOWN TO ME, OR HAS PRODUCED ___________ AS IDENTIFICATION. 7 Notary Public - State of ___________ 8 (SEAL) 9 ___________ 10 Printed Name 11 Notarial Acknowledgement 12 Per Requirements of § 117.05, Florida Statutes 13 14 STATE OF [state]__ _ 15 COUNTY OF [county]___ 16 17 The foregoing instrument was acknowledged before me by means of ☐ physical presence or ☐ 18 online notarization, this day of [year] , by [name of person] as [type of authority, e.g. 19 president or vice president] for [legal name of entity] , who ☐ is personally known or ☐ 20 has produced [type of identification] as identification. 21 22 [signature of Notary Public] _ 23 24 [the notary public’s official seal] 25 26 [printed name of Notary Public] 27 WITNESSES: (Owner Name and Title if Corporation) _____ By: _____ Printed Name Printed Name/Title (Provide Proper Evidence of Authority) _____ Printed Name 28 ACKNOWLEDGEMENT 29 STATE OF ___________ 30 COUNTY OF ___________ 31 9.A.7.a Packet Pg. 1766 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 20 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx THE FOREGOING PERFORMANCE BOND WAS ACKNOWLEDGED BEFORE ME THIS ______DAY 1 OF ________, 20___, BY (NAME OF ACKNOWLEDGER) AS (TITLE) OF (NAME OF COMPANY) WHO 2 IS PERSONALLY KNOWN TO ME, OR HAS PRODUCED ___________ AS IDENTIFICATION. 3 Notary Public - State of ___________ 4 (SEAL) 5 ___________ 6 Printed Name 7 Notarial Acknowledgement 8 Per Requirements of § 117.05, Florida Statutes 9 10 STATE OF [state]__ _ 11 COUNTY OF [county]___ 12 13 The foregoing instrument was acknowledged before me by means of ☐ physical presence or ☐ 14 online notarization, this day of [year] , by [name of person] as [type of authority, e.g. 15 president or vice president] for [legal name of entity] , who ☐ is personally known or ☐ 16 has produced [type of identification] as identification. 17 18 [signature of Notary Public] _ 19 20 [the notary public’s official seal] 21 22 [printed name of Notary Public] 23 * * * * * * * * * * * * * 24 A.4. Site Development Plan Improvements 25 * * * * * * * * * * * * * 26 b. The Performance Bond for Site Development Plans shall be substantially as 27 follows: 28 * * * * * * * * * * * * 29 IN WITNESS WHEREOF, the parties hereto have caused this PERFORMANCE BOND to be 30 executed this _____ day of ____________, 20____. 31 WITNESSES: (Owner Name and Title if Corporation) By:___________ _____ Printed Name Printed Name/Title (Provide Proper Evidence of Authority) _____ Printed Name 32 ACKNOWLEDGEMENT 33 STATE OF ___________ 34 COUNTY OF ___________ 35 9.A.7.a Packet Pg. 1767 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 21 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx THE FOREGOING PERFORMANCE BOND WAS ACKNOWLEDGED BEFORE ME THIS ______DAY 1 OF ________, 20___, BY (NAME OF ACKNOWLEDGER) AS (TITLE) OF (NAME OF COMPANY) WHO 2 IS PERSONALLY KNOWN TO ME, OR HAS PRODUCED ___________ AS IDENTIFICATION. 3 Notary Public - State of ___________ 4 (SEAL) 5 ___________ 6 Printed Name 7 Notarial Acknowledgement 8 Per Requirements of § 117.05, Florida Statutes 9 10 STATE OF [state]__ _ 11 COUNTY OF [county]___ 12 13 The foregoing instrument was acknowledged before me by means of ☐ physical presence or ☐ 14 online notarization, this day of [year] , by [name of person] as [type of authority, e.g. 15 president or vice president] for [legal name of entity] , who ☐ is personally known or ☐ 16 has produced [type of identification] as identification. 17 18 [signature of Notary Public] _ 19 20 [the notary public’s official seal] 21 22 [printed name of Notary Public] 23 WITNESSES: (Owner Name and Title if Corporation) _____ By: _____ Printed Name Printed Name/Title (Provide Proper Evidence of Authority) _____ Printed Name 24 ACKNOWLEDGEMENT 25 STATE OF ___________ 26 COUNTY OF ___________ 27 THE FOREGOING PERFORMANCE BOND WAS ACKNOWLEDGED BEFORE ME THIS ______DAY 28 OF ________, 20___, BY (NAME OF ACKNOWLEDGER) AS (TITLE) OF (NAME OF COMPANY) WHO 29 IS PERSONALLY KNOWN TO ME, OR HAS PRODUCED ___________ AS IDENTIFICATION. 30 Notary Public - State of ___________ 31 (SEAL) 32 ___________ 33 Printed Name 34 Notarial Acknowledgement 35 Per Requirements of § 117.05, Florida Statutes 36 37 STATE OF [state]__ _ 38 COUNTY OF [county]___ 39 40 9.A.7.a Packet Pg. 1768 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 22 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx The foregoing instrument was acknowledged before me by means of ☐ physical presence or ☐ 1 online notarization, this day of [year] , by [name of person] as [type of authority, e.g. 2 president or vice president] for [legal name of entity] , who ☐ is personally known or ☐ 3 has produced [type of identification] as identification. 4 5 [signature of Notary Public] _ 6 7 [the notary public’s official seal] 8 9 [printed name of Notary Public] 10 * * * * * * * * * * * * * 11 # # # # # # # # # # # # 12 9.A.7.a Packet Pg. 1769 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) EXHIBIT A 23 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx F.S. and F.A.C. Correction Table 1 2 LDC Section or Zoning District- Term/Use Prior Citation Updated Citation LDC 1.08.02 Definitions: Assisted Living Facility 400.407 F.S. 400.62 F.S. Family Care Facility 10A-5019 F.A.C. 59A-36.00 F.A.C. LDC Zoning Districts: A, E, RSF-1 through 6, RMF-6, RMF-12, RMF-16, RT, VR, C-1 through C-5, CF and the Overlay Zoning District for SBCO. Assisted Living Facility 400.402 F.S. 429.02 F.S. 58A-5 F.A.C. 59A-36 F.A.C. Continuing Care Facilities 4-193 F.A.C. 69O-193 F.A.C. 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 9.A.7.a Packet Pg. 1770 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) EXHIBIT B 24 L:\LDC Amendments\Current Work\2020 Scriver's Errors and Cross References (PL20200001602)\Drafts\2020 Scrivener Errors and Cross References 11-05-20 CCPC.docx Federal Aviation Administration DOT: 14 CFR Part 77, Subpart C § 77.17 1 2 9.A.7.a Packet Pg. 1771 Attachment: 2020 Scrivener Errors and Cross References 11-05-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) 1 L:\LDC Amendments\Advisory Boards and Public Hearings\CCPC\2020\Nov 19\5.05.12 Public Utility Ancillary Systems in Collier County 11- 09-20 CCPC.docx LAND DEVELOPMENT CODE AMENDMENT PETITION PL20200001627 SUMMARY OF AMENDMENT This amendment modifies the setback requirements for fences and walls enclosing Public Utility Ancillary System (PUAS) facilities. LDC SECTION TO BE AMENDED 5.05.12 Specific Standards for Public Utility Ancillary Systems in Collier County ORIGIN Public Utilities Department HEARING DATES BCC TBD CCPC 11-19-20 DSAC 10-07-20 DSAC-LDR 09-15-20 ADVISORY BOARD RECOMMENDATIONS DSAC-LDR Approval DSAC Approval CCPC TBD BACKGROUND The Land Development Code (LDC) defines Public Utility Ancillary Systems as “The individual or collective appurtenant equipment and structures owned or operated by a public or quasi-public entity which are integral to treatment facilities that provide raw water, potable water, irrigation quality (IQ) water and wastewater services.” Older PUAS locations are often constrained in size and cannot accommodate new equipment and site requirements within a fence or wall enclosure that maintains minimum setback requirements. Additionally, the current maximum fence and wall height is frequently insufficient to screen equipment. This amendment removes the minimum height and increases the maximum height to ten feet for a fence or wall, maintains the existing setback of five feet from adjacent property and right-of-way lines for a fence or wall enclosing a new PUAS facility, and exempts a fence or wall enclosing an existing PUAS facility installed prior to a certain effective date or installed within a utility easement existing prior to that date from the five-foot minimum setback. Fences and walls enclosing raw water wells and appurtenant equipment are subject to the effective date of Ordinance 05-27, and all other PUAS facilities are subject to the effective date of Ordinance 08-63. These effective dates were implemented pursuant to the request of the Growth Management Department subsequent to DSAC’s recommendation of approval at their meeting on October 7, 2020. This change was disclosed to DSAC during the staff report portion of their meeting on November 4, 2020, without objection. Exhibit A shows examples of existing pump stations where a five-foot minimum setback would preclude construction of a wall or fence within the existing easement. The amendment also relocates the fence and wall height standard out of the setback requirement subsection LDC 5.05.12 B.3 to a new LDC section 5.05.12 C and enumerates the remaining sections. Lastly, a cross reference to LDC section 10.02.03 has been added to clarify when a site development plan or site improvement plan requires an insubstantial change. 9.A.7.b Packet Pg. 1772 Attachment: 5.05.12 Public Utility Ancillary Systems in Collier County 11-09-20 CCPC [Revision 2] (14071 : 5:05 pm Batch LDC Amendments #2) 2 L:\LDC Amendments\Advisory Boards and Public Hearings\CCPC\2020\Nov 19\5.05.12 Public Utility Ancillary Systems in Collier County 11- 09-20 CCPC.docx FISCAL & OPERATIONAL IMPACTS There are no anticipated fiscal or operational impacts associated with this amendment. GMP CONSISTENCY To be provided by Comprehensive Planning Staff. EXHIBITS: A) Pump Stations 316.01 and 317.01 9.A.7.b Packet Pg. 1773 Attachment: 5.05.12 Public Utility Ancillary Systems in Collier County 11-09-20 CCPC [Revision 2] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 3 L:\LDC Amendments\Advisory Boards and Public Hearings\CCPC\2020\Nov 19\5.05.12 Public Utility Ancillary Systems in Collier County 11-09-20 CCPC.docx Amend the LDC as follows: 1 5.05.12 – Specific Standards for Public Utility Ancillary Systems in Collier County. 2 3 A. Applicability. When water and wastewater is conveyed through physically connected 4 infrastructure to or from a public or quasi-public treatment facility, the system of physically 5 interconnected infrastructure, including but not limited to raw water wells, pump stations, 6 water and wastewater storage tanks, vaults, valves, antennas, and other appurtenant 7 equipment, shall be considered to be collectively located onsite as that term is to be 8 applied in the GMP CCME Policies 6.1.1 and 6.1.2, and any implementing land 9 development regulations. Applicable designs for public utility ancillary systems selected 10 from the Collier County Utility Standards Manual shall be submitted for appropriate County 11 staff review of the following requirements. 12 13 B. Setback Requirements 14 15 * * * * * * * * * * * * * 16 17 3. Fences and walls enclosing public utility ancillary systems must meet the following 18 setbacks: , other than raw water wells and appurtenant equipment, installed after 19 November 12, 2008, shall be setback five feet from adjacent property and right-of-20 way lines. However, for those public utility ancillary systems installed on or before 21 November 12, 2008 or installed in utility easements existing on or before 22 November 12, 2008, there shall be no minimum setback for fences and walls. 23 24 In the case of raw water wells and appurtenant equipment installed after June 16, 25 2005, the setback shall be five feet from adjacent property and right-of-way lines, 26 except where installed in easements existing on or before June 16, 2005, in 27 which case, there shall be no minimum setback for fences and walls. 28 29 30 Adjacent to Right-of-Way or easement line - 5 feet. 31 32 Side yard or easement line - 5 feet. 33 34 Appurtenant equipment, other than antennas, that exceeds the height of the fence 35 or wall, shall be setback no less than the underlying zoning district's requirements 36 for side yard setback. 37 38 Rear yard or easement line - 5 feet. 39 40 Raw water well easements contained within a larger public easement - 2 feet. 41 42 Fence or wall heights may be between six (6) feet and eight (8) feet in height. 43 44 Appurtenant equipment shall not be considered as separate structures. 45 46 C. Fences and walls enclosing public utility ancillary systems shall not exceed ten feet in 47 height unless an administrative fence waiver is approved in accordance with the LDC 48 section 5.03.02. 49 50 9.A.7.b Packet Pg. 1774 Attachment: 5.05.12 Public Utility Ancillary Systems in Collier County 11-09-20 CCPC [Revision 2] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT 4 L:\LDC Amendments\Advisory Boards and Public Hearings\CCPC\2020\Nov 19\5.05.12 Public Utility Ancillary Systems in Collier County 11-09-20 CCPC.docx CD. Public utility ancillary system site access: 1 2 1. Direct access from public ways shall be limited to one (1) access point and must 3 otherwise comply with the requirements of LDC Ssection 4.04.02 4 5 2 Access from an easement must provide legal access to a public or approved 6 private way. Access from an existing public way to an easement must otherwise 7 comply with the requirements of LDC Ssection 4.04.02. 8 9 DE. Prior to County approval of any public utility ancillary system site under this Code, the 10 applicant shall obtain permits from SFWMD, FDEP or other state or federal agency having 11 jurisdiction over the intended use if such permits are required. 12 13 EF. Stormwater management and environmental resource permits for public utility ancillary 14 system sites shall be governed by the requirements of SFWMD or FDEP, and if approval 15 is granted for the public utility ancillary system by SFWMD or FDEP under those 16 requirements, or said requirements are deemed not applicable by SFWMD or FDEP due 17 to the de minimus size or nature of the public utility ancillary system site as verified in 18 writing by SFWMD or FDEP, the project may be considered for a waiver from the 19 requirements of LDC Ssection 10.02.02 A. 20 21 FG. Landscaping and buffering shall conform to the requirements of LDC Ssection 4.06.05 B. 22 4 23 24 GH. Site planning review and approval for public utility ancillary systems must follow the 25 requirements of an insubstantial change to a Site Development Plan or Site Improvement 26 Plan review process as required in LDC section 10.02.03, providing water, wastewater or 27 irrigation quality water from such public utility ancillary system is conveyed through 28 physically connected infrastructure to a public or quasi-public treatment facility. The 29 system of physically inter-connected infrastructure and wells may be considered to be 30 collectively located "on-site". 31 # # # # # # # # # # # # # 32 9.A.7.b Packet Pg. 1775 Attachment: 5.05.12 Public Utility Ancillary Systems in Collier County 11-09-20 CCPC [Revision 2] (14071 : 5:05 pm Batch LDC Amendments #2) Exhibit A- Pump Stations 101.16 and 305.17 5 L:\LDC Amendments\Advisory Boards and Public Hearings\CCPC\2020\Nov 19\5.05.12 Public Utility Ancillary Systems in Collier County 11-09-20 CCPC.docx 1 9.A.7.b Packet Pg. 1776 Attachment: 5.05.12 Public Utility Ancillary Systems in Collier County 11-09-20 CCPC [Revision 2] (14071 : 5:05 pm Batch LDC Amendments #2) Exhibit A- Pump Stations 101.16 and 305.17 6 L:\LDC Amendments\Advisory Boards and Public Hearings\CCPC\2020\Nov 19\5.05.12 Public Utility Ancillary Systems in Collier County 11-09-20 CCPC.docx 1 9.A.7.b Packet Pg. 1777 Attachment: 5.05.12 Public Utility Ancillary Systems in Collier County 11-09-20 CCPC [Revision 2] (14071 : 5:05 pm Batch LDC Amendments #2) 1 L:\LDC Amendments\Current Work\Community Housing Plan Implementation\Initiative 1 - Regulatory Relief\LDC 4.02.39 Design Deviations for Housing that is Affordable 10-28-20 (submittal 2-rev2).docx LAND DEVELOPMENT CODE AMENDMENT PETITION PL20200001703 SUMMARY OF AMENDMENT This amendment proposes relief from certain design standards for Housing that is Affordable pursuant to the Community Housing Plan recommendations. LDC SECTION TO BE AMENDED ORIGIN Community and Human Services Division HEARING DATES BCC CCPC DSAC DSAC-LDR TBD 11/19/2020 10/07/2020 09/15/2020 2.03.02 4.02.04 4.02.39 Residential Zoning Districts Standards for Cluster Residential Design Design Deviations for Housing that is Affordable (New Section) ADVISORY BOARD RECOMMENDATIONS DSAC-LDR Approval with changes DSAC Approval CCPC TBD BACKGROUND At the October 9, 2018 Board of County Commissioners meeting the Board provided direction upon the final recommendations of the Collier County Housing Plan. As part of that review, the Board directed staff to prepare Growth Management Plan (GMP) and Land Development Code (LDC) amendments on five specific initiatives identified within the Housing Plan: 1. Regulatory relief for affordable housing applications 2. Streamline commercial to residential conversions 3. Incentivize mixed income residential housing in future and redeveloped Activity Centers 4. Create a Strategic Opportunity Sites designation process and allow for increased density 5. Increase density along transit corridors The first Initiative, regulatory relief for affordable housing applications, seeks to evaluate cost saving measures identified in the Collier Housing Plan to provide for relief from specified processes and standards to increase certainty and cost savings for projects that include housing that is affordable. In addition to the areas identified within the Housing Plan, the Housing team in coordination with a development industry stakeholder’s group worked to identified and recommended other areas of potential cost savings relief for housing that is affordable. The approach tries to ensure t hat the quality of the project does not suffer from a functional or aesthetic standpoint, while allowing the overall cost of each unit in the project to be reduced, and therefore increasing the potential for future projects to increase the supply of housing that is affordable. The changes introduced with this initiative relate to the cost savings in terms of materials required and standards imposed on projects that provide for housing that is affordable , as well as the process for approval for cluster housing that is affordable project. As noted, the Community Housing Plan identified a number of areas to be included for cost savings such as: limiting the number of County reviews for various disciplines, removing the requirement for a generator as a lift station, and only requiring 9.A.7.c Packet Pg. 1778 Attachment: LDC 4.02.39 Design Deviations for Housing that is Affordable 10-28-20 (submittal 2-rev2) (14071 : 5:05 pm Batch LDC Amendments 2 L:\LDC Amendments\Current Work\Community Housing Plan Implementation\Initiative 1 - Regulatory Relief\LDC 4.02.39 Design Deviations for Housing that is Affordable 10-28-20 (submittal 2-rev2).docx sidewalks on one side of the street. These and additional areas of cost savings identified as part of a stakeholder think tank held February 21st at the Habitat for Humanity’s Offices formed the basis for the relief being proposed. It should be noted that all the initiatives directed by the Board at the October 8 th, 2018 public hearing could be classified under the premise of regulatory relief, but this initiative focuses upon specific design components that can be identified as areas of relief, as well as certain process within the County review that can be identified as potential cost savings, such as making cluster development that is affordable a permitted use in the RMF-6 zoning district and amending standards for compatibility compliance. The LDC defines cluster development as, “A design technique allowed within residential zoning districts or where residential development is an allowable use. This form of development employs a more compact arrangement of dwelling units by allowing for, or requiring as the case may be, reductions in the standard or typical lot size and yard requirements of the applicable zoning district, in order to: increase common open space; reduce the overall development area; reduce alterations and impacts to natural resources on the site; to preserve additional native vegetati on and habitat areas; and, to reduce the cost of providing services, including but not limited to central sewer and water. The full list of cost savings strategies was scrutinized by the Consultant, Housing Staff and Growth Management Staff to find agreement on the specific relief measures to be incorporated within the proposed LDC amendments contained within Initiative One. DSAC-LDR Subcommittee Recommendation The DSAC-LDR Subcommittee reviewed the amendment on September 15, 2020, and recommended approval with the following changes: • Clarify proposed Section 4.02.39 B.1 regarding storm event design requirements. o These proposed changes have been incorporated in the amendment. • Modify proposed Section 4.02.39 B.2 to require relocation of required trees to street trees or buffer areas, rather than simply exempting the requirement. o This section has been modified to exempt required trees only on lots adjacent to preserve areas or perimeter berms and allowing all other required trees to be relocated to common areas or street tree programs. • Consider changes to proposed Section 4.02.39 B.5 which allowed for the deferral of payment-in- lieu of construction of external sidewalks to address potential issues related to deferral of an assessment to future homeowners. o This provision has been removed from the amendment. FISCAL & OPERATIONAL IMPACTS There are no anticipated fiscal or operational impacts to the County. The amendment relaxes development standards and application requirements for housing that is affordable. The amendment is intended to decrease costs and application review time for developers of housing that is affordable. GMP CONSISTENCY The proposed LDC amendment has been reviewed by Comprehensive Planning staff and may be deemed consistent with the GMP. 9.A.7.c Packet Pg. 1779 Attachment: LDC 4.02.39 Design Deviations for Housing that is Affordable 10-28-20 (submittal 2-rev2) (14071 : 5:05 pm Batch LDC Amendments 3 L:\LDC Amendments\Current Work\Community Housing Plan Implementation\Initiative 1 - Regulatory Relief\LDC 4.02.39 Design Deviations for Housing that is Affordable 10-28-20 (submittal 2-rev2).docx It should be noted that the proposed amendments could result in a slight decrease in SDP review fees collected by the Growth Management Department, as the process for reviewing certain projects are proposed to be condensed, but this reduction in fees corresponds to a decrease in the reviews required by Staff. EXHIBITS: N/A 9.A.7.c Packet Pg. 1780 Attachment: LDC 4.02.39 Design Deviations for Housing that is Affordable 10-28-20 (submittal 2-rev2) (14071 : 5:05 pm Batch LDC Amendments DRAFT Text underlined is new text to be added Text strikethrough is current text to be deleted 4 L:\LDC Amendments\Current Work\Community Housing Plan Implementation\Initiative 1 - Regulatory Relief\LDC 4.02.39 Design Deviations for Housing that is Affordable 10-28-20 (submittal 2-rev2).docx Amend the LDC as follows: 1 2.03.02 - Residential Zoning Districts 2 3 * * * * * * * * * * * * * 4 5 B. Residential Multi-Family-6 District (RMF-6). The purpose and intent of the residential multi-6 family-6 district (RMF-6) is to provide for single-family, two-family and multi-family 7 residences having a low profile silhouette, surrounded by open space , being so situated 8 that it is located in close proximity to public and commercial services and has direct or 9 convenient access to collector and arterial roads on the county major road network. The 10 RMF-6 district corresponds to and implements the urban mixed use land use designation 11 on the future land use map of the Collier County GMP. The maximum density permissible 12 in the RMF-6 district and the urban mixed use land use designation shall be guided, in 13 part, by the density rating system contained in the future land use element of the Collier 14 County GMP. The maximum density permissible or permitted in the RMF-6 district shall 15 not exceed the density permissible under the density rating system, except as permitted 16 by policies contained in the future land use element. 17 18 1. The following subsections identify the uses that are permissible by right and the 19 uses that are allowable as accessory or conditional uses in the RMF-6 district. 20 21 a. Permitted uses. 22 23 1. Single-family dwellings. 24 25 2. Duplexes, two-family dwellings. 26 27 3. Multi-family dwellings, townhouses as provided for in section 28 5.05.07. 29 30 4. Family care facilities, subject to section 5.05.04. 31 32 5. Educational plants and public schools with an agreement with 33 Collier County, as described in LDC section 5.05.14; however, any 34 high school located in this district is subject to a compatibility review 35 as described in LDC section 10.02.03. 36 37 b. Accessory uses. 38 39 1. Uses and structures that are accessory and incidental to uses 40 permitted as of right in the RMF-6 district. 41 42 2. Private docks and boathouses, subject to section 5.03.06. 43 44 3. Recreational facilities that serve as an integral part of a residential 45 development and have been designated, reviewed and approved 46 on a site development plan or preliminary subdivision plat for that 47 development. Recreational facilities may include, but are not limited 48 to, golf course, clubhouse, community center building and tennis 49 facilities, playgrounds and playfields. 50 9.A.7.c Packet Pg. 1781 Attachment: LDC 4.02.39 Design Deviations for Housing that is Affordable 10-28-20 (submittal 2-rev2) (14071 : 5:05 pm Batch LDC Amendments DRAFT Text underlined is new text to be added Text strikethrough is current text to be deleted 5 L:\LDC Amendments\Current Work\Community Housing Plan Implementation\Initiative 1 - Regulatory Relief\LDC 4.02.39 Design Deviations for Housing that is Affordable 10-28-20 (submittal 2-rev2).docx 1 c. Conditional uses. The following uses are permissible as conditional uses 2 in the RMF-6 district, subject to the standards and procedures established 3 in LDC section 10.08.00. 4 5 1. Churches. 6 7 2. Schools, private. Also, "Ancillary Plants" for public schools. 8 9 3. Child care centers and adult day care centers. 10 11 4. Civic and cultural facilities. 12 13 5. Recreational facilities not accessory to principal use. 14 15 6. Group care facilities (category I and II); care units; nursing homes; 16 assisted living facilities pursuant to § 400.402 F.S. and ch. 58A-5 17 F.A.C; and continuing care retirement communities pursuant to § 18 651 F.S. and ch. 4-193 F.A.C.; all subject to section 5.05.04. 19 20 7. Noncommercial boat launch facilities, subject to the applicable 21 review criteria set forth in section 5.03.06. 22 23 8. Cluster development, subject to section 4.02.04, except for 24 affordable housing projects which qualify under Section 4.02.39.C 25 which do not require a conditional use. 26 27 9. Model homes and model sales centers, subject to compliance with 28 all other LDC requirements, to include but not limited to, section 29 5.04.04. 30 31 10. Public schools without an agreement with Collier County, as 32 described in LDC section 5.05.14. Additional standards in LDC 33 section 5.05.14 shall also apply; however, any high school located 34 in this district is subject to a compatibility review as described in 35 LDC section 10.02.03. 36 37 d. Prohibited animals in residential districts. The following animals are to be 38 considered farm animals and are not permitted to be kept in residential 39 districts except as provided for in zoning district regulations: turkeys, 40 chickens, ducks, geese, pigs, horses, cows, goats, hogs, and the like. 41 42 # # # # # # # # # # # # # 43 44 4.02.04 - Standards for Cluster Residential Design 45 46 A. The purpose of a cluster development design technique is to provide a unique and 47 innovative alternative to residential development in the RSF 1 through 6, RMF-6, PUD and 48 VR districts by creating a more varied, efficient, attractive, and economical resident ial 49 development containing a more usable pattern of open space . It is intended to implement 50 9.A.7.c Packet Pg. 1782 Attachment: LDC 4.02.39 Design Deviations for Housing that is Affordable 10-28-20 (submittal 2-rev2) (14071 : 5:05 pm Batch LDC Amendments DRAFT Text underlined is new text to be added Text strikethrough is current text to be deleted 6 L:\LDC Amendments\Current Work\Community Housing Plan Implementation\Initiative 1 - Regulatory Relief\LDC 4.02.39 Design Deviations for Housing that is Affordable 10-28-20 (submittal 2-rev2).docx the (GMP) by, among other things, encouraging compact urban growth, discouraging 1 urban sprawl, and encouraging the conservation of environmental resources. 2 3 B. This section shall apply to all parcels of land under single 4 ownership within the RSF 1 through 6, RMF-6, VR and PUD zoning 5 districts which permit cluster development. See LDC section 6 2.03.08 A.2 for clustering standards in RFMU receiving lands 7 district. 8 9 C. Conditional uses approved for cluster development and single family affordable housing 10 projects in the RMF-6 zoning districts eligible under Section 4.02.39.C. may reduce the lot 11 area, lot width, and yard requirements within a zoning district, subject to the criteria 12 enumerated in this section. The lot area, lot width, coverage, and yard regulations of the 13 residential zoning district in which the cluster development is located shall be used as the 14 basis for all computations of allowed reductions. The following reductions in lot area, lot 15 width, coverage and yard regulations of the underlying zoning district shall be are 16 permissible: pursuant to the grant of a conditional use for cluster development. 17 18 1. The maximum allowable gross density in any cluster development shall not exceed 19 the maximum allowable gross density of the residential zoning district in which the 20 cluster housing development is located. 21 22 2. The following site design and dimensional standards shall apply to cluster 23 development: 24 25 Table 3. Table of Design Standards for Cluster Development. 26 Design Standard Minimum lot area per single-family unit 3,000 sq. ft. Minimum lot width Cul-de-sac lots 20 feet All other lots 40 feet Minimum setbacks Front yard front entry garage side entry garage If no garage 20 feet 10 feet 25 feet Side yards zero lot line on one side no zero lot line 10 feet remaining side 5 feet each side Rear yard principal structure accessory structure 10 feet 3 feet D. Requirements for zero lot line developments: 27 28 9.A.7.c Packet Pg. 1783 Attachment: LDC 4.02.39 Design Deviations for Housing that is Affordable 10-28-20 (submittal 2-rev2) (14071 : 5:05 pm Batch LDC Amendments DRAFT Text underlined is new text to be added Text strikethrough is current text to be deleted 7 L:\LDC Amendments\Current Work\Community Housing Plan Implementation\Initiative 1 - Regulatory Relief\LDC 4.02.39 Design Deviations for Housing that is Affordable 10-28-20 (submittal 2-rev2).docx 1. The zero (0) lot line portion of the dwelling unit shall be void of doors where such 1 wall is contiguous to an adjoining lot line. 2 3 2. Where the nature of the construction of a residence has provided for zero (0) side 4 yard, footings and roof overhang encroachments may be permitted onto the 5 adjoining lot. A roof drainage system shall be put in place to prevent roof drainage 6 from falling onto the abutting property adjacent the walls of the residence with the 7 zero (0) side yard tolerance. Furthermore, provision shall be made for a three (3) 8 foot easement on the abutting property, which shall be recorded running with the 9 land with the residence enjoying the zero (0) lot side yard, for maintenance 10 purposes. 11 12 3. Roof overhangs shall be prohibited over adjacent property lines, unless a recorded 13 restrictive covenant creating the requisite easement interest for encroachment, 14 maintenance, and repair of the building overhang is an element of the project. 15 16 E. Common open space. 17 18 1. All reductions in the minimum lot area, lot width, and yard requirements below that 19 which would otherwise be required within the district in which the cluster 20 development is located shall be required to provide an equal amount of common 21 open space within the same phase and general area of each cluster of homes in 22 the development unless said cluster development is part of a planned unit 23 development where the open space requirements of this LDC have been satisfied. 24 25 2. Common open space shall be reserved for recreational uses. 26 27 3. Any commercial uses recreational facility subject to membership, registration, 28 fees, or aimed at attracting outside users, shall not be counted as common open 29 space. 30 31 4. The sale, lease, or other disposition of common open space shall be prohibited 32 except to a nonprofit corporation or homeowners' association or other similar entity 33 established under the laws of Florida to administer and maintain the facilities 34 subject to a deed restriction acceptable to the County to limit the use of said 35 property to common open space . Provisions shall be included to assure the 36 continued maintenance of the common open space area. 37 38 5. Access rights to common open space for all residents within the cluster housing 39 development shall be guaranteed. 40 41 6. Land utilized for common open space shall be restricted to common open space 42 in perpetuity by appropriate legal instruments satisfactory to Collier County. Such 43 instrument shall be binding upon the owner, developer, his successors, and 44 assigns, and shall constitute a covenant running with the land, and be in recordable 45 form. 46 47 F. Additional reduction to the development standards provided at sections 4.02.04 C.—E. 48 may be approved by the Collier County Planning Commission for projects defined as 49 common architectural theme projects. In determining whether or not a project qualifies as 50 9.A.7.c Packet Pg. 1784 Attachment: LDC 4.02.39 Design Deviations for Housing that is Affordable 10-28-20 (submittal 2-rev2) (14071 : 5:05 pm Batch LDC Amendments DRAFT Text underlined is new text to be added Text strikethrough is current text to be deleted 8 L:\LDC Amendments\Current Work\Community Housing Plan Implementation\Initiative 1 - Regulatory Relief\LDC 4.02.39 Design Deviations for Housing that is Affordable 10-28-20 (submittal 2-rev2).docx a common architectural theme project the BCC shall determine that all of the following 1 design features are incorporated into the project: 2 3 1. The architectural style of the dwelling units/structures shall be similar in design and 4 in the use of materials and color. 5 6 2. The residential project shall have a signature entranceway which serves to identify 7 the development as having a common architectural theme. The entranceway 8 design and improvement elements shall include some or all of the following: the 9 use of landscape materials, gated structure, water features, sculpture, and 10 ornamental pavement surfaces. 11 12 3. Street materials, signage, and lighting shall be complementary and the same 13 throughout the project's accessways. 14 15 # # # # # # # # # # # # # 16 17 4.02.39 – Alternative Design for Housing that is Affordable 18 19 A. The intent of this Section is to provide incentives for housing that is affordable and applies 20 to residential only projects, and residential portions of PUDs. Vertical mixed-use projects 21 are not eligible for the alternative designs identified within this Section. 22 23 B. Affordable housing projects may use the following design alternatives, subject to 24 compliance with Section 4.02.39.C. 25 26 1. Section 3.07.02.E - Local/internal roads that are privately maintained may be 27 designed to the elevation required to meet the 5-year, 1-day storm event, and the 28 perimeter berm shall be designed so that surrounding properties will not be 29 adversely impacted by the project’s influence on stormwater sheet flow up to the 30 elevation during the 25 year, 3-day design storm. 31 32 2. Section 4.06.05.A.1 - Single-family developments lots which are adjacent to 33 preserve areas or perimeter berms are exempt from providing one canopy tree per 34 3,000 square feet of pervious open space per lot. For all other lots, the required 35 one canopy tree may be relocated to common areas or to a street tree program. 36 37 3. Sections 6.06.01.S, 10.02.02.A.11 & Appendix B - For all local/internal roads that 38 are privately owned and maintained, an inverted crown design, shall be allowed. 39 40 9.A.7.c Packet Pg. 1785 Attachment: LDC 4.02.39 Design Deviations for Housing that is Affordable 10-28-20 (submittal 2-rev2) (14071 : 5:05 pm Batch LDC Amendments DRAFT Text underlined is new text to be added Text strikethrough is current text to be deleted 9 L:\LDC Amendments\Current Work\Community Housing Plan Implementation\Initiative 1 - Regulatory Relief\LDC 4.02.39 Design Deviations for Housing that is Affordable 10-28-20 (submittal 2-rev2).docx 1 4. Sections 6.06.02.A.2 & 6.06.02.F - For local/internal sidewalks that are privately 2 maintained, the minimum sidewalk width shall be four feet, which can be of 3 concrete or asphalt material and shall be constructed over a compacted subgrade. 4 Asphalt shall also require a minimum of 4 inches of compacted limerock base, in 5 addition to the compacted subgrade. 6 7 5. Section 10.02.03.A.3 - Three-family housing structures proposed on a lot(s) of 8 record are exempt from the Site Development Plan provisions of LDC Section 9 10.02.03.A.2. 10 11 6. Section 10.02.04.C - For single-family developments, the clubhouse facility may 12 be included within the construction plans and final subdivision plats. The 13 clubhouse facility shall commence construction when fifty percent of the lots have 14 received a Certificate of Occupancy. 15 16 7. Section 10.02.08.I.2. - The set-aside of land or dedication of land for a public water 17 well at time of rezoning is not required, unless the site is located within a quarter-18 mile of a future raw water transmission main identified in the latest Board-adopted 19 Collier County 10-Year Water Supply Facilities Work Plan Update and in such a 20 way that the quantity of affordable housing units would not be impacted. 21 22 C. Criteria for design alternatives for housing that is affordable. The alternatives described 23 in Section 4.02.39.B. will be allowed when the following criteria are met: 24 25 1. Compatibility. 26 27 a. Setbacks from all project boundaries that abut property zoned or developed 28 for single family residential use shall be a minimum of one foot (setback) 29 per one foot maximum zoned height for principal structures. 30 9.A.7.c Packet Pg. 1786 Attachment: LDC 4.02.39 Design Deviations for Housing that is Affordable 10-28-20 (submittal 2-rev2) (14071 : 5:05 pm Batch LDC Amendments DRAFT Text underlined is new text to be added Text strikethrough is current text to be deleted 10 L:\LDC Amendments\Current Work\Community Housing Plan Implementation\Initiative 1 - Regulatory Relief\LDC 4.02.39 Design Deviations for Housing that is Affordable 10-28-20 (submittal 2-rev2).docx 1 b. For projects of more than three units, the required buffer for all project 2 boundaries that abut property zoned or developed for single family 3 residential use shall be a 15 foot wide Type ”B” landscape buffer per LDC 4 Section 4.06.02. 5 6 2. Affordability. To qualify for the design alternatives of this section a project shall 7 commit to one of the following agreements or commitments to provide a minimum 8 of 20 percent of the overall units as housing that is affordable: 9 10 a. Affordable Housing Density Bonus (AHDB) Agreement per Section 11 2.06.00; or 12 13 b. Affordable Housing Impact Fee Deferral Agreement per Code of 14 Ordinances Article IV of Chapter 74; or 15 16 c. PUD commitment or Developer’s Agreement (DA) for units that serve 17 households at the income levels (very-low, low, moderate, or gap) identified 18 in Section 2.06.00, or units that are priced within the limits established in 19 the Collier County Housing Demand Methodology, as updated yearly or 20 Board approved Table of Rental Rates, as updated yearly. 21 22 # # # # # # # # # # # # # 23 9.A.7.c Packet Pg. 1787 Attachment: LDC 4.02.39 Design Deviations for Housing that is Affordable 10-28-20 (submittal 2-rev2) (14071 : 5:05 pm Batch LDC Amendments 1 L:\LDC Amendments\Current Work\Communication Towers in Estates Zoning (PL20200001721)\Drafts\LDC 5.05.09 Cell Towers in Estates Districts 11-04-20 CCPC.docx LAND DEVELOPMENT CODE AMENDMENT PETITION PL20200001721 SUMMARY OF AMENDMENT This amendment implements the Golden Gate Area Master Plan (GGAMP) to allow cellular towers as a conditional use in the Estates (E) Zoning District on parcels that are a minimum of 2.25 acres and located adjacent to collector or arterial roads. It also corrects a few cross references. LDC SECTIONS TO BE AMENDED 2.03.01 Agricultural Districts 5.05.09 Communication Towers Origin Growth Management Department HEARING DATES BCC TBD CCPC 11/19/20 DSAC 10/07/20 DSAC-LDR 09/15/20 ADVISORY BOARD RECOMMENDATIONS DSAC-LDR Approval with changes DSAC Approval CCPC TBD BACKGROUND When the GGAMP amendments were adopted in the Growth Management Plan (GMP) on September 24, 2019, new provisions for various types of conditional uses were added to the Urban and Rural Golden Gate Estates Sub- elements of the GGAMP. One such provision is the “Special Exceptions to Conditional Use Locational Criteria” – Urban Section (B.1.A.3.e.5.) and Rural Section (B.1.A.3.d.4.). It states the following: “Conditional Use for a cellular tower is allowed in the Estates Zoning District only on parcels no smaller than 2.25 acres and adjacent to a roadway classified within the Transportation Element as a Collector or Arterial.” This amendment originated from a solid majority of residents surveyed, both in the rural Estates and the urban Estates, that had indicated dissatisfaction with existing cellular service. Over 75% of the rural Estates residents surveyed believed that communication towers should be conditional uses, and available at any locati on in the Estates. The proposed amendment shall allow cellular service to increase after the approval of new communication towers. By LDC section 2.01.03 A 4, communication towers are deemed permitted uses in all zoning districts, except CON districts, RFMU sending lands, NRPAS, HSAS, and FSAS and “…. limited to those providing wireless emergency telephone service, subject to all applicable provisions in section 5.05.09 of this Code.” However, LDC section 5.05.09 G.1 states “….no new tower of any height shall be permitted in the RSF-1 through RSF-6, RMF- 6, VR, MH, TTRVC and E Zoning districts.” The proposed amendment shall rectify this inconsistency, put into effect the GGAMP new provision, and provide for new communication towers to be allowed as a conditional use in the Estates Zoning District. The Transportation Element of the GMP’s maps depict all of the collector and arterial roads throughout the County. These roadway maps display where new communication towers can be located. See Exhibit A. In LDC section 5.05.09 G.1, the cross reference to LDC section 5.05.09 F.7 should read 5.05.09 G.7 which does address separation requirements and the second cross reference to LDC section 5.05.09 ((F) 3) should read 5.05.09 9.A.7.d Packet Pg. 1788 Attachment: LDC 5.05.09 Cell Towers in Estates Districts 11-04-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) 2 L:\LDC Amendments\Current Work\Communication Towers in Estates Zoning (PL20200001721)\Drafts\LDC 5.05.09 Cell Towers in Estates Districts 11-04-20 CCPC.docx G 3 which does address essential services sites. In LDC section 5.05.09 G.3 another scrivener error is corrected by inserting a period after the words “Essential services-Specified conditional uses”. DSAC-LDR Subcommittee Recommendations The DSAC-LDR Subcommittee reviewed the amendment on September 15, 2020 and unanimously recommended approval with the following changes: o In 5.05.9 B.25.d, add the following words “The required” to the beginning sentence of “Perimeter wall or fence height shall be…”; o Require the wall or fence height to be a “minimum of eight feet from finished grade…” and o Stipulate the 15 feet landscape buffer shall be a “Type B” landscape buffer and tree plantings within the buffer be a minimum 12 feet tall to screen the equipment cabinets. All recommendations have been incorporated in the LDC text. After DSAC’s recommendation of approval, staff modified subsection 5.05.09 G.25 b. to require evidence from the communications provider that it’s search radius for tower placement requires placement of the tower in the Estates Zoning District to meet its coverage requirements and that the tower cannot be co-located on an existing tower and provide the same service coverage. The revised text is highlighted in yellow. FISCAL & OPERATIONAL IMPACTS There are no anticipated fiscal or operational impacts to the County associated with this amendment. The amendment can have fiscal impacts on property owners in the Estates who will be eligible to apply for Conditional Use approval of communication towers. GMP CONSISTENCY The proposed LDC amendment has been reviewed by Comprehensive Planning staff and may be deemed consistent with the GMP. EXHIBITS: A) GMP Transportation Element Maps 9.A.7.d Packet Pg. 1789 Attachment: LDC 5.05.09 Cell Towers in Estates Districts 11-04-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT Text underlined is new text to be added Text strikethrough is current text to be deleted 3 L:\LDC Amendments\Current Work\Communication Towers in Estates Zoning (PL20200001721)\Drafts\LDC 5.05.09 Cell Towers in Estates Districts 11-04-20 CCPC.docx Amend the LDC as follows: 1 2.03.01 – Agricultural Districts. 2 3 * * * * * * * * * * * * * 4 5 B. Estate District (E). The purpose and intent of the estates district (E) is to provide lands for 6 low density residential development in a semi-rural to rural environment, with limited 7 agricultural activities. In addition to low density residential development with limited 8 agricultural activities, the E district is also designed to accommodate as conditional uses, 9 development that provides services for and is compatible with the low density residential, 10 semi-rural and rural character of the E district. The E district corresponds to and 11 implements the estates land use designation on the future land use map of the Collier 12 County GMP, although, in limited instances, it may occur outside of the estates land use 13 designation. The maximum density permissible in the E district shall be consistent with 14 and not exceed the density permissible or permitted under the estates district of the future 15 land use element of the Collier County GMP as provided under the Golden Gate Master 16 Plan. 17 18 1. The following subsections identify the uses that are permissible by right and the 19 uses that are allowable as accessory or conditional uses in the estates district 20 (E). 21 22 a. Permitted uses. 23 24 * * * * * * * * * * * * * 25 26 c. Conditional uses. For Estates zoning within the Golden Gate Estates 27 subdivision, the Golden Gate Area Master Plan in the GMP restricts the 28 location of conditional uses. The following uses are permissible as 29 conditional uses in the estates district (E), subject to the standards and 30 procedures established in LDC section 10.08.00: 31 32 * * * * * * * * * * * * * 33 34 8. Essential services, as set forth in LDC subsection 2.01.03 G. 35 36 9. Model homes and model sales centers, subject to compliance 37 with all other LDC requirements, to include but not limited to 38 section 5.04.04. 39 40 10. Ancillary plants. 41 42 11. Public schools without an agreement with Collier County, as 43 described in LDC section 5.05.14. Additional standards in LDC 44 section 5.05.14 shall also apply. 45 46 12. Communication towers up to specified heights, subject to LDC 47 section 5.05.09. 48 49 * * * * * * * * * * * * * 50 9.A.7.d Packet Pg. 1790 Attachment: LDC 5.05.09 Cell Towers in Estates Districts 11-04-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT Text underlined is new text to be added Text strikethrough is current text to be deleted 4 L:\LDC Amendments\Current Work\Communication Towers in Estates Zoning (PL20200001721)\Drafts\LDC 5.05.09 Cell Towers in Estates Districts 11-04-20 CCPC.docx # # # # # # # # # # # # # 1 2 5.05.09 – Communication Towers 3 4 * * * * * * * * * * * * * 5 6 G. Development standards for communication towers. 7 8 1. Except to the extent that amateur radio towers, and ground-mounted antennas 9 with a height not to exceed twenty (20) feet, are exempted by subsection 5.05.09 10 herein, no new tower of any height shall be permitted in the RSF-1 through RSF-11 6, RMF-6, VR, MH, TTRVC, and E zoning districts. However, notwithstanding other 12 provisions of this section, including the separation requirements of subsection 13 5.05.09 (F)(7) G.7. below, towers may be allowed to any height as a conditional 14 use in the Estate (E) zoning district only on parcels designated as Urban or Rural 15 Golden Gate Estates Sub-Element in the Golden Gate Area Master Plan or sites 16 approved for a specified essential service listed in subsection 5.05.09 ((F)(3) G.3. 17 below. There shall be no exception to this subsection except for conditional use 18 applications by a government for a governmental use. 19 20 * * * * * * * * * * * * * 21 22 3. Essential services —Specified conditional uses. Except in the RSF-1 through 23 RSF-6, and RMF-6 zoning districts, towers may be allowed to any height as a 24 conditional use on sites approved for a conditional use essential service for any 25 of the following conditional uses: safety service facilities including, but not 26 necessarily limited to, fire stations, sheriff's substation or facility, emergency 27 medical services facility, and all other similar uses where a communications 28 tower could be considered an accessory or logically associated use with the 29 safety service conditional use on the site. In addition, communications towers 30 can be approved as a conditional use for a stand-alone essential service facility, 31 provided the tower is to be owned by, or to be leased to, a governmental entity, 32 and the primary uses of the tower are for governmental purposes. 33 34 * * * * * * * * * * * * * 35 36 7. With the exception of rooftop towers and towers on essential services sites, each 37 new communication tower shall meet the following separation requirements: 38 39 a. Each new tower that exceeds 185 feet in height shall be located not less 40 than two and one-half (2.5) times the height of the tower from all RSF-1 41 through RSF-6, and RMF-6 zoning districts, including PUDs where the 42 adjacent use(s) is/are, or comparable to, the RSF-1 through RSF-6 and 43 RMF-6 zoning districts. If a part of a PUD is not developed, and it is 44 inconclusive whether the part of a PUD area within such minimum 45 separation distance from the proposed tower site may be developed with a 46 density of six (6) units per acre or less, it shall be presumed that the PUD 47 area nearest to the proposed site will be developed at the lowest density 48 possible under the respective PUD. 49 50 9.A.7.d Packet Pg. 1791 Attachment: LDC 5.05.09 Cell Towers in Estates Districts 11-04-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT Text underlined is new text to be added Text strikethrough is current text to be deleted 5 L:\LDC Amendments\Current Work\Communication Towers in Estates Zoning (PL20200001721)\Drafts\LDC 5.05.09 Cell Towers in Estates Districts 11-04-20 CCPC.docx b. In addition, each such new tower that exceeds a height of seventy-five (75) 1 feet, excluding antennas, shall be separated from all boundaries of 2 surrounding property zoned RMF-12, RMF-16, E, RT, VR, MH, TTRVC,H, 3 and the residential areas of PUDs with existing or planned densities greater 4 than six (6) units per acre by not less than the total height of the tower 5 including its antennas; and from all other surrounding property boundaries 6 by a distance not less than one-half (1/2) the height of the tower and its 7 antennas, or the tower's certified collapse area, whichever distance is 8 greater. 9 10 c. Communication towers in the Estate (E) zoning district shall be separated 11 from residentially zoned properties as follows: 12 13 i. New towers up to 75 feet in height shall be located not less than the 14 total height of the tower and antennas from all residentially zoned 15 properties. 16 17 ii. New towers over 75 feet in height shall be located not less than two 18 and one-half times the height of the tower and antennas, or the 19 certified collapse area, whichever distance is greater, from all 20 residentially zoned properties. 21 22 * * * * * * * * * * * * * 23 24 25. Communication towers in the Estate (E) Zoning District. 25 26 Communication towers are allowed on parcels designated as Urban or Rural 27 Golden Gate Estates Sub-element in the Golden Gate Area Master Plan and are 28 subject to the following: 29 30 a. The parcel is a minimum 2.25 acres and adjacent to an arterial or collector 31 road. 32 33 b. The communications provider has provided evidence that the 34 communications provider’s search radius for tower placement requires 35 placement of the tower in the Estates zoning district to meet its coverage 36 requirements and the tower cannot be co-located on an existing tower and 37 provide the same service coverage. 38 39 c. All security and site lighting shall be less than 20 feet above grade, fully 40 shielded, and directed away from neighboring properties. 41 42 d. Fencing height and landscaping. The required perimeter wall or fence 43 height shall be a minimum of eight feet from finished grade of base 44 supporting structure and no greater than 10 feet. A minimum 15 feet 45 landscape Type B buffer along the perimeter of wall or fence is required 46 and tree plantings within the buffer shall be 12 feet high. 47 48 e. Equipment cabinets. Overall height of ground-mounted equipment or 49 equipment enclosure shall not exceed 12 feet. 50 51 9.A.7.d Packet Pg. 1792 Attachment: LDC 5.05.09 Cell Towers in Estates Districts 11-04-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) DRAFT Text underlined is new text to be added Text strikethrough is current text to be deleted 6 L:\LDC Amendments\Current Work\Communication Towers in Estates Zoning (PL20200001721)\Drafts\LDC 5.05.09 Cell Towers in Estates Districts 11-04-20 CCPC.docx # # # # # # # # # # # # # 1 9.A.7.d Packet Pg. 1793 Attachment: LDC 5.05.09 Cell Towers in Estates Districts 11-04-20 CCPC [Revision 1] (14071 : 5:05 pm Batch LDC Amendments #2) Exhibit A – GMP Transportation Element Maps 7 L:\LDC Amendments\Current Work\Communication Towers in Estates Zoning (PL20200001721)\Drafts\LDC 5.05.09 Cell Towers in Estates Districts 11-04-20 CCPC.docx 9.A.7.dPacket Pg. 1794Attachment: LDC 5.05.09 Cell Towers in Estates Districts 11-04-20 CCPC [Revision 1] (14071 : 5:05 pm Exhibit A – GMP Transportation Element Maps 8 L:\LDC Amendments\Current Work\Communication Towers in Estates Zoning (PL20200001721)\Drafts\LDC 5.05.09 Cell Towers in Estates Districts 11-04-20 CCPC.docx 9.A.7.dPacket Pg. 1795Attachment: LDC 5.05.09 Cell Towers in Estates Districts 11-04-20 CCPC [Revision 1] (14071 : 5:05 pm Exhibit A – GMP Transportation Element Maps 9 L:\LDC Amendments\Current Work\Communication Towers in Estates Zoning (PL20200001721)\Drafts\LDC 5.05.09 Cell Towers in Estates Districts 11-04-20 CCPC.docx 9.A.7.dPacket Pg. 1796Attachment: LDC 5.05.09 Cell Towers in Estates Districts 11-04-20 CCPC [Revision 1] (14071 : 5:05 pm Exhibit A – GMP Transportation Element Maps 10 L:\LDC Amendments\Current Work\Communication Towers in Estates Zoning (PL20200001721)\Drafts\LDC 5.05.09 Cell Towers in Estates Districts 11-04-20 CCPC.docx 9.A.7.dPacket Pg. 1797Attachment: LDC 5.05.09 Cell Towers in Estates Districts 11-04-20 CCPC [Revision 1] (14071 : 5:05 pm